BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780694|ref|YP_003065107.1| probable transcriptional
regulator protein, LuxR family [Candidatus Liberibacter asiaticus str.
psy62]
         (246 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780694|ref|YP_003065107.1| probable transcriptional regulator protein, LuxR family [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040371|gb|ACT57167.1| probable transcriptional regulator protein, LuxR family [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 246

 Score =  514 bits (1324), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 246/246 (100%), Positives = 246/246 (100%)

Query: 1   MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASH 60
           MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASH
Sbjct: 1   MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASH 60

Query: 61  FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI 120
           FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI
Sbjct: 61  FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI 120

Query: 121 TPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW 180
           TPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW
Sbjct: 121 TPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW 180

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA
Sbjct: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240

Query: 241 VRNNIV 246
           VRNNIV
Sbjct: 241 VRNNIV 246


>gi|315121859|ref|YP_004062348.1| probable transcriptional regulator protein, LuxR family [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495261|gb|ADR51860.1| probable transcriptional regulator protein, LuxR family [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 246

 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 224/246 (91%), Positives = 234/246 (95%)

Query: 1   MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASH 60
           MNFE+QQVNIVLNREDEQRTS VSHLPTRSDLLARMIPLD TVS  MRMYALTEYVGASH
Sbjct: 1   MNFEMQQVNIVLNREDEQRTSIVSHLPTRSDLLARMIPLDRTVSSKMRMYALTEYVGASH 60

Query: 61  FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI 120
           FLLVRWDLFQEQKLDS+VSSDWPFDLVRCM LSEKDKYYNVLQRP ELFCPVFH LPENI
Sbjct: 61  FLLVRWDLFQEQKLDSVVSSDWPFDLVRCMTLSEKDKYYNVLQRPAELFCPVFHILPENI 120

Query: 121 TPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW 180
             P+GMDNRYC+LTFDV RIRIGLMLLFPKGRI+ +DRLWEIGLLAAYQANMFK+Y+VH 
Sbjct: 121 DLPSGMDNRYCALTFDVGRIRIGLMLLFPKGRIVSQDRLWEIGLLAAYQANMFKNYNVHL 180

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           GKDFELTGRE+ECLTWISEGKTSDEIAVILGISRNT+NNYIASIMRKTATKTRSGAIAYA
Sbjct: 181 GKDFELTGREIECLTWISEGKTSDEIAVILGISRNTINNYIASIMRKTATKTRSGAIAYA 240

Query: 241 VRNNIV 246
           VRNNIV
Sbjct: 241 VRNNIV 246


>gi|190890349|ref|YP_001976891.1| transcriptional regulator protein, LuxR family [Rhizobium etli CIAT
           652]
 gi|190695628|gb|ACE89713.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CIAT 652]
          Length = 248

 Score =  234 bits (598), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 124/240 (51%), Positives = 161/240 (67%), Gaps = 6/240 (2%)

Query: 13  NREDEQRTSFVSH----LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDL 68
           ++ ++Q  +F S     L  R +L+ R+  +  T      + ALTEYVGASH+LL R DL
Sbjct: 9   SKGEKQMMNFASAVAPALLPRDELIQRLHSVASTGRLQSGLRALTEYVGASHYLLARCDL 68

Query: 69  FQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNV--LQRPTELFCPVFHTLPENITPPAGM 126
            QE  LD +VSSDWPFDLV+ +A      Y     L++  ++F P F  LPE+   P G 
Sbjct: 69  IQESGLDFVVSSDWPFDLVKDIANDLVSGYARSTELEKCMQVFQPNFALLPESAAVPEGA 128

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFEL 186
             +YCSLTF+V R R+ LM LF +G I+  +RL ++GLLA Y A+  +       +DFEL
Sbjct: 129 SRQYCSLTFNVGRSRLALMFLFGEGFILSPERLRDVGLLAGYVASFLRCGGARVDRDFEL 188

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T RE+ECL WI+EGKTSDEIA+ILGISRNT+NNYI S+MRKTATKTRS AIA+AVRNN+V
Sbjct: 189 TDRELECLFWIAEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIAFAVRNNLV 248


>gi|222084851|ref|YP_002543380.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
 gi|221722299|gb|ACM25455.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
          Length = 245

 Score =  233 bits (593), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 121/248 (48%), Positives = 163/248 (65%), Gaps = 5/248 (2%)

Query: 1   MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASH 60
           M+ +I Q +     + + R +  S   +R  L+ ++  +         +  LT+YVGASH
Sbjct: 1   MDMQISQAS---KGDKDARAAAPSSAMSRDQLILQLTAVAGPAYLQSGLRVLTDYVGASH 57

Query: 61  FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNV--LQRPTELFCPVFHTLPE 118
           +LL R DL QE  LD +VSSDWPFDLVR +A    + Y     L++   LF PVF  LP+
Sbjct: 58  YLLARCDLIQESGLDFVVSSDWPFDLVRRLASELTNGYGRAGELEKSMSLFQPVFAFLPD 117

Query: 119 NITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDV 178
           ++ PP G+   YC+LTF+V R R  LMLL     ++  +RL ++GLLA Y A+  +S + 
Sbjct: 118 DVEPPEGVSRHYCALTFNVGRTRFSLMLLARDSLLLSPERLRDVGLLAGYFASFTRSVEG 177

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
              +DF+LT RE+ECL WI+EGKTSDEIA+ILGISRNT+NNYI S+MRKTATKTRS AIA
Sbjct: 178 KLERDFDLTERELECLFWIAEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIA 237

Query: 239 YAVRNNIV 246
           +AVRNN+V
Sbjct: 238 FAVRNNLV 245


>gi|116250468|ref|YP_766306.1| GerE/LuxR family transcriptional regulator [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115255116|emb|CAK06190.1| regulator of flagellar and motility genes, also regulates rem
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 262

