HHsearch alignment for GI: 254780694 and conserved domain: pfam00196

>pfam00196 GerE Bacterial regulatory proteins, luxR family.
Probab=99.70  E-value=3.6e-17  Score=129.06  Aligned_cols=57  Identities=42%  Similarity=0.494  Sum_probs=55.3

Q ss_pred             CCCCHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             888977999999998599979999994999889999999999980799889999999
Q gi|254780694|r  184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA  240 (246)
Q Consensus       184 ~~LT~RE~eVl~lia~G~t~~eIA~~L~iS~~TV~~hl~~i~~KLgv~~R~eav~~A  240 (246)
T Consensus         2 ~~LT~RE~~il~~l~~G~s~~eIA~~L~is~~TV~~h~~~i~~Kl~v~nr~elv~~A   58 (58)
T pfam00196         2 DSLSPREREVLRLLAAGKSNKEIADILGISEKTVKVHRSNIMRKLNVHSRVELIRLA   58 (58)
T ss_pred             CCCCHHHHHHHHHHHHCCCHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCHHHHHHHC
T ss_conf             977999999999998079999999997888999999999999980999999999559