HHsearch alignment for GI: 254780694 and conserved domain: PRK00215

>PRK00215 LexA repressor; Validated.
Probab=96.72  E-value=0.0035  Score=39.28  Aligned_cols=42  Identities=36%  Similarity=0.521  Sum_probs=37.6

Q ss_pred             CCHHHHHHHHHHHC-------CCCHHHHHHHHCC-CHHHHHHHHHHHHHH
Q ss_conf             89779999999985-------9997999999499-988999999999998
Q gi|254780694|r  186 LTGREVECLTWISE-------GKTSDEIAVILGI-SRNTVNNYIASIMRK  227 (246)
Q Consensus       186 LT~RE~eVl~lia~-------G~t~~eIA~~L~i-S~~TV~~hl~~i~~K  227 (246)
T Consensus         2 LT~kQ~~il~fI~~~~~~~g~~Ps~rEI~~~~g~~S~~tV~~~l~~Le~k   51 (204)
T PRK00215          2 LTARQQEILDFIKDRIEETGYPPSRREIADALGLRSPSAVHEHLKALERK   51 (204)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHC
T ss_conf             89899999999999999748899899999980999818999999999879