HHsearch alignment for GI: 254780694 and conserved domain: PRK11512

>PRK11512 DNA-binding transcriptional repressor MarR; Provisional.
Probab=92.16  E-value=0.7  Score=24.51  Aligned_cols=46  Identities=15%  Similarity=0.266  Sum_probs=38.8

Q ss_pred             CCCCCCHHHHHHHHHHH--CCCCHHHHHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             88888977999999998--59997999999499988999999999998
Q gi|254780694|r  182 KDFELTGREVECLTWIS--EGKTSDEIAVILGISRNTVNNYIASIMRK  227 (246)
Q Consensus       182 ~~~~LT~RE~eVl~lia--~G~t~~eIA~~L~iS~~TV~~hl~~i~~K  227 (246)
T Consensus        34 ~~~gLt~~Q~~vL~~L~~~~~~t~~eLa~~l~id~~tvt~~ldrLe~~   81 (144)
T PRK11512         34 SPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVCK   81 (144)
T ss_pred             HHCCCCHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHC
T ss_conf             545999999999999998699799999999788887899999999978