HHsearch results for GI: 254780694 and protein with PDBid: 3frw_A

>3frw_A Putative Trp repressor protein; structural genomics, APC21159, PSI-2, protein structure initiative; 2.05A {Ruminococcus obeum atcc 29174} PDB: 3g1c_A
Probab=96.42  E-value=0.0045  Score=37.19  Aligned_cols=44  Identities=18%  Similarity=0.214  Sum_probs=34.5

Q ss_pred             CCHHH-------HHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             89779-------99999998599979999994999889999999999980799
Q gi|254780694|r  186 LTGRE-------VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATK  231 (246)
Q Consensus       186 LT~RE-------~eVl~lia~G~t~~eIA~~L~iS~~TV~~hl~~i~~KLgv~  231 (246)
                      |||.|       .+|++++.+|+|+.+||..+++|..||.. +++-. |-|..
T Consensus        37 ~T~~E~~~la~R~~va~lL~~g~syreIa~~~gvS~aTIsR-v~r~L-~~g~~   87 (107)
T 3frw_A           37 CTINELLSLSQRFEVAKMLTDKRTYLDISEKTGASTATISR-VNRSL-NYGND   87 (107)
T ss_dssp             SCHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHCCCHHHHHH-HHHHH-HHSCS
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHH-HHHHH-HCCCC
T ss_conf             99999999999999999988699999999996987475899-99998-83895