HHsearch alignment for GI: 254780694 and conserved domain: PRK10840

>PRK10840 transcriptional regulator RcsB; Provisional.
Probab=99.91  E-value=2.7e-23  Score=168.41  Aligned_cols=208  Identities=12%  Similarity=0.026  Sum_probs=134.4

Q ss_pred             HHHEEEEECCCCHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCEEECCC---
Q ss_conf             01100022144588887655302321379999732799999999999998719302300026663111232100068---
Q gi|254780694|r    5 IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSD---   81 (246)
Q Consensus         5 ~~~~~~~l~r~d~~r~~~v~~l~~~~d~~~~l~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~l~~~---   81 (246)
T Consensus         1 M~~irIlIvDDh~lvr~Gl~~~L~~~~~~~vvg~a~~~~~~~~~~~~----~~-----------pDvvllDl~mpg~~~~   65 (216)
T PRK10840          1 MNNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPK----LD-----------AHVLITDLSMPGDKYG   65 (216)
T ss_pred             CCCCEEEEECCHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHH----CC-----------CCEEEEECCCCCCCCC
T ss_conf             99888999889799999999998159996899987999999999862----39-----------8989982677999887


Q ss_pred             CCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHCCCCCCCHHHHHH
Q ss_conf             95899999996698451738999985232443032543333214457147503373689999999717875469899999
Q gi|254780694|r   82 WPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWE  161 (246)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  161 (246)
T Consensus        66 dGl~~~~~i~~~-----~p~~~---vivls~~~~~~~v~~al~~Ga~Gyl~K~~~~~~L~~AI~~v~~G~~~~~~~~~~~  137 (216)
T PRK10840         66 DGITLIKYIKRH-----FPSLS---IIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRL  137 (216)
T ss_pred             CHHHHHHHHHHH-----CCCCE---EEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHCCCCCCCHHHHHH
T ss_conf             899999999985-----89980---8998477878999999858974899878999999999999987994396999999


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHH
Q ss_conf             99999999975420146779888889779999999985999799999949998899999999999807998899999999
Q gi|254780694|r  162 IGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV  241 (246)
Q Consensus       162 ~~~~~~~~~~~~~~~~~~~~~~~~LT~RE~eVl~lia~G~t~~eIA~~L~iS~~TV~~hl~~i~~KLgv~~R~eav~~A~  241 (246)
T Consensus       138 l~-----------~~~~~~~~~~~LT~RE~eVL~lla~G~snkeIA~~L~iS~~TV~~h~~~i~~KLgv~n~~eLv~ya~  206 (216)
T PRK10840        138 LE-----------KISAGGYGDKRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLS  206 (216)
T ss_pred             HH-----------HHCCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHH
T ss_conf             99-----------7205888778999899999999986999999998969899999999999999829998999999999


Q ss_pred             HCCCC
Q ss_conf             75898
Q gi|254780694|r  242 RNNIV  246 (246)
Q Consensus       242 ~~Gli  246 (246)
T Consensus       207 ~~gl~  211 (216)
T PRK10840        207 SVTLS  211 (216)
T ss_pred             HCCCC
T ss_conf             86999