HHsearch alignment for GI: 254780694 and conserved domain: PRK05803

>PRK05803 sporulation sigma factor SigK; Reviewed.
Probab=97.00  E-value=0.002  Score=40.92  Aligned_cols=46  Identities=35%  Similarity=0.322  Sum_probs=42.4

Q ss_pred             CCCCHHHHHHHHHH-----HCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHC
Q ss_conf             88897799999999-----85999799999949998899999999999807
Q gi|254780694|r  184 FELTGREVECLTWI-----SEGKTSDEIAVILGISRNTVNNYIASIMRKTA  229 (246)
Q Consensus       184 ~~LT~RE~eVl~li-----a~G~t~~eIA~~L~iS~~TV~~hl~~i~~KLg  229 (246)
T Consensus       173 ~~L~~REr~II~~RfGL~~~~~~Tl~eIg~~lgiSrERVRQIe~~Al~KLr  223 (228)
T PRK05803        173 DILDPREKEVIEMRYGLGDGKEKTQREIAKALGISRSYVSRIEKKALKKLF  223 (228)
T ss_pred             HCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             518988999999986478999715999999989799999999999999999