 Score =  231 bits (589), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 122/229 (53%), Positives = 156/229 (68%), Gaps = 2/229 (0%)

Query: 20  TSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVS 79
           ++ V  L  R +LL R+  +  T      + ALT+YVGASH+LL R DL QE  LD IVS
Sbjct: 34  SAVVPDLLPRDELLQRLHGVASTGRLQSGLRALTDYVGASHYLLARCDLLQESGLDFIVS 93

Query: 80  SDWPFDLVRCMALSEKDKYYNV--LQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           SDWPFDLVR +A      Y     L++  ++F P F  LP++   P G   +YCS+TF+V
Sbjct: 94  SDWPFDLVRDIANDLVRGYARSTELEKCMQVFQPNFALLPDSAEVPDGASRQYCSVTFNV 153

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
            R R+ LM LF +G I+  +RL ++GLLA Y A+  +       +DFELT RE+ECL WI
Sbjct: 154 GRSRLSLMFLFGEGFILSPERLRDVGLLAGYVASFLRCGGTKVDRDFELTDRELECLFWI 213

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +EGKTSDEIA+ILGISRNT+NNYI S+MRKTATKTRS AIA+AVRNN+V
Sbjct: 214 AEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIAFAVRNNLV 262


>gi|82940562|emb|CAJ44291.1| putative transcription regulator protein MotR, LuxR family
           [Rhizobium leguminosarum bv. viciae]
          Length = 248

 Score =  231 bits (589), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 122/229 (53%), Positives = 155/229 (67%), Gaps = 2/229 (0%)

Query: 20  TSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVS 79
           ++ V  L  R  LL R+  +  +      + ALT+YVGASH+LL R DL QE  LD IVS
Sbjct: 20  SAVVPDLLPRDKLLQRLHGVTSSGRLQSGLRALTDYVGASHYLLARCDLLQESGLDFIVS 79

Query: 80  SDWPFDLVRCMALSEKDKYYNV--LQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           SDWPFDLVR +A      Y     L+R  ++F P F  LP++   P G   +YCS+TF+V
Sbjct: 80  SDWPFDLVRDIANDLVRGYARSTELERCMQVFQPNFALLPDSAEVPDGASRQYCSVTFNV 139

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
            R R+ LM LF +G I+  +RL ++GLLA Y A+  +       +DFELT RE+ECL WI
Sbjct: 140 GRSRLALMFLFGEGFILSPERLRDVGLLAGYVASFLRCGGTRVDRDFELTDRELECLFWI 199

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +EGKTSDEIA+ILGISRNT+NNYI S+MRKTATKTRS AIA+AVRNN+V
Sbjct: 200 AEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIAFAVRNNLV 248


>gi|262283887|gb|ACY40751.1| VisN [Rhizobium leguminosarum bv. viciae]
          Length = 262

 Score =  231 bits (588), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 122/229 (53%), Positives = 156/229 (68%), Gaps = 2/229 (0%)

Query: 20  TSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVS 79
           ++ V  L  R +LL R+  +  T      + ALT+YVGASH+LL R DL QE  LD IVS
Sbjct: 34  SAVVPDLLPRDELLLRLHGVASTGRLQSGLRALTDYVGASHYLLARCDLLQESGLDFIVS 93

Query: 80  SDWPFDLVRCMALSEKDKYYNV--LQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           SDWPFDLVR +A      Y     L++  ++F P F  LP++   P G   +YCS+TF+V
Sbjct: 94  SDWPFDLVRDIANDLVRGYARSTELEKCMQVFQPNFALLPDSAEVPDGASRQYCSVTFNV 153

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
            R R+ LM LF +G I+  +RL ++GLLA Y A+  +       +DFELT RE+ECL WI
Sbjct: 154 GRSRLALMFLFGEGFILSPERLRDVGLLAGYVASFLRCGGTKVDRDFELTDRELECLFWI 213

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +EGKTSDEIA+ILGISRNT+NNYI S+MRKTATKTRS AIA+AVRNN+V
Sbjct: 214 AEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIAFAVRNNLV 262


>gi|209547914|ref|YP_002279831.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533670|gb|ACI53605.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 248

 Score =  231 bits (588), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 122/229 (53%), Positives = 155/229 (67%), Gaps = 2/229 (0%)

Query: 20  TSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVS 79
           ++ V  L  R  LL R+  +  T      + ALTEYVGASH+LL R DL QE  LD IVS
Sbjct: 20  SAVVPDLLPRDQLLQRLHGVANTGRLQSGLRALTEYVGASHYLLARCDLLQESGLDFIVS 79

Query: 80  SDWPFDLVRCMALSEKDKYYNV--LQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           SDWPFDLVR +A      Y     L++  ++F P F  +P++   P G   +YCS+TF+V
Sbjct: 80  SDWPFDLVRDIANDLVRGYARSTELEKCMQVFQPNFALMPDSADVPDGASRQYCSVTFNV 139

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
            R R+ LM LF +G I+  +RL ++GLLA Y A+  +       +DFELT RE+ECL WI
Sbjct: 140 GRSRLALMFLFGEGFILSPERLRDVGLLAGYVASFLRCGGTRVDRDFELTDRELECLFWI 199

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +EGKTSDEIA+ILGISRNT+NNYI S+MRKTATKTRS AIA+AVRNN+V
Sbjct: 200 AEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIAFAVRNNLV 248


>gi|86356298|ref|YP_468190.1| LuxR family transcriptional regulator [Rhizobium etli CFN 42]
 gi|86280400|gb|ABC89463.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CFN 42]
          Length = 234

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 153/223 (68%), Gaps = 3/223 (1%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFD 85
           LP R +L+ R+  +  T      + ALT+YVGASH+LL R DL QE  LD IVSSDWPFD
Sbjct: 13  LP-RDELVRRLHGVADTGRLQSGLRALTDYVGASHYLLARCDLIQESGLDFIVSSDWPFD 71

