RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780693|ref|YP_003065106.1| transcriptional regulator protein [Candidatus Liberibacter asiaticus str. psy62] (235 letters) >gnl|CDD|99777 cd06170, LuxR_C_like, C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many are active as homodimers. Many are two domain proteins in which the DNA binding property of the C-terminal DNA binding domain is modulated by modifications of the N-terminal domain. For example in the case of Lux R which participates in the regulation of gene expression in response to fluctuations in cell-population density (quorum-sensing), a signaling molecule, the pheromone Acyl HSL (N-acyl derivatives of homoserine lactone), binds to the N-terminal domain and leads to LuxR dimerization. For others phophorylation of the N-terminal domain leads to multimerization, for example Escherichia coli NarL and Sinorhizobium melilot FixJ. NarL controls gene expression of many respiratory-related operons when environmental nitrate or nitrite is present under anerobic conditions. FixJ is involved in the transcriptional activation of nitrogen fixation genes. The group also includes small proteins which lack an N-terminal signaling domain, such as Bacillus subtilis GerE. GerE is dimeric and acts in conjunction with sigmaK as an activator or a repressor modulating the expression of various genes in particular those encoding the spore-coat. These LuxR family regulators may share a similar organization of their target binding sites. For example the LuxR dimer binds the lux box, a 20bp inverted repeat, GerE dimers bind two 12bp consensus sequences in inverted orientation having the central four bases overlap, and the NarL dimer binds two 7bp inverted repeats separated by 2 bp.. Length = 57 Score = 70.6 bits (174), Expect = 3e-13 Identities = 25/57 (43%), Positives = 35/57 (61%) Query: 174 LTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIR 230 LT RE L+L +G T++EIA+ LG+S TV +L + KL +R Q +A AIR Sbjct: 1 LTPREREVLRLLAEGKTNKEIADILGISEKTVKTHLRNIMRKLGVKSRTQLVAYAIR 57 >gnl|CDD|32632 COG2771, CsgD, DNA-binding HTH domain-containing proteins [Transcription]. Length = 65 Score = 65.0 bits (158), Expect = 2e-11 Identities = 25/61 (40%), Positives = 36/61 (59%) Query: 174 LTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGY 233 LT RE L+L G +++EIA LG+S TV +L + KL NR++ +A A+R G Sbjct: 5 LTPREREILRLVAQGKSNKEIARILGISEETVKTHLRNIYRKLGVKNRVELVALALRLGL 64 Query: 234 I 234 I Sbjct: 65 I 65 >gnl|CDD|32379 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]. Length = 211 Score = 63.4 bits (154), Expect = 5e-11 Identities = 33/112 (29%), Positives = 53/112 (47%), Gaps = 6/112 (5%) Query: 129 NGYVIFTSEFLMLANEVIIEAHGACY------QVITDFLELFKKRSSAARNLTERETSCL 182 +GY++ + L + A G Y + + L + A LT RE L Sbjct: 98 DGYLLKDASPEELVEAIRAVAAGGTYLPPDIARKLAGLLPSSSAEAPLAELLTPRELEVL 157 Query: 183 QLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYI 234 +L +G +++EIAE+L LS TV ++ + KL NR +A +A+R G I Sbjct: 158 RLLAEGLSNKEIAEELNLSEKTVKTHVSNILRKLGVRNRTEAAIRALRLGLI 209 >gnl|CDD|109261 pfam00196, GerE, Bacterial regulatory proteins, luxR family. Length = 58 Score = 59.9 bits (146), Expect = 6e-10 Identities = 19/56 (33%), Positives = 33/56 (58%) Query: 173 NLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKA 228 +L+ RE L+L G +++EIA+ LG+S TV + + KL+ +R++ I A Sbjct: 3 SLSPREREVLRLLAAGKSNKEIADILGISEKTVKVHRSNIMRKLNVHSRVELIRLA 58 >gnl|CDD|32733 COG2909, MalT, ATP-dependent transcriptional regulator [Transcription]. Length = 894 Score = 54.2 bits (130), Expect = 3e-08 Identities = 24/74 (32%), Positives = 38/74 (51%) Query: 159 DFLELFKKRSSAARNLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDA 218 E F + L++RE L L G ++EEIA++L +S+ TV ++ + KL Sbjct: 817 HLDEEFVEGLLNELPLSQRELEVLGLIAQGLSNEEIAQELFISLTTVKTHIRNIYQKLGV 876 Query: 219 VNRIQAIAKAIRFG 232 NR QA+ +A G Sbjct: 877 ANRTQAVQRAKELG 890 >gnl|CDD|34204 COG4566, TtrR, Response regulator [Signal transduction mechanisms]. Length = 202 Score = 36.8 bits (85), Expect = 0.005 Identities = 18/60 (30%), Positives = 29/60 (48%) Query: 173 NLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFG 232 LT RE L L G +++IA LG+S TV + + K+ A + + + A+ G Sbjct: 142 TLTPRERQVLDLVVRGLMNKQIAFDLGISERTVELHRANVMEKMQARSLAELVRMALSLG 201 >gnl|CDD|100119 cd06171, Sigma70_r4, Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or plastid core RNA polymerase to specific promoter elements located upstream of transcription initiation points. The SR4 of Ec sigma70 and other essential primary SFs contact promoter sequences located 35 base-pairs upstream of the initiation point, recognizing a 6-base-pair -35 consensus TTGACA. Sigma70 related SFs also include SFs which are dispensable for bacterial cell growth for example Ec sigmaS, SFs which activate regulons in response to a specific signal for example heat-shock Ec sigmaH, and a group of SFs which includes the extracytoplasmic function (ECF) SFs and is typified by Ec sigmaE which contains SR2 and -4 only. ECF SFs direct the transcription of genes that regulate various responses including periplasmic stress and pathogenesis. Ec sigmaE SR4 also contacts the -35 element, but recognizes a different consensus (a 7-base-pair GGAACTT). Plant SFs recognize sigma70 type promoters and direct transcription of the major plastid RNA polymerase, plastid-encoded RNA polymerase (PEP).. Length = 55 Score = 35.2 bits (82), Expect = 0.017 Identities = 21/44 (47%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Query: 174 LTERETSCLQLA-GDGYTSEEIAEKLGLSVHTVNAYLGSATVKL 216 L ERE + L G+G + EEIAE LG+S TV L A KL Sbjct: 11 LPEREREVILLRFGEGLSYEEIAEILGISRSTVRQRLHRALKKL 54 >gnl|CDD|31783 COG1595, RpoE, DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription]. Length = 182 Score = 34.3 bits (78), Expect = 0.032 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Query: 169 SAARNLTERETSCLQLA-GDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDA 218 A L R+ L +G + EEIAE LG+SV TV + L A KL Sbjct: 123 RALARLPPRQREAFLLRYLEGLSYEEIAEILGISVGTVKSRLHRARKKLRE 173 >gnl|CDD|146939 pfam04545, Sigma70_r4, Sigma-70, region 4. Region 4 of sigma-70 like sigma-factors are involved in binding to the -35 promoter element via a helix-turn-helix motif. Due to the way Pfam works, the threshold has been set artificially high to prevent overlaps with other helix-turn-helix families. Therefore there are many false negatives. Length = 50 Score = 33.9 bits (79), Expect = 0.034 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 174 LTERETSCLQLA-GDGYTSEEIAEKLGLSVHTV 205 L RE L L G+G T EEI E+LG+S V Sbjct: 5 LPPREREVLVLRFGEGLTLEEIGERLGISRERV 37 >gnl|CDD|143331 cd01392, HTH_LacI, Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators. HTH-DNA binding domain of the LacI (lactose operon repressor) family of bacterial transcriptional regulators and their putative