HHsearch alignment for GI: 254780694 and conserved domain: PRK13413

>PRK13413 mpi multiple promoter invertase; Provisional.
Probab=96.53  E-value=0.0057  Score=37.94  Aligned_cols=43  Identities=28%  Similarity=0.482  Sum_probs=37.8

Q ss_pred             CCCCHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             8889779999999985999799999949998899999999999
Q gi|254780694|r  184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMR  226 (246)
Q Consensus       184 ~~LT~RE~eVl~lia~G~t~~eIA~~L~iS~~TV~~hl~~i~~  226 (246)
T Consensus       156 ~~~~~~~~~i~~~~~~g~s~~~iak~~gvsrsTvyR~lK~~~e  198 (200)
T PRK13413        156 YKLHGKEEVITKELKKGTTKSEIAKKLKVSRTTLARFLKTMYE  198 (200)
T ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHC
T ss_conf             1247999999999988899999999989299999999974410