Query: 86  LVRCMALSEKDKYYNV--LQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
           LVR +A      Y     L++  ++F P F  LPE    P G   +YCSLTF+V R R+ 
Sbjct: 72  LVRDIANDLVSTYARSTELEKCMQVFQPNFALLPEGADVPEGASRQYCSLTFNVGRSRLA 131

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           LM LF +G I+  +RL ++GLLA Y A+  +       +DFELT RE+ECL WI+EGKTS
Sbjct: 132 LMFLFGEGFILSPERLRDVGLLAGYIASFLRCGGAKVDRDFELTDRELECLFWIAEGKTS 191

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           DEIA+ILGISRNT+NNYI S+MRKTATKTRS AIA+AVRNN+V
Sbjct: 192 DEIAMILGISRNTINNYITSVMRKTATKTRSEAIAFAVRNNLV 234


>gi|241203092|ref|YP_002974188.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856982|gb|ACS54649.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 248

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 121/229 (52%), Positives = 156/229 (68%), Gaps = 2/229 (0%)

Query: 20  TSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVS 79
           ++ V  L  R +LL R+  +  T      + ALT+YVGAS++LL R DL QE  LD IVS
Sbjct: 20  SAAVPDLLPRDELLQRLHGVASTGRLQSGLRALTDYVGASYYLLARCDLLQESGLDFIVS 79

Query: 80  SDWPFDLVRCMALSEKDKYYNV--LQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           SDWPFDLVR +A      Y     L++  ++F P F  LP++   P G   +YCS+TF+V
Sbjct: 80  SDWPFDLVRDIANDLVRGYARSTELEKCMQVFQPNFALLPDSAEVPDGASRQYCSVTFNV 139

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
            R R+ LM LF +G I+  +RL ++GLLA Y A+  +       +DFELT RE+ECL WI
Sbjct: 140 GRSRLALMFLFGEGFILSPERLRDVGLLAGYVASFLRCGGTKVDRDFELTDRELECLFWI 199

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +EGKTSDEIA+ILGISRNT+NNYI S+MRKTATKTRS AIA+AVRNN+V
Sbjct: 200 AEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIAFAVRNNLV 248


>gi|15964400|ref|NP_384753.1| putative transcription regulator protein [Sinorhizobium meliloti
           1021]
 gi|15073577|emb|CAC45219.1| Transcriptional regulator of motility genes, LuxR family
           [Sinorhizobium meliloti 1021]
          Length = 245

 Score =  217 bits (552), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 149/221 (67%), Gaps = 2/221 (0%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
           +R  L+ R+  +         + ALTEYVGA+H+LL R D+ Q+  LD +V SDWPFD+V
Sbjct: 25  SREQLIRRLGEVASGAGLGNGLAALTEYVGATHYLLARHDVSQDGGLDFVVCSDWPFDIV 84

Query: 88  RCMA--LSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLM 145
           R ++  ++        L+R      P FHT+P++I  P G+   YC++TF V R R  LM
Sbjct: 85  RRLSGIIAGLHAKITELERCLAQLQPAFHTMPDDIGLPRGVSRSYCAVTFSVGRTRFSLM 144

Query: 146 LLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDE 205
           LLFP+  I+ ++ L +I +LA Y A+     DV   ++ ELT RE+ECL WI+EGKTSDE
Sbjct: 145 LLFPEDVILSQEALRDIAVLAGYVASHKIKADVRHDRECELTERELECLFWIAEGKTSDE 204

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           IAVILGISRNT+NNYI S+MRKTAT+TRS AIA+AVRNN+V
Sbjct: 205 IAVILGISRNTINNYITSVMRKTATRTRSEAIAHAVRNNLV 245


>gi|2916781|emb|CAA11948.1| unnamed protein product [Sinorhizobium meliloti]
          Length = 245

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 110/221 (49%), Positives = 149/221 (67%), Gaps = 2/221 (0%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
           +R  L+ R+  +         + ALTEYVGA+H+LL R D+ Q+  LD +V SDWPFD+V
Sbjct: 25  SREQLIRRLGEVASGAGLGNGLAALTEYVGATHYLLARHDVSQDGGLDFVVCSDWPFDIV 84

Query: 88  RCMA--LSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLM 145
           R ++  ++        L++      P FHT+P++I  P G+   YC++TF V R R  LM
Sbjct: 85  RRLSGIIAGLHAKITELEKCLAQLQPAFHTMPDDIGLPRGVSRSYCAVTFSVGRTRFSLM 144

Query: 146 LLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDE 205
           LLFP+  I+ ++ L +I +LA Y A+     DV   ++ ELT RE+ECL WI+EGKTSDE
Sbjct: 145 LLFPEDVILSQESLRDIAVLAGYVASHKIKADVRHDRECELTERELECLFWIAEGKTSDE 204

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           IAVILGISRNT+NNYI S+MRKTAT+TRS AIA+AVRNN+V
Sbjct: 205 IAVILGISRNTINNYITSVMRKTATRTRSEAIAHAVRNNLV 245


>gi|307311542|ref|ZP_07591183.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
 gi|307318897|ref|ZP_07598328.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306895311|gb|EFN26066.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306899559|gb|EFN30188.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
          Length = 210

 Score =  215 bits (547), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 142/200 (71%), Gaps = 2/200 (1%)

Query: 49  MYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMA--LSEKDKYYNVLQRPT 106
           + ALTEYVGA+H+LL R D+ Q+  LD +V SDWPFD+VR ++  ++        L+R  
Sbjct: 11  LAALTEYVGATHYLLARHDVSQDGGLDFVVCSDWPFDIVRRLSGIIAGLHAKITELERCL 70