homologs found in plants. The LacI family has more than 500 members distributed among almost all bacterial species. The monomeric proteins of the LacI family contain common structural features that include a small DNA-binding domain with a helix-turn-helix motif in the N-terminus, a regulatory ligand-binding domain which exhibits the type I periplasmic binding protein fold in the C-terminus for oligomerization and for effector binding, and an approximately 18-amino acid linker connecting these two functional domains. In LacI-like transcriptional regulators, the ligands are monosaccharides including lactose, ribose, fructose, xylose, arabinose, galactose/glucose, and other sugars, with a few exceptions. When the C-terminal domain of the LacI family repressor binds its ligand, it undergoes a conformational change which affects the DNA-binding affinity of the repressor. In Escherichia coli, LacI represses transcription by binding with high affinity to the lac operon at a specific operator DNA sequence until it interacts with the physiological inducer allolactose or a non-degradable analog IPTG (isopropyl-beta-D-thiogalactopyranoside). Induction of the repressor lowers its affinity for the operator sequence, thereby allowing transcription of the lac operon structural genes (lacZ, lacY, and LacA). The lac repressor occurs as a tetramer made up of two functional dimers. Thus, two DNA binding domains of a dimer are required to bind the inverted repeat sequences of the operator DNA binding sites. Length = 52 Score = 32.8 bits (76), Expect = 0.090 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Query: 193 EIAEKLGLSVHTVNAYL-GSATVKLDAVNRIQAIAKAIRFGYI 234 +IA G+SV TV+ L G V + R+ A A+ + GY Sbjct: 2 DIARAAGVSVATVSRVLNGKPRVSEETRERVLAAAEEL--GYR 42 >gnl|CDD|33219 COG3413, COG3413, Predicted DNA binding protein [General function prediction only]. Length = 215 Score = 30.4 bits (68), Expect = 0.47 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 8/52 (15%) Query: 173 NLTERETSCLQLAGD-GY-------TSEEIAEKLGLSVHTVNAYLGSATVKL 216 +LT+R+ L+LA GY + +++A++LG+S T++ +L A KL Sbjct: 155 DLTDRQLEVLRLAYKMGYFDYPRRVSLKDLAKELGISKSTLSEHLRRAERKL 206 >gnl|CDD|31797 COG1609, PurR, Transcriptional regulators [Transcription]. Length = 333 Score = 30.3 bits (68), Expect = 0.49 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Query: 190 TSEEIAEKLGLSVHTVNAYL-GSATVKLDAVNRIQAIAKAIRFGYI 234 T +++A+ G+S TV+ L GS V + ++ A K + GY Sbjct: 2 TIKDVAKLAGVSKATVSRVLNGSPYVSEETREKVLAAIKEL--GYR 45 >gnl|CDD|113729 pfam04967, HTH_10, HTH DNA binding domain. Length = 53 Score = 30.3 bits (69), Expect = 0.51 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 8/51 (15%) Query: 174 LTERETSCLQLAGD-GY-------TSEEIAEKLGLSVHTVNAYLGSATVKL 216 LT+R+ L+LA GY T +++A++LG+S T++ +L A KL Sbjct: 1 LTDRQREILRLAYKMGYFDYPRRVTLKDLAKELGISKSTLSEHLRRAESKL 51 >gnl|CDD|31509 COG1318, COG1318, Predicted transcriptional regulators [Transcription]. Length = 182 Score = 29.2 bits (65), Expect = 0.97 Identities = 13/35 (37%), Positives = 16/35 (45%) Query: 188 GYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRI 222 G T EIAE+LG + TV +L T V Sbjct: 61 GMTISEIAEELGRTEQTVRNHLKGETKAGQLVRET 95 >gnl|CDD|32535 COG2390, DeoR, Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription]. Length = 321 Score = 29.4 bits (66), Expect = 0.98 Identities = 13/26 (50%), Positives = 17/26 (65%) Query: 187 DGYTSEEIAEKLGLSVHTVNAYLGSA 212 +G T