HHsearch alignment for GI: 254780694 and conserved domain: PRK10188

>PRK10188 DNA-binding transcriptional activator SdiA; Provisional.
Probab=100.00  E-value=3.8e-36  Score=250.90  Aligned_cols=218  Identities=19%  Similarity=0.156  Sum_probs=176.7

Q ss_pred             CCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCEEECCCCCHHHHHHHHHCCCCCCCHHHHHHHHH
Q ss_conf             21379999732799999999999998719302300026663111232100068958999999966984517389999852
Q gi|254780694|r   29 RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTEL  108 (246)
Q Consensus        29 ~~d~~~~l~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~  108 (246)
T Consensus        10 ~~~~l~~~~~a~~~~~~~~~l~~~~~~lGFey~~~~~~~p~p~~~p~~~l~snYP~~W~~~Y~~~~y~~iDPvv~~~~~s   89 (240)
T PRK10188         10 RRTMLLRFQEMAAAEEVYHELQLQTQQLEYDYYSLCVRHPVPFTRPKVAFYTTYPEAWVSHYQAENYLAIDPVLKPENFS   89 (240)
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCEEEECCCCHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             99999999847999999999999999759825898874268888876688728999999999987791449510244468


Q ss_pred             HHHHHCCCH--------HHHHHHCCCCCEEEEECCCHHHHHHHHHHHHCCCC--CCC-HHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             324430325--------43333214457147503373689999999717875--469-8999999999999997542014
Q gi|254780694|r  109 FCPVFHTLP--------ENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGR--IIL-RDRLWEIGLLAAYQANMFKSYD  177 (246)
Q Consensus       109 ~~~~~~~~~--------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~-~~~~~~~~~~~~~~~~~~~~~~  177 (246)
T Consensus        90 ~~P~~W~~~l~~~~~~~~~eA~~~Gl~~G~t~p~~~~~g~~g~lSla~~~~~~~~~~~~~~~l~l~~l~~~~~~~~~~~~  169 (240)
T PRK10188         90 QGHLMWNDDLFSEAQALWDAARAHGLRRGVTQCLMLPNRALGFLSFSRSSLREIPILSDELELRLQLLVRESLMALMRLE  169 (240)
T ss_pred             CCCEECCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             98730784012420999999998298676178887279983899985478877754355999999999999999998640


Q ss_pred             --CCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCC
Q ss_conf             --677988888977999999998599979999994999889999999999980799889999999975898
Q gi|254780694|r  178 --VHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV  246 (246)
Q Consensus       178 --~~~~~~~~LT~RE~eVl~lia~G~t~~eIA~~L~iS~~TV~~hl~~i~~KLgv~~R~eav~~A~~~Gli  246 (246)
T Consensus       170 ~~~~~~~~~~LT~RE~E~L~W~A~GKTs~EIa~IL~ISe~TV~fHl~na~~KL~a~Nr~qAva~A~~~GLI  240 (240)
T PRK10188        170 DEMVMTPEMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI  240 (240)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCC
T ss_conf             44457987889989999999997799999999883999999999999999995899899999999985899