Query: 107 ELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLA 166
               P FHT+P++I  P G+   YC++TF V R R  LMLLFP+  I+ ++ L +I +LA
Sbjct: 71  AQLQPAFHTMPDDIGLPRGVSRSYCAVTFSVGRTRFSLMLLFPEDVILSQEALRDIAVLA 130

Query: 167 AYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMR 226
            Y A+     DV   ++ ELT RE+ECL WI+EGKTSDEIAVILGISRNT+NNYI S+MR
Sbjct: 131 GYVASHKIKADVRHDRECELTERELECLFWIAEGKTSDEIAVILGISRNTINNYITSVMR 190

Query: 227 KTATKTRSGAIAYAVRNNIV 246
           KTAT+TRS AIA+AVRNN+V
Sbjct: 191 KTATRTRSEAIAHAVRNNLV 210


>gi|150395470|ref|YP_001325937.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
 gi|150026985|gb|ABR59102.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
          Length = 245

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 108/221 (48%), Positives = 148/221 (66%), Gaps = 2/221 (0%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
           +R  L+ R+  L         +  LTEYVGA+H+LL R D+ Q+  LD +V SDWPFD+V
Sbjct: 25  SREQLIRRLGELASGTGLGNGLAVLTEYVGATHYLLARHDVSQDGGLDFVVCSDWPFDIV 84

Query: 88  RCMA--LSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLM 145
           R ++  ++  +     L++      PVFH +P++I  P G+   YC++TF +   R  LM
Sbjct: 85  RRLSGIIAGLNSKTTELEKCRAQLQPVFHAMPDDIGLPRGVSRSYCAVTFSIGPTRFSLM 144

Query: 146 LLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDE 205
           LLFP+  I+ +D L ++ +LA Y A+     DV   ++ ELT RE+ECL WI+EGKTSDE
Sbjct: 145 LLFPEDVILSQDALRDVAVLAGYVASHKIKADVRHDRECELTERELECLFWIAEGKTSDE 204

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           IAVILGISRNT+NNYI S+MRKTAT+TRS AIA+AVRNN+V
Sbjct: 205 IAVILGISRNTINNYITSVMRKTATRTRSEAIAHAVRNNLV 245


>gi|227820843|ref|YP_002824813.1| predicted LuxR family transcriptional regulator [Sinorhizobium
           fredii NGR234]
 gi|227339842|gb|ACP24060.1| predicted LuxR family transcriptional regulator [Sinorhizobium
           fredii NGR234]
          Length = 245

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 113/228 (49%), Positives = 149/228 (65%), Gaps = 16/228 (7%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
           +R  L+ R+       S    +  LTEYVGA+H LL R DL Q+  LD ++ SDWPFD+V
Sbjct: 25  SREQLIRRLGEAAERSSLANGLAILTEYVGATHHLLARHDLSQDGGLDFVLCSDWPFDVV 84

Query: 88  RCMA---------LSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVA 138
           R +A          +E +K    LQ       P F  LP++I  P G++  YCS+TF+V 
Sbjct: 85  RRLASIVIGLNAKTTELEKCLAALQ-------PCFQVLPDDIDLPRGVNRSYCSVTFNVG 137

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWIS 198
           R R  LMLLFP+  I+ ++ L +I +LA+Y A+      V   +DFELT RE+ECL WI+
Sbjct: 138 RSRFSLMLLFPEDVILSQEGLRDIAVLASYLASFKAGAGVRHDRDFELTEREIECLFWIA 197

Query: 199 EGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EGKTS+EIAVILGISRNT+NNYI S+MRKTAT+TRS AIA+AVR+N+V
Sbjct: 198 EGKTSEEIAVILGISRNTINNYITSVMRKTATRTRSEAIAHAVRHNLV 245


>gi|222149995|ref|YP_002550952.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
 gi|221736977|gb|ACM37940.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
          Length = 248

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 152/233 (65%), Gaps = 5/233 (2%)

Query: 18  QRTSFVSHLPTRSDLLARMIPLDCTVSWTMR--MYALTEYVGASHFLLVRWDLFQEQKLD 75
           Q+T+     P   D + R +      S  +R  M+ LT+Y GASH+LL R+DL QE  LD
Sbjct: 17  QKTANRPEGPRLRDAMIRQLS-SAASSGKLRVAMHILTDYAGASHYLLARYDLIQEHGLD 75

Query: 76  SIVSSDWPFDLVRCMA--LSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSL 133
            +V++DWPFDL R +A  LS        L++   L    F  LP+++  P G   +YCS+
Sbjct: 76  FVVTADWPFDLARGVATELSAACSRATELEKCLGLLQAKFVLLPDDLELPLGASRQYCSV 135

Query: 134 TFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVEC 193
            F+V R R+ L++L P G +I  DRL ++GLLAAY  ++         +DFELT RE+EC
Sbjct: 136 MFNVGRTRLALVMLLPDGFVISPDRLRDVGLLAAYCVSLSTGRSQKADRDFELTERELEC 195

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L WI+EGKTSDEIA ILGISRNT+NNYI S+MRKTATKTRS AIAYAVRNN+V
Sbjct: 196 LFWIAEGKTSDEIATILGISRNTINNYITSVMRKTATKTRSEAIAYAVRNNLV 248


>gi|325291913|ref|YP_004277777.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
 gi|325059766|gb|ADY63457.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
          Length = 251

 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 136/197 (69%), Gaps = 2/197 (1%)

Query: 52  LTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMA--LSEKDKYYNVLQRPTELF 109
           L  Y GASH+LL R DL +E  L  I++SDWPFDLVR +   L+      + +++   L 
Sbjct: 55  LVTYAGASHYLLAREDLLEETGLKFIITSDWPFDLVRRLGAELANSQNRSSEMEKCLSLL 114

