HHsearch alignment for GI: 254780694 and conserved domain: pfam04218

>pfam04218 CENP-B_N CENP-B N-terminal DNA-binding domain. Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere. Within the N-terminal 125 residues, there is a DNA-binding region, which binds to a corresponding 17bp CENP-B box sequence. CENP-B dimers either bind two separate DNA molecules or alternatively, they may bind two CENP-B boxes on one DNA molecule, with the intervening stretch of DNA forming a loop structure. The CENP-B DNA-binding domain consists of two repeating domains, RP1 and RP2. This family corresponds to RP1 has been shown to consist of four helices in a helix-turn-helix structure.
Probab=90.89  E-value=0.61  Score=24.90  Aligned_cols=41  Identities=24%  Similarity=0.385  Sum_probs=36.3

Q ss_pred             CCCCHHH-HHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHH
Q ss_conf             8889779-9999999859997999999499988999999999
Q gi|254780694|r  184 FELTGRE-VECLTWISEGKTSDEIAVILGISRNTVNNYIASI  224 (246)
Q Consensus       184 ~~LT~RE-~eVl~lia~G~t~~eIA~~L~iS~~TV~~hl~~i  224 (246)
T Consensus         5 ~~LTl~eKi~iI~~~e~G~s~~~lar~~gi~~STl~~I~Knk   46 (53)
T pfam04218         5 TSLTLREKIEVIQRSEEGESKASLARRFNVPRSTLRDILKNK   46 (53)
T ss_pred             EEECHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             141699999999999858968899999698797999999809