HHsearch alignment for GI: 254780694 and conserved domain: pfam03444

>pfam03444 DUF293 Domain of unknown function. This domain is always found with a pair of CBS domains pfam00571. this region may be distantly related to the HrcA proteins of prokaryotes (Bateman A pers. obs.).
Probab=94.94  E-value=0.063  Score=31.22  Aligned_cols=45  Identities=33%  Similarity=0.399  Sum_probs=35.8

Q ss_pred             CCCHHHHHHHHHHHC-----C--CCHHHHHHHHCCCHHHHHHHHHHHHHHHCC
Q ss_conf             889779999999985-----9--997999999499988999999999998079
Q gi|254780694|r  185 ELTGREVECLTWISE-----G--KTSDEIAVILGISRNTVNNYIASIMRKTAT  230 (246)
Q Consensus       185 ~LT~RE~eVl~lia~-----G--~t~~eIA~~L~iS~~TV~~hl~~i~~KLgv  230 (246)
T Consensus         1 ~LT~~Qr~IL~aLI~lY~~~~~pVks~~IAe~l~~spgTIRN~M~~L-~~LGL   52 (79)
T pfam03444         1 ELTPVQKEILQALINLYRKKGRAVKGEEIADIIGRNPGTVRNQMQSL-KALGL   52 (79)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHH-HHCCC
T ss_conf             97789999999999999972998667999999878908899999999-98588