Query: 110 CPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQ 169
            P    LP++++ P G+D +Y +L+F V RIR+ L+LLFP+  +   DRL EI LL  Y 
Sbjct: 115 QPRLLVLPDDVSVPFGIDRQYSALSFCVGRIRLSLLLLFPEHSVPSPDRLREIALLTGYC 174

Query: 170 ANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTA 229
            +   + +    +D +LT RE+ECL WI+EGKTSDEIA+ILGISRNT+NNYI S+MRKTA
Sbjct: 175 VSFGIASEAKAVRDIDLTERELECLFWIAEGKTSDEIAMILGISRNTINNYITSVMRKTA 234

Query: 230 TKTRSGAIAYAVRNNIV 246
           TKTRS AIAYAVRNN+V
Sbjct: 235 TKTRSEAIAYAVRNNLV 251


>gi|159184353|ref|NP_353554.2| LuxR family transcriptional regulator [Agrobacterium tumefaciens
           str. C58]
 gi|159139669|gb|AAK86339.2| transcriptional regulator, LuxR family [Agrobacterium tumefaciens
           str. C58]
          Length = 226

 Score =  194 bits (493), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 136/197 (69%), Gaps = 2/197 (1%)

Query: 52  LTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMA--LSEKDKYYNVLQRPTELF 109
           L  Y GASH+LL R DL +E  L  IV+SDWPFDLVR +   L+      + +++   L 
Sbjct: 30  LVTYAGASHYLLARDDLLEETGLKFIVTSDWPFDLVRRLGIELTNSQNRSSEMEKCLSLL 89

Query: 110 CPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQ 169
            P    LP++++ P G+D +Y +L+F V RIR+ L+LLFP+  +   +RL EI LL  Y 
Sbjct: 90  QPRLLLLPDDVSVPYGIDRQYSALSFCVGRIRLSLLLLFPEEAVPSPERLREIALLTGYC 149

Query: 170 ANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTA 229
            +   + +    +D +LT RE+ECL WI+EGKTSDEIA+ILGISRNT+NNYI S+MRKTA
Sbjct: 150 VSFGIASEAKTVRDIDLTERELECLFWIAEGKTSDEIAMILGISRNTINNYITSVMRKTA 209

Query: 230 TKTRSGAIAYAVRNNIV 246
           TKTRS AIAYAVRNN+V
Sbjct: 210 TKTRSEAIAYAVRNNLV 226


>gi|218658162|ref|ZP_03514092.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli IE4771]
          Length = 144

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 107/144 (74%)

Query: 103 QRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEI 162
           ++  ++F P F  LPE+   P G   +YCSLTF+V R R+ LM LF +G I+  +RL ++
Sbjct: 1   EKCMQVFQPNFALLPESAAVPEGASRQYCSLTFNVGRSRLALMFLFGEGFILSPERLRDV 60

Query: 163 GLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIA 222
           GLLA Y A+  +       +DFELT RE+ECL WI+EGKTSDEIA+ILGISRNT+NNYI 
Sbjct: 61  GLLAGYVASFLRCGGARVDRDFELTDRELECLFWIAEGKTSDEIAMILGISRNTINNYIT 120

Query: 223 SIMRKTATKTRSGAIAYAVRNNIV 246
           S+MRKTATKTRS AIA+AVRNN+V
Sbjct: 121 SVMRKTATKTRSEAIAFAVRNNLV 144


>gi|163758000|ref|ZP_02165088.1| putative GerE/LuxR family transcriptional regulator [Hoeflea
           phototrophica DFL-43]
 gi|162284289|gb|EDQ34572.1| putative GerE/LuxR family transcriptional regulator [Hoeflea
           phototrophica DFL-43]
          Length = 224

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 124/204 (60%), Gaps = 15/204 (7%)

Query: 52  LTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMA--LSEKDKYYNVLQRPTELF 109
           +++Y GA  +L+ R+D + ++  D +++S+WPFDLVR +   L +     + + R    F
Sbjct: 27  ISDYTGAKCYLVARYDHYSDRHHDFVLTSNWPFDLVRNLGAGLVDAQARTSEVSRCLHAF 86

Query: 110 CPVFH-------TLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEI 162
            P+F         LPEN++P      R C + ++V ++R+ + LLF K   +  DR+ + 
Sbjct: 87  EPLFQDVDGVAVNLPENLSP------RVCLVPYNVGKVRLLMALLFEKDAFVSHDRIRDA 140

Query: 163 GLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIA 222
            L A+Y A  F           +LT REVECL+WI EGKTSDEIA+I+GISRNTVNNYI 
Sbjct: 141 ALAASYHAVHFTEITTTSDSLSDLTDREVECLSWIGEGKTSDEIALIIGISRNTVNNYIT 200

Query: 223 SIMRKTATKTRSGAIAYAVRNNIV 246
           SIM KT  KTRS A+A+AVR  I+
Sbjct: 201 SIMNKTGAKTRSEAVAFAVRQRII 224


>gi|218514697|ref|ZP_03511537.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli 8C-3]
          Length = 124

 Score =  161 bits (407), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 78/124 (62%), Positives = 96/124 (77%)

Query: 123 PAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGK 182
           P G   +YCSLTF+V R R+ LM LF +G I+  +RL ++GLLA Y A+  +       +
Sbjct: 1   PEGASRQYCSLTFNVGRSRLALMFLFGEGFILSPERLRDVGLLAGYVASFLRCGGARVDR 60

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           DFELT RE+ECL WI+EGKTSDEIA+ILGISRNT+NNYI S+MRKTATKTRS AIA+AVR
Sbjct: 61  DFELTDRELECLFWIAEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIAFAVR 120

Query: 243 NNIV 246
           NN+V
Sbjct: 121 NNLV 124


>gi|218671090|ref|ZP_03520761.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli GR56]
          Length = 202

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 77/185 (41%), Positives = 109/185 (58%), Gaps = 6/185 (3%)