EIAE+LG+S TV+ L A Sbjct: 25 EGLTQSEIAERLGISRATVSRLLAKA 50 >gnl|CDD|144828 pfam01381, HTH_3, Helix-turn-helix. This large family of DNA binding helix-turn helix proteins includes Cro and CI. Length = 55 Score = 28.7 bits (65), Expect = 1.5 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 4/44 (9%) Query: 188 GYTSEEIAEKLGLSVHTVNAYL-GSATVKLDAVNRIQAIAKAIR 230 G + EE+AEKLG+S T++ G L+ ++ +A+A+ Sbjct: 9 GLSQEELAEKLGVSRSTISKIENGKREPSLE---TLKKLAEALG 49 >gnl|CDD|33163 COG3355, COG3355, Predicted transcriptional regulator [Transcription]. Length = 126 Score = 28.3 bits (63), Expect = 1.7 Identities = 15/65 (23%), Positives = 26/65 (40%), Gaps = 4/65 (6%) Query: 173 NLTERETSCLQL---AGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAI 229 L+E + + T +E+AE L S TV L + ++ V R + K Sbjct: 24 GLSELDVEVYKALLEENGPLTVDELAEILNRSRSTVYRSLQN-LLEAGLVEREKVNLKGG 82 Query: 230 RFGYI 234 + Y+ Sbjct: 83 GYYYL 87 >gnl|CDD|31547 COG1356, COG1356, Uncharacterized protein conserved in archaea [Function unknown]. Length = 143 Score = 28.0 bits (62), Expect = 2.5 Identities = 15/57 (26%), Positives = 23/57 (40%) Query: 174 LTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIR 230 LTE++ L L G T EIA L + V+A A ++ + + I Sbjct: 9 LTEQQIKVLVLREKGLTQSEIARILKTTRANVSAIEKRALENIEKARNTLLLWEQIN 65 >gnl|CDD|37022 KOG1811, KOG1811, KOG1811, Predicted Zn2+-binding protein, contains FYVE domain [General function prediction only]. Length = 1141 Score = 27.1 bits (59), Expect = 3.9 Identities = 24/88 (27%), Positives = 33/88 (37%), Gaps = 7/88 (7%) Query: 131 YVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETSCLQLAGDGYT 190 +F +L E GA Y + L+LF A + LQLAG G Sbjct: 124 IAGKRLKFFLL----FEEMFGASYAHCSS-LKLFMGEQLEAECKEDPAGLALQLAGKGAV 178 Query: 191 SE--EIAEKLGLSVHTVNAYLGSATVKL 216 E+AE+ G S+ + LG K Sbjct: 179 GAALEVAEEAGFSIDERDELLGRQAEKA 206 >gnl|CDD|28977 cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.. Length = 58 Score = 27.0 bits (60), Expect = 4.0 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 4/43 (9%) Query: 188 GYTSEEIAEKLGLSVHTVNAYL-GSATVKLDAVNRIQAIAKAI 229 G T EE+AEKLG+S T++ G L+ ++ +AKA+ Sbjct: 12 GLTQEELAEKLGVSRSTISRIENGKRNPSLE---TLEKLAKAL 51 >gnl|CDD|109553 pfam00502, Phycobilisome, Phycobilisome protein. Length = 157 Score = 26.8 bits (60), Expect = 5.0 Identities = 5/26 (19%), Positives = 12/26 (46%) Query: 204 TVNAYLGSATVKLDAVNRIQAIAKAI 229 ++ ++ +L+A + A A I Sbjct: 21 SLKGFVQRGNARLEAAEALTANASKI 46 >gnl|CDD|33221 COG3415, COG3415, Transposase and inactivated derivatives [DNA replication, recombination, and repair]. Length = 138 Score = 26.8 bits (59), Expect = 5.1 Identities = 10/39 (25%), Positives = 20/39 (51%) Query: 173 NLTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGS 211 + RE + G+G + E A++ G+S+ TV ++ Sbjct: 6 SNDLRERVVDAVVGEGLSCREAAKRFGVSISTVYRWVRR 44 >gnl|CDD|133386 cd01111, HTH_MerD, Helix-Turn-Helix DNA binding domain of the MerD transcription regulator. Helix-turn-helix (HTH) transcription regulator MerD. The putative secondary regulator of mercury resistance (mer) operons, MerD, has been shown to down-regulate the expression of this operon in gram-negative bacteria. It binds to the same operator DNA as MerR that activates transcription of the operon in the presence of mercury ions. The MerD protein shares the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily, which promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are conserved and contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules such as metal ions, drugs, and organic substrates. Length = 107 Score = 27.0 bits (60), Expect = 5.3 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 189 YTSEEIAEKLGLSVHTVNAYL 209 Y+ ++A G+SVH V YL Sbjct: 1 YSISQLALDAGVSVHIVRDYL 21 >gnl|CDD|133384 cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates. Length = 113 Score = 26.7 bits (60), Expect = 5.6 Identities = 10/16 (62%), Positives = 12/16 (75%) Query: 189 YTSEEIAEKLGLSVHT 204 YT +E+AEK GLS T Sbjct: 1 YTIKEVAEKTGLSADT 16 >gnl|CDD|32494 COG2345, COG2345, Predicted transcriptional regulator [Transcription]. Length = 218 Score = 26.4 bits (58), Expect = 6.9 Identities = 10/35 (28%), Positives = 17/35 (48%) Query: 175 TERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYL 209 T L +++E+AE+LG+S V +L Sbjct: 12 TRERILELLKKSGPVSADELAEELGISPMAVRRHL 46 >gnl|CDD|35043 COG5484, COG5484, Uncharacterized conserved protein [Function unknown]. Length = 279 Score = 26.3 bits (57), Expect = 7.0 Identities = 9/22 (40%), Positives = 16/22 (72%) Query: 187 DGYTSEEIAEKLGLSVHTVNAY 208 G ++IAEKLG+S +T+ ++ Sbjct: 18 KGMKLKDIAEKLGVSPNTIKSW 39 >gnl|CDD|36988 KOG1777, KOG1777, KOG1777, Putative Zn-finger protein [General function prediction only]. Length = 625 Score = 26.5 bits (58), Expect = 7.3 Identities = 19/76 (25%), Positives = 26/76 (34%), Gaps = 10/76 (13%) Query: 20 RLHLIQNRIKARNFALYTINSALDFPRRQQLICELHN------YDLDSGDIPNILIETYG 73 ++N I A NFA I S + RQ E+ Y G E YG Sbjct: 267 LGQFLENSIYANNFAGVWITSNSNPTIRQ---NEIIFGAQGGVYIFGDGRGLFEFNEIYG 323 Query: 74 DDFL-FHFNSGLLPII 88 + L + PI+ Sbjct: 324 NALLGIQIRTNSTPIV 339 >gnl|CDD|31840 COG1654, BirA, Biotin operon repressor [Transcription]. Length = 79 Score = 26.0 bits (57), Expect = 8.0 Identities = 10/39 (25%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Query: 172 RNLTERETSCLQLAGDGYTS-EEIAEKLGLSVHTVNAYL 209 ++ ++ L L + S E++AE+LG+S V ++ Sbjct: 2 KDTSQMLLLLLLLLTGNFVSGEKLAEELGISRTAVWKHI 40 >gnl|CDD|34203 COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms]. Length = 224 Score = 26.3 bits (58), Expect = 8.2 Identities = 11/28 (39%), Positives = 16/28 (57%) Query: 182 LQLAGDGYTSEEIAEKLGLSVHTVNAYL 209 L+ T+EE+A+ LG+S T YL Sbjct: 167 LKEPDQELTAEELAQALGISRVTARRYL 194 >gnl|CDD|28976 cd00092, HTH_CRP, helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family.. Length = 67 Score = 26.0 bits (57), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Query: 190 TSEEIAEKLGLSVHTVNAYLGS 211 T +EIA+ LGL+ TV+ L Sbjct: 27 TRQEIADYLGLTRETVSRTLKE 48 >gnl|CDD|144749 pfam01268, FTHFS, Formate--tetrahydrofolate ligase. Length = 555 Score = 26.2 bits (59), Expect = 8.9 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Query: 192 EEIAEKLGLSVHTVNAYLGS--ATVKLDAVNRIQ 223 EIAEKLGL + Y G A V LD ++R++ Sbjct: 17 TEIAEKLGLPEDELEPY-GKYKAKVSLDVLDRLK 49 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0783 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,735,490 Number of extensions: 143139 Number of successful extensions: 439 Number of sequences better than 10.0: 1 Number of HSP's gapped: 439 Number of HSP's successfully gapped: 38 Length of query: 235 Length of database: 6,263,737 Length adjustment: 91 Effective length of query: 144 Effective length of database: 4,297,318 Effective search space: 618813792 Effective search space used: 618813792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 56 (25.2 bits)