RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780692|ref|YP_003065105.1| hypothetical protein CLIBASIA_02895 [Candidatus Liberibacter asiaticus str. psy62] (72 letters) >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Score = 27.9 bits (61), Expect = 0.62 Identities = 11/43 (25%), Positives = 20/43 (46%), Gaps = 6/43 (13%) Query: 16 MMNGYQKEKKD------IERTRLNIERTRLTCEEARHTQDENL 52 + NGY EKK+ +E E ++ T E+ +H + + Sbjct: 911 LFNGYNPEKKEMIQEVIVEEDLEPFEASKETAEQFKHQHGDKV 953 >3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide- binding, phosphoprotein, polymorphism; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3fzh_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 1ngh_A* 1ngd_A* 1ngf_A* 1bup_A* 1nga_A* ... Length = 404 Score = 25.3 bits (55), Expect = 3.3 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Query: 3 FLGGIIFT-IICLYMMNGYQKE-KKDIERTRLNIERTRLTCEEARHT 47 LGG F + ++ ++++ KKDI + + R R CE A+ T Sbjct: 248 HLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRT 294 >2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Length = 605 Score = 24.7 bits (54), Expect = 5.1 Identities = 11/47 (23%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Query: 3 FLGGIIFT-IICLYMMNGYQKE-KKDIERTRLNIERTRLTCEEARHT 47 LGG F + Y++ ++K+ D+ L ++R + E+A+ Sbjct: 226 HLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIE 272 >2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Length = 509 Score = 24.4 bits (53), Expect = 6.8 Identities = 12/47 (25%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Query: 3 FLGGIIFT-IICLYMMNGYQKE-KKDIERTRLNIERTRLTCEEARHT 47 LGG F +I Y++N +++E D+ + ++ ++R + E+A+ Sbjct: 195 HLGGDDFDQVIIDYLVNQFKQEHGIDLSKDKMALQRLKDAAEKAKKE 241 >1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554 Score = 24.1 bits (52), Expect = 7.5 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Query: 3 FLGGIIFT-IICLYMMNGYQKE-KKDIERTRLNIERTRLTCEEARHT 47 LGG F + + + ++++ KKDI + + R R CE A+ T Sbjct: 227 HLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRT 273 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.317 0.134 0.379 Gapped Lambda K H 0.267 0.0450 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 599,902 Number of extensions: 20960 Number of successful extensions: 67 Number of sequences better than 10.0: 1 Number of HSP's gapped: 67 Number of HSP's successfully gapped: 17 Length of query: 72 Length of database: 5,693,230 Length adjustment: 42 Effective length of query: 30 Effective length of database: 4,674,982 Effective search space: 140249460 Effective search space used: 140249460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.7 bits)