HHsearch alignment for GI: 254780694 and conserved domain: TIGR03541

>TIGR03541 reg_near_HchA LuxR family transcriptional regulatory, chaperone HchA-associated. Members of this protein family belong to the LuxR transcriptional regulator family, and contain both autoinducer binding (pfam03472) and transcriptional regulator (pfam00196) domains. Members, however, occur only in a few members of the Gammaproteobacteria that have the chaperone/aminopeptidase HchA, and are always encoded by the adjacent gene.
Probab=100.00  E-value=2.8e-33  Score=232.54  Aligned_cols=214  Identities=20%  Similarity=0.139  Sum_probs=169.3

Q ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCEE-ECCCCCHHHHHHHHHCCCCCCCHHHHHHHHHH
Q ss_conf             37999973279999999999999871930230002666311123210-00689589999999669845173899998523
Q gi|254780694|r   31 DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI-VSSDWPFDLVRCMALSEKDKYYNVLQRPTELF  109 (246)
Q Consensus        31 d~~~~l~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~-l~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~  109 (246)
T Consensus         6 ~~l~~l~~a~t~~~l~~~l~~~~~~~Gfd~~~y~~~~~~~~~~~~~~~~~~~~w~~~~~~y~~~~Y~~~DPvv~~~~~~~   85 (232)
T TIGR03541         6 QAVRQIEQASTLEAIQDAVREFAQNLGYDRFVLFSAHSAKDELIERIFWVEGDWFDDGNAVDAQTYLRHCPVTRHILEAD   85 (232)
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCEECCCCCHHHHHHHHHHCCCCCCCCHHHHHHHCC
T ss_conf             99999984899999999999999984998899963477766556400037874577899998839910698999998579


Q ss_pred             HHHHCCCHH----------HHHHHCCCCCEEEEECCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCCC-
Q ss_conf             244303254----------333321445714750337368999999971787546989999999999999975420146-
Q gi|254780694|r  110 CPVFHTLPE----------NITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDV-  178 (246)
Q Consensus       110 ~~~~~~~~~----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-  178 (246)
T Consensus        86 ~Pf~Ws~~~~~~~~~~~~~~~a~~~G-~~G~tvPi~~~~G~~g~~s~a~-~~~d~~~~~~~~l~l~~~~a~~~~~~l~~~  163 (232)
T TIGR03541        86 EPFFWSKTPNENGERYRVVRNPSGRG-VHGLQVPVFGRTGLEGAVSLGG-KLIDLSARFRLALQLLCVTAFFAARRLLEA  163 (232)
T ss_pred             CCEECCCCCCCCHHHHHHHHHHHHCC-CCEEEEEEECCCCCEEEEEECC-CCCCCCHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99623888766877899999998639-9589998888999868998416-877789999999999999999999997358


Q ss_pred             -CCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCC
Q ss_conf             -77988888977999999998599979999994999889999999999980799889999999975898
Q gi|254780694|r  179 -HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV  246 (246)
Q Consensus       179 -~~~~~~~LT~RE~eVl~lia~G~t~~eIA~~L~iS~~TV~~hl~~i~~KLgv~~R~eav~~A~~~Gli  246 (246)
T Consensus       164 ~~~~~~~~LT~RE~E~L~w~A~Gkt~~eIa~iL~iSe~TV~~hl~~a~~KLga~nr~qAVa~Ai~~GlI  232 (232)
T TIGR03541       164 PLLREAGVLSEREREVLAWTALGRRQADIAAILGISERTVENHLRSARRKLGVATTAQAIAIALRKGDI  232 (232)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCC
T ss_conf             998889998989999999998799999999996989999999999999984899999999999987999