BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780692|ref|YP_003065105.1| hypothetical protein CLIBASIA_02895 [Candidatus Liberibacter asiaticus str. psy62] (72 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254780692|ref|YP_003065105.1| hypothetical protein CLIBASIA_02895 [Candidatus Liberibacter asiaticus str. psy62] gi|254040369|gb|ACT57165.1| hypothetical protein CLIBASIA_02895 [Candidatus Liberibacter asiaticus str. psy62] Length = 72 Score = 147 bits (372), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 72/72 (100%), Positives = 72/72 (100%) Query: 1 MEFLGGIIFTIICLYMMNGYQKEKKDIERTRLNIERTRLTCEEARHTQDENLTKACKDEL 60 MEFLGGIIFTIICLYMMNGYQKEKKDIERTRLNIERTRLTCEEARHTQDENLTKACKDEL Sbjct: 1 MEFLGGIIFTIICLYMMNGYQKEKKDIERTRLNIERTRLTCEEARHTQDENLTKACKDEL 60 Query: 61 KNIKSNPKEKAK 72 KNIKSNPKEKAK Sbjct: 61 KNIKSNPKEKAK 72 >gi|149378466|ref|ZP_01896154.1| acyl-CoA dehydrogenase [Marinobacter algicola DG893] gi|149357246|gb|EDM45780.1| acyl-CoA dehydrogenase [Marinobacter algicola DG893] Length = 400 Score = 33.9 bits (76), Expect = 7.3, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 26/48 (54%) Query: 17 MNGYQKEKKDIERTRLNIERTRLTCEEARHTQDENLTKACKDELKNIK 64 ++ + +KDI R+R+ IE+ RL +A H D K + E+ IK Sbjct: 291 LSSFDSIRKDIARSRMEIEQARLMTLKAAHMMDTVGNKVARQEIAMIK 338 >gi|86133626|ref|ZP_01052208.1| DNA recombination protein RmuC [Polaribacter sp. MED152] gi|85820489|gb|EAQ41636.1| DNA recombination protein RmuC [Polaribacter sp. MED152] Length = 447 Score = 33.5 bits (75), Expect = 8.9, Method: Compositional matrix adjust. Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 9/73 (12%) Query: 3 FLGGIIFTIICLYMMN-----GYQKEKKDIERTRLNIERTRLTCEEARHTQDENLTKACK 57 FL +IF+ I LY+ ++KEK ++E+ + E L ++A+ T + N + K Sbjct: 8 FLIALIFSFIGLYIGKLLAKVNFEKEKTNLEKEKSTFEERVLLLQQAKDTLENNFIELQK 67 Query: 58 DELKNIKSNPKEK 70 D IK+N EK Sbjct: 68 D----IKTNQLEK 76 Searching..................................................done Results from round 2 CONVERGED! >gi|254780692|ref|YP_003065105.1| hypothetical protein CLIBASIA_02895 [Candidatus Liberibacter asiaticus str. psy62] gi|254040369|gb|ACT57165.1| hypothetical protein CLIBASIA_02895 [Candidatus Liberibacter asiaticus str. psy62] Length = 72 Score = 130 bits (328), Expect = 5e-29, Method: Composition-based stats. Identities = 72/72 (100%), Positives = 72/72 (100%) Query: 1 MEFLGGIIFTIICLYMMNGYQKEKKDIERTRLNIERTRLTCEEARHTQDENLTKACKDEL 60 MEFLGGIIFTIICLYMMNGYQKEKKDIERTRLNIERTRLTCEEARHTQDENLTKACKDEL Sbjct: 1 MEFLGGIIFTIICLYMMNGYQKEKKDIERTRLNIERTRLTCEEARHTQDENLTKACKDEL 60 Query: 61 KNIKSNPKEKAK 72 KNIKSNPKEKAK Sbjct: 61 KNIKSNPKEKAK 72 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.317 0.134 0.379 Lambda K H 0.267 0.0416 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,160,996,399 Number of Sequences: 14124377 Number of extensions: 31829056 Number of successful extensions: 124245 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 124233 Number of HSP's gapped (non-prelim): 12 length of query: 72 length of database: 4,842,793,630 effective HSP length: 44 effective length of query: 28 effective length of database: 4,221,321,042 effective search space: 118196989176 effective search space used: 118196989176 T: 11 A: 40 X1: 15 ( 6.9 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 75 (33.5 bits)