HHsearch alignment for GI: 254780694 and conserved domain: smart00862

>smart00862 Trans_reg_C Transcriptional regulatory protein, C terminal. This domain is almost always found associated with the response regulator receiver domain. It may play a role in DNA binding.
Probab=94.67  E-value=0.075  Score=30.74  Aligned_cols=49  Identities=18%  Similarity=0.269  Sum_probs=41.1

Q ss_pred             CCCCCHHHHHHHHHHHCC----CCHHHHHHHHC------CCHHHHHHHHHHHHHHHCCC
Q ss_conf             888897799999999859----99799999949------99889999999999980799
Q gi|254780694|r  183 DFELTGREVECLTWISEG----KTSDEIAVILG------ISRNTVNNYIASIMRKTATK  231 (246)
Q Consensus       183 ~~~LT~RE~eVl~lia~G----~t~~eIA~~L~------iS~~TV~~hl~~i~~KLgv~  231 (246)
T Consensus         3 ~v~Lt~~e~~lL~~L~~~~~~~vs~~~l~~~lw~~~~~~~~~~~l~~~I~~LR~kl~~~   61 (78)
T smart00862        3 PIKLTPKEFRLLELLLRNPGRVVSREELLEAVWGDDDDDVDDNTLDVHISRLRKKLEDD   61 (78)
T ss_pred             EEECCHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             73248999999999984799629699999876288878888602789999999997645