HHsearch alignment for GI: 254780694 and conserved domain: PRK10430

>PRK10430 DNA-binding transcriptional activator DcuR; Provisional.
Probab=97.10  E-value=0.0036  Score=39.23  Aligned_cols=140  Identities=15%  Similarity=0.083  Sum_probs=73.7

Q ss_pred             CCCCEEECCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHC--
Q ss_conf             123210006895899999996698451738999985232443032543333214457147503373689999999717--
Q gi|254780694|r   72 QKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFP--  149 (246)
Q Consensus        72 ~~~~~~l~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--  149 (246)
T Consensus        53 ILLDi~mPd~~Glell~~lR~~~~~--~~------VI~ITa~~d~~~v~~Al~~Ga~DYLiKPf~~~rl~~~L~~y~~~~  124 (239)
T PRK10430         53 ILLDIYMQQENGLDLLPVLHEAGCK--SD------VIVISSAADAATIKDSLHYGVVDYLIKPFQASRFEEALTGWRQKK  124 (239)
T ss_pred             EEECCCCCCCCHHHHHHHHHHHCCC--CE------EEEEEECCCHHHHHHHHHCCCHHHEECCCCHHHHHHHHHHHHHHH
T ss_conf             9978999999789999999985899--81------999972688999999998395030489999999999999999999


Q ss_pred             ----CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHH-HHHHHH---HC-CCCHHHHHHHHCCCHHHHHHH
Q ss_conf             ----875469899999999999999754201467798888897799-999999---85-999799999949998899999
Q gi|254780694|r  150 ----KGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREV-ECLTWI---SE-GKTSDEIAVILGISRNTVNNY  220 (246)
Q Consensus       150 ----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LT~RE~-eVl~li---a~-G~t~~eIA~~L~iS~~TV~~h  220 (246)
T Consensus       125 ~~l~~~~~~~Q~~iD~l~------~~~~~~~~~~~~lPKGl~~~TL~~i~~~l~~~~~~~~sa~eva~~~giSRvTaRRY  198 (239)
T PRK10430        125 MALEKRQYYDQAELDQLI------HGSSSNEQDPRRLPKGLTPQTLRTLCQWIDAHQDYEFSTDELANEVNISRVSCRKY  198 (239)
T ss_pred             HHHCCCCCCCHHHHHHHH------HCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             985457878999999998------50578888766699999999999999999827999846999998858529889999


Q ss_pred             HHHHH
Q ss_conf             99999
Q gi|254780694|r  221 IASIM  225 (246)
Q Consensus       221 l~~i~  225 (246)
T Consensus       199 Le~L~  203 (239)
T PRK10430        199 LIWLV  203 (239)
T ss_pred             HHHHH
T ss_conf             99998