HHsearch alignment for GI: 254780694 and conserved domain: PRK11517

>PRK11517 transcriptional regulatory protein YedW; Provisional.
Probab=97.18  E-value=0.0025  Score=40.26  Aligned_cols=112  Identities=15%  Similarity=0.126  Sum_probs=72.0

Q ss_pred             CCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHH
Q ss_conf             32543333214457147503373689999999717875469899999999999999754201467798888897799999
Q gi|254780694|r  115 TLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECL  194 (246)
Q Consensus       115 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LT~RE~eVl  194 (246)
T Consensus        82 ~~~d~i~~l~~GADDYl~KPf~~~EL~aRi~a~lrr~~~~~~~-~-~~~---~l~ld~~~~~v~~~~~~i~LT~~E~~LL  156 (223)
T PRK11517         82 SVDDRVRGLDSGANDYLVKPFSFSELLARVRAQLRQHHALNST-L-EIS---GLRMDSVSQSVSRDNISITLTRKEFQLL  156 (223)
T ss_pred             CHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHCCCCCCCCC-E-EEC---CEEEEHHHEEEEECCEEECCCHHHHHHH
T ss_conf             6578999998398776208977899999999996414577871-7-988---7898001318962998982999999999


Q ss_pred             HHHHCC----CCHHHHHHHHC-----CCHHHHHHHHHHHHHHHCCC
Q ss_conf             999859----99799999949-----99889999999999980799
Q gi|254780694|r  195 TWISEG----KTSDEIAVILG-----ISRNTVNNYIASIMRKTATK  231 (246)
Q Consensus       195 ~lia~G----~t~~eIA~~L~-----iS~~TV~~hl~~i~~KLgv~  231 (246)
T Consensus       157 ~~L~~~~g~vvsre~l~~~vwg~~~~~~~~~idv~I~rLRkKl~~~  202 (223)
T PRK11517        157 WLLASRAGEIIPRTVIASEIWGINFDSDTNTVDVAIRRLRAKVDDP  202 (223)
T ss_pred             HHHHHCCCCCCCHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCC
T ss_conf             9998689985989999999629887888587999999999985788