HHsearch alignment for GI: 254780694 and conserved domain: PRK12513

>PRK12513 RNA polymerase sigma factor; Provisional.
Probab=98.06  E-value=1.2e-05  Score=55.06  Aligned_cols=46  Identities=20%  Similarity=0.219  Sum_probs=42.6

Q ss_pred             CCCCHHHHHHHHH-HHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHC
Q ss_conf             8889779999999-985999799999949998899999999999807
Q gi|254780694|r  184 FELTGREVECLTW-ISEGKTSDEIAVILGISRNTVNNYIASIMRKTA  229 (246)
Q Consensus       184 ~~LT~RE~eVl~l-ia~G~t~~eIA~~L~iS~~TV~~hl~~i~~KLg  229 (246)
T Consensus       138 ~~Lp~~~r~il~L~~~~g~s~~EIA~~l~is~~tVk~~l~rA~~~Lr  184 (194)
T PRK12513        138 ETLPDEQREVFLLREHGDLSLEEIAQLTGVPLETVKSRLRYALQKLR  184 (194)
T ss_pred             HCCCHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             72998999999999984999999999989499999999999999999