HHsearch alignment for GI: 254780694 and conserved domain: PRK12526

>PRK12526 RNA polymerase sigma factor; Provisional.
Probab=98.17  E-value=5.3e-06  Score=57.37  Aligned_cols=46  Identities=13%  Similarity=0.153  Sum_probs=42.3

Q ss_pred             CCCCHHHHHHHHHHH-CCCCHHHHHHHHCCCHHHHHHHHHHHHHHHC
Q ss_conf             888977999999998-5999799999949998899999999999807
Q gi|254780694|r  184 FELTGREVECLTWIS-EGKTSDEIAVILGISRNTVNNYIASIMRKTA  229 (246)
Q Consensus       184 ~~LT~RE~eVl~lia-~G~t~~eIA~~L~iS~~TV~~hl~~i~~KLg  229 (246)
T Consensus       152 ~~LP~~~R~vi~L~~~egls~~EIA~~l~is~~TVksrl~rAlk~LR  198 (206)
T PRK12526        152 EKLPEAQQTVVKGVYFQELSQEQLAQQLNVPLGTVKSRLRLALAKLK  198 (206)
T ss_pred             HCCCHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             86899988898999985999999999989399999999999999999