HHsearch alignment for GI: 254780694 and conserved domain: PRK07405

>PRK07405 RNA polymerase sigma factor SigD; Validated.
Probab=96.32  E-value=0.012  Score=35.97  Aligned_cols=47  Identities=23%  Similarity=0.195  Sum_probs=41.0

Q ss_pred             CCCCHHHHHHHHHHH-----CCCCHHHHHHHHCCCHHHHHHHHHHHHHHHCC
Q ss_conf             888977999999998-----59997999999499988999999999998079
Q gi|254780694|r  184 FELTGREVECLTWIS-----EGKTSDEIAVILGISRNTVNNYIASIMRKTAT  230 (246)
Q Consensus       184 ~~LT~RE~eVl~lia-----~G~t~~eIA~~L~iS~~TV~~hl~~i~~KLgv  230 (246)
T Consensus       256 ~~L~eREr~II~lRfGl~~~~~~TL~EIg~~lgvSrERVRQIE~~AL~KLR~  307 (318)
T PRK07405        256 ADLTPQQKEVIALRFGLEDGQPLTLAKIGERLNISRERVRQIEREALSKLRK  307 (318)
T ss_pred             HCCCHHHHHHHHHHHCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHH
T ss_conf             6299989999999807789897479999989795999999999999999987