HHsearch alignment for GI: 254780694 and conserved domain: TIGR03020

>TIGR03020 EpsA transcriptional regulator EpsA. Proteins in this family include a C-terminal LuxR transcriptional regulator domain (pfam00196). These proteins are positioned proximal to either EpsH-containing exopolysaccharide biosynthesis operons of the Methylobacillus type, or the associated PEP-CTERM-containing genes.
Probab=99.83  E-value=1.1e-20  Score=151.55  Aligned_cols=94  Identities=31%  Similarity=0.408  Sum_probs=73.6

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHCCCC-------C----CCCCCCCHHHHHHHHHHHCCCCHHHHHHHHCCCHHHH
Q ss_conf             7875469899999999999999754201467-------7----9888889779999999985999799999949998899
Q gi|254780694|r  149 PKGRIILRDRLWEIGLLAAYQANMFKSYDVH-------W----GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTV  217 (246)
Q Consensus       149 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~----~~~~~LT~RE~eVl~lia~G~t~~eIA~~L~iS~~TV  217 (246)
T Consensus       143 ~~~~~~~~~~~~~LelL~P~Lh~AL~rv~~l~~q~~~~~~~~~~~~glLT~RE~EVL~~va~G~sn~eIA~~L~iS~~TV  222 (247)
T TIGR03020       143 RSSVPLDARHAYFLELLLPYLDSALRRVLFLPNQHRTRPLGERHSAGLITAREAEILAWVRDGKTNEEIAAILGISSLTV  222 (247)
T ss_pred             ECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHCCCHHHH
T ss_conf             15889987799999976889999999863164335455555677678999899999999987999999999949799999


Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             9999999998079988999999997
Q gi|254780694|r  218 NNYIASIMRKTATKTRSGAIAYAVR  242 (246)
Q Consensus       218 ~~hl~~i~~KLgv~~R~eav~~A~~  242 (246)
T Consensus       223 k~H~~~i~~KL~v~nR~qAV~kAla  247 (247)
T TIGR03020       223 KNHLQHIFKKLDVRNRAQAVAKAIA  247 (247)
T ss_pred             HHHHHHHHHHCCCCCHHHHHHHHHC
T ss_conf             9999999998099989999999859