HHsearch alignment for GI: 254780694 and conserved domain: PRK12535

>PRK12535 RNA polymerase sigma factor; Provisional.
Probab=97.92  E-value=3.1e-05  Score=52.50  Aligned_cols=45  Identities=22%  Similarity=0.192  Sum_probs=42.3

Q ss_pred             CCCHHHHHHHHHH-HCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHC
Q ss_conf             8897799999999-85999799999949998899999999999807
Q gi|254780694|r  185 ELTGREVECLTWI-SEGKTSDEIAVILGISRNTVNNYIASIMRKTA  229 (246)
Q Consensus       185 ~LT~RE~eVl~li-a~G~t~~eIA~~L~iS~~TV~~hl~~i~~KLg  229 (246)
T Consensus       132 ~Lp~~~R~~l~L~~~~g~s~~EIA~ilgi~~gTVKsRl~RAr~~Lr  177 (195)
T PRK12535        132 ALPPERREALILTQVLGYTYEEAAKIADVRVGTIRSRVARARADLV  177 (195)
T ss_pred             CCCHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             4999887999999982998999999989399999999999999999