>TIGR02959 SigZ RNA polymerase sigma factor, SigZ family; InterPro: IPR014304 This entry is a group of RNA polymerase sigma factors where one of the members is designated as SigZ in Bacillus subtilis . This group has a very sporadic distribution, B. subtilis, for instance, being the only sequenced strain of Bacilli with a member Dechloromonas aromatica (strain RCB), that appears to have two of these sigma factors. A member of which appears on a plasmid found in Photobacterium profundum SS9 and Vibrio fischeri (strain ATCC 700601 / ES114), where a second one is chromosomally encoded..

Probab=93.22 E-value=0.078 Score=30.64 Aligned_cols=44 Identities=27% Similarity=0.285 Sum_probs=39.6 Q ss_pred CCCHHHHHHHHHH-HCCCCHHHHHHHHCCCHHHHHHHHHHHHHHH Q ss_conf 8897799999999-8599979999994999889999999999980 Q gi|254780694|r 185 ELTGREVECLTWI-SEGKTSDEIAVILGISRNTVNNYIASIMRKT 228 (246) Q Consensus 185 ~LT~RE~eVl~li-a~G~t~~eIA~~L~iS~~TV~~hl~~i~~KL 228 (246) T Consensus 100 ~LP~~~r~a~~L~el~G~sQ~e~A~kLGlSlSGaKSRVQRGR~~L 144 (170) T TIGR02959 100 ELPDEYREAIRLTELEGLSQKEIAEKLGLSLSGAKSRVQRGRKKL 144 (170) T ss_pred HCCHHHHHHHHHHHCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHH T ss_conf 569867889888750799827998761753351567889999999

HHsearch alignment for GI: 254780694 and conserved domain: TIGR02959