HHsearch alignment for GI: 254780694 and conserved domain: PRK09958

>PRK09958 DNA-binding transcriptional activator EvgA; Provisional.
Probab=99.89  E-value=3.2e-22  Score=161.55  Aligned_cols=202  Identities=15%  Similarity=0.074  Sum_probs=129.5

Q ss_pred             EEEECCCCHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCEEECCCCCHHHHH
Q ss_conf             00221445888876553023213799997327999999999999987193023000266631112321000689589999
Q gi|254780694|r    9 NIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR   88 (246)
Q Consensus         9 ~~~l~r~d~~r~~~v~~l~~~~d~~~~l~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~   88 (246)
T Consensus         2 ~vlivDDh~lvr~gl~~ll~~~~-~~vv~~~~~~~~~l~~~~----~-----------~~pDvvllDl~lp~~~G~~~~~   65 (204)
T PRK09958          2 NAIIIDDHPLAIAAIRNLLIKND-IEILAELTEGGSAVQRVE----T-----------LKPDIVIIDVDIPGVNGIQVLE   65 (204)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCC-CEEEEEECCHHHHHHHHH----H-----------CCCCEEEEECCCCCCCCHHHHH
T ss_conf             89998698999999999998689-989999799999999987----4-----------3979999958999998416788


Q ss_pred             HHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHH
Q ss_conf             99966984517389999852324430325433332144571475033736899999997178754698999999999999
Q gi|254780694|r   89 CMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAY  168 (246)
Q Consensus        89 ~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  168 (246)
T Consensus        66 ~ir~~~~~-----~~---viv~s~~~~~~~~~~a~~~Ga~g~l~K~~~~~~l~~aI~~v~~G~~~~~~~~~~~~------  131 (204)
T PRK09958         66 TLRKRQYS-----GI---IIIVSAKNDHFYGKHCADAGANGFVSKKEGMNNIIAAIEAAKNGYCYFPFSLNRFV------  131 (204)
T ss_pred             HHHHHCCC-----EE---EEEEECCCCCHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHCCCCCCCHHHHHHH------
T ss_conf             89872798-----05---99997246521144335268637997899999999999999779970889999998------


Q ss_pred             HHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCC
Q ss_conf             99754201467798888897799999999859997999999499988999999999998079988999999997589
Q gi|254780694|r  169 QANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI  245 (246)
Q Consensus       169 ~~~~~~~~~~~~~~~~~LT~RE~eVl~lia~G~t~~eIA~~L~iS~~TV~~hl~~i~~KLgv~~R~eav~~A~~~Gl  245 (246)
T Consensus       132 -----~~~~~~~~~~~~Lt~RE~eVL~ll~~G~snkeIA~~L~iS~~TV~~h~~~i~~KL~v~~r~el~~~A~~~~l  203 (204)
T PRK09958        132 -----GSLTSDQQKLDSLSKQEISVMRYILDGKDNNDIAEKMFISNKTVSTYKSRLMEKLECKSLMDLYTFAQRNKI  203 (204)
T ss_pred             -----HHCCCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCC
T ss_conf             -----631356311256899999999999869999999989788999999999999998489999999999998289