HHsearch alignment for GI: 254780694 and conserved domain: PRK11179

>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional.
Probab=94.41  E-value=0.15  Score=28.80  Aligned_cols=45  Identities=16%  Similarity=0.304  Sum_probs=37.6

Q ss_pred             CCCCCCHHHHHHHHHHHCC--CCHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             8888897799999999859--99799999949998899999999999
Q gi|254780694|r  182 KDFELTGREVECLTWISEG--KTSDEIAVILGISRNTVNNYIASIMR  226 (246)
Q Consensus       182 ~~~~LT~RE~eVl~lia~G--~t~~eIA~~L~iS~~TV~~hl~~i~~  226 (246)
T Consensus         3 ~~~klD~~D~~IL~~Lq~d~R~s~~eiA~~lglS~stv~~Ri~rLe~   49 (153)
T PRK11179          3 ENYQIDNLDRGILEALMENARTPYAELAKQFGVSPGTIHVRVEKMKQ   49 (153)
T ss_pred             CCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHH
T ss_conf             65767899999999999848999999999989299999999999997