Query: 13  NREDEQRTSFVSH----LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDL 68
           ++ + Q  +F S     L  R +L+ R+  +  T      + ALTEYVGASH+LL R DL
Sbjct: 9   SKGERQMINFASAVAPALLPRDELIQRLHSVASTGRLQSGLRALTEYVGASHYLLARCDL 68

Query: 69  FQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNV--LQRPTELFCPVFHTLPENITPPAGM 126
            QE  LD +V+SDWPFDLV+ +A +    Y     L++  ++F P F  LPE+   P G 
Sbjct: 69  IQESGLDFVVASDWPFDLVKDIANNLVSGYARSTELEKCMQVFQPNFALLPESADVPEGA 128

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFEL 186
             +YCSLTF+V R R+ LM LF +G I+  +RL ++GLLA Y A+  +       +DFEL
Sbjct: 129 SRQYCSLTFNVGRSRLALMFLFGEGFILSPERLRDVGLLAGYVASFLRCGGARVDRDFEL 188

Query: 187 TGREV 191
           T RE+
Sbjct: 189 TDREL 193


>gi|218680630|ref|ZP_03528527.1| transcriptional regulator, LuxR family protein [Rhizobium etli CIAT
           894]
          Length = 186

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 81/134 (60%), Gaps = 2/134 (1%)

Query: 20  TSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVS 79
           ++ V+ L  R +LL R+  +  T      + ALTEYVGASH+LL R DL QE  LD IVS
Sbjct: 20  SAVVADLLPRDELLQRLHGVADTGRLQSGLRALTEYVGASHYLLARCDLLQESGLDFIVS 79

Query: 80  SDWPFDLVRCMALSEKDKYYNV--LQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           SDWPFDLVR +A      Y     L++  ++F P F  +P+N   P G   +YCSLTF+V
Sbjct: 80  SDWPFDLVRDIANDLVRGYARSTELEKCMQVFQPNFALMPDNADVPDGASRQYCSLTFNV 139

Query: 138 ARIRIGLMLLFPKG 151
            R R+ LM LF +G
Sbjct: 140 GRSRLALMFLFRRG 153


>gi|218509885|ref|ZP_03507763.1| LuxR family transcriptional regulator [Rhizobium etli Brasil 5]
          Length = 49

 Score = 85.9 bits (211), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 41/49 (83%), Positives = 47/49 (95%)

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +EGKTSDEIA+ILGISRNT+NNYI S+MRKTATKTRS AIA+AVRNN+V
Sbjct: 1   AEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIAFAVRNNLV 49


>gi|260466634|ref|ZP_05812822.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|259029640|gb|EEW30928.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
          Length = 236

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 97/210 (46%), Gaps = 18/210 (8%)

Query: 52  LTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMA------LSEKDKYYNVLQRP 105
           LT  +GA  ++LV     Q++    IVSS+W FD +  +       L++         RP
Sbjct: 30  LTAEIGADSYMLVAMVHDQDRNDARIVSSNWIFDAIELIGKRLIAGLAQGTLTVAPGTRP 89

Query: 106 TELFCPVFHTLPENITPPAGMDNRYC---------SLTFDVARIRIGLMLLFPKGRIILR 156
             L   V    P+     +G + R           SL  +V R R+  +        I +
Sbjct: 90  RPL---VAAQAPDADGLVSGEEARLLDVLGHAEIYSLRLNVGRQRLFALFSAASAGKIDQ 146

Query: 157 DRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNT 216
             L +  L   Y  +              L+ RE ECL W+SEGKT+DE+AVILG+S NT
Sbjct: 147 PALMKAQLKCCYALSHIPQLIAAAAMQDPLSDRERECLFWVSEGKTTDEVAVILGVSSNT 206

Query: 217 VNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           VN+YI   ++K A   R+ AIA A+R+ I+
Sbjct: 207 VNSYITHAIQKFAASNRAMAIATAIRSGII 236


>gi|319781696|ref|YP_004141172.1| LuxR family transcription regulator [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167584|gb|ADV11122.1| regulatory protein LuxR [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 236

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/244 (30%), Positives = 107/244 (43%), Gaps = 31/244 (12%)

Query: 18  QRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI 77
           Q  +  S L +R DL           S+ M+   LT  +GA  ++LV     Q++    I
Sbjct: 9   QSDTLGSRLTSRGDL----------TSFFMQ---LTAEIGADSYMLVAIVHDQDRNDARI 55

Query: 78  VSSDWPFDLVRCMA------LSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYC 131
           VSS+W FD +  +       L++         RP  L   V    PE      G + R  
Sbjct: 56  VSSNWIFDAIELIGKRLIAGLAQGALTVAPGIRPQPL---VASRAPEADGLVTGEEARLL 112

Query: 132 ---------SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGK 182
                    SL  +V R R+  +        I +  L    L   Y  +           
Sbjct: 113 DVLGHAEIYSLRLNVGRQRLFALFSAATAGSIDQPALMRAQLKCCYALSHIPQLIAAAAM 172

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
              L+ RE ECL W+SEGKT+DE+AVILG+S NTVN+YI   ++K A   R+ AIA A+R
Sbjct: 173 QDPLSDRERECLFWVSEGKTTDEVAVILGVSSNTVNSYITHAIQKFAASNRAMAIATAIR 232

Query: 243 NNIV 246
           + I+
Sbjct: 233 SGII 236


>gi|13472561|ref|NP_104128.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
 gi|14023307|dbj|BAB49914.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
          Length = 265

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 98/210 (46%), Gaps = 18/210 (8%)

Query: 52  LTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM------ALSEKDKYYNVLQRP 105
           LT  +GA  ++LV     Q++    IVSS+W FD +  +      +L++         RP
Sbjct: 59  LTAEIGADSYMLVAIVHDQDRNDARIVSSNWIFDAIELIGKRLIASLAQGALTVAPGIRP 118

