HHsearch alignment for GI: 254780694 and conserved domain: pfam00486

>pfam00486 Trans_reg_C Transcriptional regulatory protein, C terminal.
Probab=95.26  E-value=0.043  Score=32.29  Aligned_cols=49  Identities=22%  Similarity=0.365  Sum_probs=42.9

Q ss_pred             CCCCCHHHHHHHHHHHCC----CCHHHHHHHH-----CCCHHHHHHHHHHHHHHHCCC
Q ss_conf             888897799999999859----9979999994-----999889999999999980799
Q gi|254780694|r  183 DFELTGREVECLTWISEG----KTSDEIAVIL-----GISRNTVNNYIASIMRKTATK  231 (246)
Q Consensus       183 ~~~LT~RE~eVl~lia~G----~t~~eIA~~L-----~iS~~TV~~hl~~i~~KLgv~  231 (246)
T Consensus         3 ~i~Lt~~E~~lL~~L~~~~~~~vsr~~l~~~iw~~~~~~~~~sl~~~I~rLR~kl~~~   60 (77)
T pfam00486         3 EVELTPKEFDLLELLARNPGRVVSREELLEEVWGEDFDVDDNTVDVHISRLRKKLEDD   60 (77)
T ss_pred             EEECCHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             7233899999999999679971979999999638766655330999999999987544