HHsearch alignment for GI: 254780694 and conserved domain: PRK09651

>PRK09651 RNA polymerase sigma factor FecI; Provisional.
Probab=98.18  E-value=5e-06  Score=57.58  Aligned_cols=45  Identities=31%  Similarity=0.418  Sum_probs=40.6

Q ss_pred             CCCCHHHHHHHHH-HHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHH
Q ss_conf             8889779999999-98599979999994999889999999999980
Q gi|254780694|r  184 FELTGREVECLTW-ISEGKTSDEIAVILGISRNTVNNYIASIMRKT  228 (246)
Q Consensus       184 ~~LT~RE~eVl~l-ia~G~t~~eIA~~L~iS~~TV~~hl~~i~~KL  228 (246)
T Consensus       118 ~~Lp~~~R~v~~L~~~egls~~EIA~~lgiS~~tVk~~l~rAlk~c  163 (172)
T PRK09651        118 DGLNGKTREAFLLSQLDGLTYSEIAHKLGVSISSVKKYVAKAVEHC  163 (172)
T ss_pred             HHCCHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             7099999999999988399999999998939999999999999999