HHsearch alignment for GI: 254780694 and conserved domain: PRK12423

>PRK12423 LexA repressor; Provisional.
Probab=96.75  E-value=0.0024  Score=40.32  Aligned_cols=44  Identities=27%  Similarity=0.431  Sum_probs=38.6

Q ss_pred             CCCHHHHHHHHHHHC-----C--CCHHHHHHHHCC-CHHHHHHHHHHHHHHH
Q ss_conf             889779999999985-----9--997999999499-9889999999999980
Q gi|254780694|r  185 ELTGREVECLTWISE-----G--KTSDEIAVILGI-SRNTVNNYIASIMRKT  228 (246)
Q Consensus       185 ~LT~RE~eVl~lia~-----G--~t~~eIA~~L~i-S~~TV~~hl~~i~~KL  228 (246)
T Consensus         3 ~LT~kQ~~iL~fI~~~~~~~G~~Pt~rEI~~~~g~~S~~~v~~hl~~L~~kG   54 (202)
T PRK12423          3 TLTPKRAAILAFIRERIAQAGQPPSLAEIAQAFGFASRSVARKHVQALAEAG   54 (202)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHCC
T ss_conf             2089999999999999996298988999999829998678999999999887