HHsearch results for GI: 254780694 and protein with PDBid: 3klo_A

>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A*
Probab=99.86  E-value=2.3e-21  Score=154.59  Aligned_cols=122  Identities=21%  Similarity=0.142  Sum_probs=95.9

Q ss_pred             HHHHCCCCCEEEEECCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHC
Q ss_conf             33321445714750337368999999971787546989999999999999975420146779888889779999999985
Q gi|254780694|r  120 ITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISE  199 (246)
Q Consensus       120 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LT~RE~eVl~lia~  199 (246)
                      ......++.||+.+.........++..+..+..+.++.....+...   .  ..............||+||+|||+++++
T Consensus        99 ~~~~~~Ga~g~l~K~~~~~~L~~ai~~v~~G~~~~~~~~~~~~~~~---~--~~~~~~~~~~~~~~LT~RE~eVL~ll~~  173 (225)
T 3klo_A           99 LLFKWNNLAGVFYIDDDMDTLIKGMSKILQDEMWLTRKLAQEYILH---Y--RAGNSVVTSQMYAKLTKREQQIIKLLGS  173 (225)
T ss_dssp             HHTTSTTEEEEEETTCCHHHHHHHHHHHHTTCCBCCHHHHHHHHHH---H--HTTCCCCCCHHHHTSCHHHHHHHHHHTT
T ss_pred             HHHHHCCCCEEEECCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHH---H--CCCCCCCCCCCHHHHCHHHHHHHHHHHC
T ss_conf             9999869959997799999999999998479753104788888765---3--1466533232134422256543035533


Q ss_pred             CCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHC-CCC
Q ss_conf             99979999994999889999999999980799889999999975-898
Q gi|254780694|r  200 GKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN-NIV  246 (246)
Q Consensus       200 G~t~~eIA~~L~iS~~TV~~hl~~i~~KLgv~~R~eav~~A~~~-Gli  246 (246)
                      |+||+|||+.|+||++||++|+++||+|||++||+||+.||.++ ||.
T Consensus       174 G~snkeIA~~L~iS~~TVk~h~~~i~~KLgv~nr~el~~~A~~~~g~~  221 (225)
T 3klo_A          174 GASNIEIADKLFVSENTVKTHLHNVFKKINAKNRLQALIWAKNNIGIE  221 (225)
T ss_dssp             TCCHHHHHHHTTCCHHHHHHHHHHHTTTSCCSSHHHHHHHHHHHCCC-
T ss_pred             CCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCC
T ss_conf             997999999978899999999999999868999999999999907977