Query: 106 TELFCPVFHTLPENITPPAGMDNRYC---------SLTFDVARIRIGLMLLFPKGRIILR 156
             L   V    P+     +G + R           SL  +V R R+  +        I +
Sbjct: 119 RPL---VAARAPDADGLVSGEEARLLDVLGHAEIYSLRLNVGRQRLFALFSAATSGQIDQ 175

Query: 157 DRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNT 216
             L +  L   Y  +              L+ RE ECL W+SEGKT+DE+AVILG+S NT
Sbjct: 176 PALMKAQLKCCYALSHIPQLIAAAAMQDPLSDRERECLFWVSEGKTTDEVAVILGVSSNT 235

Query: 217 VNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           VN+YI   ++K A   R+ AIA A+R+ I+
Sbjct: 236 VNSYITHAIQKFAASNRAMAIATAIRSGII 265


>gi|15966467|ref|NP_386820.1| putative transcription regulator protein [Sinorhizobium meliloti
           1021]
 gi|15075738|emb|CAC47293.1| Transcription regulator LuxR family [Sinorhizobium meliloti 1021]
          Length = 247

 Score = 78.6 bits (192), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 101/215 (46%), Gaps = 20/215 (9%)

Query: 49  MYALTEYVGASHFLLVRWDLFQEQKL-DSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTE 107
           M  L    G +HF++ R  L  EQ+  + +V S+WP +LV+     E  +   +++R  +
Sbjct: 36  MRRLISRYGFAHFMIARLPLADEQRFSERLVLSNWPAELVQQYDAGETFQTSELVERLRQ 95

Query: 108 LFCPVFHTLPENITPPAGMDNR--YCSLTFDVARIRIGLMLLFPKGRIIL---------- 155
              PV    PE + P      +  +  L          ++L    G   +          
Sbjct: 96  TKLPVTGG-PELMEPAGKGAGKAAFIRLPPHAGMGHFAVLLHTTYGEPFVAVLSGTRDEP 154

Query: 156 ----RDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILG 211
               R  L+ + LL  ++  + +++D   G   +L+ REVECL W + GK+SDEIA+ILG
Sbjct: 155 AGAERATLY-LALLQLFEC-LERTFDAGSGAREKLSSREVECLRWAAAGKSSDEIAIILG 212

Query: 212 ISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           IS  TV++Y  S  RK     R  AIA A+R  ++
Sbjct: 213 ISAYTVSSYFKSATRKLDAVNRMQAIARAMRMKLI 247


>gi|150397799|ref|YP_001328266.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
 gi|150029314|gb|ABR61431.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
          Length = 247

 Score = 78.2 bits (191), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 112/234 (47%), Gaps = 18/234 (7%)

Query: 30  SDLLARMIPLDCTVSWTMR--MYALTEYVGASHFLLVRWDLFQEQKL-DSIVSSDWPFDL 86
           +D+L  + P      + +   M  L    G +HF++ R  +  EQ+  + ++ S+WP +L
Sbjct: 15  TDMLFEIDPASVRTEYELLHLMRRLISRYGFAHFMIARLPMADEQRFSERLMLSNWPAEL 74

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTF----DVARIRI 142
           V+    SE  +   +++R  +   P+    PE + P      +  ++      D+A   +
Sbjct: 75  VQQYDASETFQASLLIERLRQTKLPIAGG-PELMEPARKGAGKAPAILLPPHADMAHFAV 133

Query: 143 GLMLLFPKGRIIL----RDRL--WEIGLLAAYQANMF----KSYDVHWGKDFELTGREVE 192
            L   + +  +++    RD     E   L      +F    +++D   G   +L+ RE+E
Sbjct: 134 LLHTTYGEPFVVVLSGKRDEPAGGERATLYLALVQLFECLERTFDAGSGAREKLSSREIE 193

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           CL W + GK+SDEIA+ILGIS  TV++Y  S  RK     R  AIA A+R  ++
Sbjct: 194 CLRWAAAGKSSDEIAIILGISAYTVSSYFKSATRKLDAVNRMQAIARAMRMKLI 247


>gi|307300496|ref|ZP_07580276.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
 gi|307318361|ref|ZP_07597796.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306896043|gb|EFN26794.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306904662|gb|EFN35246.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
          Length = 321

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/216 (29%), Positives = 101/216 (46%), Gaps = 22/216 (10%)

Query: 49  MYALTEYVGASHFLLVRWDLFQEQKL-DSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTE 107
           M  L    G +HF++ R  L  EQ+  + +V S+WP +LV+     E  +   +++R  +
Sbjct: 110 MRRLISRYGFAHFMIARLPLADEQRFSERLVLSNWPAELVQQYDAGETFQTSELVERLRQ 169

Query: 108 LFCPVFHTLPENITPPAGMDN---RYCSLTFDVARIRIGLMLLFPKGRIIL--------- 155
              PV  T    +  PAG       +  L          ++L    G   +         
Sbjct: 170 TKLPV--TGGPELMEPAGKGAGKAAFIRLPPHAGMGHFAVLLHTTYGEPFVAVLSGTRDE 227

Query: 156 -----RDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVIL 210
                R  L+ + LL  ++  + +++D   G   +L+ REVECL W + GK+SDEIA+IL
Sbjct: 228 PAGAERATLY-LALLQLFEC-LERTFDAGSGAREKLSSREVECLRWAAAGKSSDEIAIIL 285

Query: 211 GISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           GIS  TV++Y  S  RK     R  AIA A+R  ++
Sbjct: 286 GISAYTVSSYFKSATRKLDAVNRMQAIARAMRMKLI 321


>gi|163760319|ref|ZP_02167402.1| putative transcriptional regulator protein, LuxR family [Hoeflea
           phototrophica DFL-43]
 gi|162282718|gb|EDQ33006.1| putative transcriptional regulator protein, LuxR family [Hoeflea
           phototrophica DFL-43]
          Length = 208

