HHsearch alignment for GI: 254780694 and conserved domain: PRK12525

>PRK12525 RNA polymerase sigma factor; Provisional.
Probab=98.29  E-value=2e-06  Score=60.17  Aligned_cols=44  Identities=25%  Similarity=0.335  Sum_probs=40.3

Q ss_pred             CCCCHHHHHHHHHH-HCCCCHHHHHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             88897799999999-859997999999499988999999999998
Q gi|254780694|r  184 FELTGREVECLTWI-SEGKTSDEIAVILGISRNTVNNYIASIMRK  227 (246)
Q Consensus       184 ~~LT~RE~eVl~li-a~G~t~~eIA~~L~iS~~TV~~hl~~i~~K  227 (246)
T Consensus       117 ~~LP~~~R~vflL~~~eGlsy~EIAe~LgIS~~tV~~~l~rAl~~  161 (168)
T PRK12525        117 DGLSGKARAAFLMSQLEGLTYVEIGERLGVSLSRIHQYMVEAFKC  161 (168)
T ss_pred             HCCCHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             639999999999999929999999999897999999999999999