HHsearch alignment for GI: 254780694 and conserved domain: PRK06811

>PRK06811 RNA polymerase factor sigma-70; Validated.
Probab=98.03  E-value=1.6e-05  Score=54.40  Aligned_cols=46  Identities=24%  Similarity=0.297  Sum_probs=42.0

Q ss_pred             CCCCHHHHHHHHHH-HCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHC
Q ss_conf             88897799999999-85999799999949998899999999999807
Q gi|254780694|r  184 FELTGREVECLTWI-SEGKTSDEIAVILGISRNTVNNYIASIMRKTA  229 (246)
Q Consensus       184 ~~LT~RE~eVl~li-a~G~t~~eIA~~L~iS~~TV~~hl~~i~~KLg  229 (246)
T Consensus       127 ~~L~~~~r~v~~l~~~~~~s~~EIA~~l~is~~tVk~rl~Rar~~Lr  173 (185)
T PRK06811        127 NDLKKLDREIFIKRYLLGESIEEIAKKLGLTRSAIDNRLSRGRKKLK  173 (185)
T ss_pred             HCCCHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             48999999999999994999999999989299999999999999999