HHsearch results for GI: 254780694 and protein with PDBid: 2a6h_F

>2a6h_F RNA polymerase sigma factor RPOD; RNA polymerase holoenzyme, streptolydigin, antibiotic, transcription regulation; HET: STD; 2.40A {Thermus thermophilus} SCOP: a.4.13.1 a.4.13.2 a.177.1.1 PDB: 1smy_F* 1zyr_F* 1iw7_F* 2a69_F* 2a6e_F 2a68_F* 2be5_F* 2cw0_F 3eql_F* 3dxj_F* 1l9u_H 1ku2_A 3lev_A* 3les_A*
Probab=96.53  E-value=0.0018  Score=39.70  Aligned_cols=45  Identities=22%  Similarity=0.391  Sum_probs=40.5

Q ss_pred             CCCHHHHHHHHHH-----HCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHC
Q ss_conf             8897799999999-----85999799999949998899999999999807
Q gi|254780694|r  185 ELTGREVECLTWI-----SEGKTSDEIAVILGISRNTVNNYIASIMRKTA  229 (246)
Q Consensus       185 ~LT~RE~eVl~li-----a~G~t~~eIA~~L~iS~~TV~~hl~~i~~KLg  229 (246)
                      .|++||++|+.+-     .+.+|-+|||..++||...|+..-+++++||-
T Consensus       360 ~L~~REr~II~lRfGL~~~~~~Tl~EIg~~lgvSreRVrQIe~~AL~KLR  409 (423)
T 2a6h_F          360 KLSEREAMVLKLRKGLIDGREHTLEEVGAFFGVTRERIRQIENKALRKLK  409 (423)
T ss_dssp             SSCHHHHHHHHHHHHTTCC-----CHHHHSSSSCHHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             59999999999706678998603999999989799999999999999988