HHsearch alignment for GI: 254780694 and conserved domain: PRK12517

>PRK12517 RNA polymerase sigma factor; Provisional.
Probab=98.07  E-value=1.2e-05  Score=55.15  Aligned_cols=45  Identities=27%  Similarity=0.238  Sum_probs=42.1

Q ss_pred             CCCHHHHHHHHHH-HCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHC
Q ss_conf             8897799999999-85999799999949998899999999999807
Q gi|254780694|r  185 ELTGREVECLTWI-SEGKTSDEIAVILGISRNTVNNYIASIMRKTA  229 (246)
Q Consensus       185 ~LT~RE~eVl~li-a~G~t~~eIA~~L~iS~~TV~~hl~~i~~KLg  229 (246)
T Consensus       128 ~Lp~~~R~vi~L~~~eg~s~~EIA~~Lgis~~tVksrl~RAr~~Lr  173 (188)
T PRK12517        128 KLDPEYREPLLLQVIGGFSGEEIAEILDLNKNTVMTRLFRARNQLK  173 (188)
T ss_pred             CCCHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             6999999999999983999999999989399999999999999999