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 67/103 (65%), Gaps = 7/103 (6%)

Query: 151 GRIILRDR----LWEIGLLAAYQANMFKSY-DVHWGKDF--ELTGREVECLTWISEGKTS 203
           G I+LR+R      E+ L+A   + +F+ Y +V    D    L+ RE++ ++W SEGKTS
Sbjct: 105 GLILLRNRERPLHSEVALIAYDASIVFQRYFEVVLSLDSISGLSEREIQIVSWTSEGKTS 164

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            EIA+ILG+S +TVN+YIA+I+RK     R+  +A A+RN ++
Sbjct: 165 SEIAIILGLSEHTVNSYIAAILRKLQVVNRAQMVASALRNGLI 207


>gi|330831695|ref|YP_004394647.1| LuxR family transcriptional regulator [Aeromonas veronii B565]
 gi|328806831|gb|AEB52030.1| Transcriptional regulator, LuxR family [Aeromonas veronii B565]
          Length = 258

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/62 (54%), Positives = 42/62 (67%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EL+ RE ECL W SEGKTS EIA ILGIS  TVN ++  +  KT +K RS AIA  + + 
Sbjct: 182 ELSDREKECLFWASEGKTSWEIATILGISERTVNFHLTQVTNKTDSKNRSQAIAKGITSG 241

Query: 245 IV 246
           I+
Sbjct: 242 II 243


>gi|59940149|gb|AAX12613.1| LuxR-type transcriptional regulator [Aeromonas sp. 1m]
          Length = 260

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLVWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|117619760|ref|YP_858670.1| transcriptional activator protein AhyR/asaR [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117561167|gb|ABK38115.1| transcriptional activator protein AhyR/asaR [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 203

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EL+ RE ECL W SEGKTS EIA ILGIS  TVN ++  +  KT +K R+ AIA ++ + 
Sbjct: 127 ELSDREKECLFWASEGKTSWEIATILGISERTVNFHLNQVTNKTDSKNRNQAIAKSISSG 186

Query: 245 IV 246
           I+
Sbjct: 187 II 188


>gi|145301148|ref|YP_001143989.1| LuxR family transcriptional regulator [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142853920|gb|ABO92241.1| transcriptional regulator, LuxR family [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 260

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EL+ RE ECL W SEGKTS EIA ILGIS  TVN ++  +  KT +K R+ AIA ++ + 
Sbjct: 184 ELSDREKECLFWASEGKTSWEIATILGISERTVNFHLNQVTNKTDSKNRNQAIAKSISSG 243

Query: 245 IV 246
           I+
Sbjct: 244 II 245


>gi|59940143|gb|AAX12610.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. sobria]
          Length = 260

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 42/66 (63%), Gaps = 1/66 (1%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           GKD  LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  
Sbjct: 179 GKD-PLTERETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKG 237

Query: 241 VRNNIV 246
           V   ++
Sbjct: 238 VSTGLL 243


>gi|66277270|gb|AAY44566.1| LuxR-like protein [Aeromonas sp. ym3]
          Length = 260

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|66277274|gb|AAY44568.1| LuxR-like protein [Aeromonas sp. CCRC 13880]
          Length = 260

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940145|gb|AAX12611.1| LuxR-type transcriptional regulator [Aeromonas sp. QM 21725]
          Length = 260

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940071|gb|AAX12574.1| LuxR-type transcriptional regulator [Aeromonas caviae]
 gi|59940073|gb|AAX12575.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. sobria]
 gi|59940077|gb|AAX12577.1| LuxR-type transcriptional regulator [Aeromonas enteropelogenes]
 gi|59940085|gb|AAX12581.1| LuxR-type transcriptional regulator [Aeromonas sp. AE-51]
 gi|59940087|gb|AAX12582.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
 gi|59940099|gb|AAX12588.1| LuxR-type transcriptional regulator [Aeromonas sp. AN-24]
 gi|59940113|gb|AAX12595.1| LuxR-type transcriptional regulator [Aeromonas jandaei]
          Length = 260

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|330828294|ref|YP_004391246.1| LuxR-like protein [Aeromonas veronii B565]
 gi|328803430|gb|AEB48629.1| LuxR-like protein [Aeromonas veronii B565]
          Length = 268

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 42/66 (63%), Gaps = 1/66 (1%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           GKD  LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  
Sbjct: 187 GKD-PLTERETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKG 245

Query: 241 VRNNIV 246
           V   ++
Sbjct: 246 VSTGLL 251


>gi|59940109|gb|AAX12593.1| LuxR-type transcriptional regulator [Aeromonas sp. AN-46]
          Length = 260

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940127|gb|AAX12602.1| LuxR-type transcriptional regulator [Aeromonas sp. Manipal A1]
 gi|59940139|gb|AAX12608.1| LuxR-type transcriptional regulator [Aeromonas caviae]
 gi|59940153|gb|AAX12615.1| LuxR-type transcriptional regulator [Aeromonas sp. 12m]
 gi|59940161|gb|AAX12619.1| LuxR-type transcriptional regulator [Aeromonas sp. 19m]
          Length = 260

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940069|gb|AAX12573.1| LuxR-type transcriptional regulator [Aeromonas veronii]
          Length = 260

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 42/66 (63%), Gaps = 1/66 (1%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           GKD  LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  
Sbjct: 179 GKD-PLTERETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKG 237

Query: 241 VRNNIV 246
           V   ++
Sbjct: 238 VSTGLL 243


>gi|59940151|gb|AAX12614.1| LuxR-type transcriptional regulator [Aeromonas sp. 11m]
          Length = 260

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940047|gb|AAX12562.1| LuxR-type transcriptional regulator [Aeromonas jandaei]
 gi|59940057|gb|AAX12567.1| LuxR-type transcriptional regulator [Aeromonas enteropelogenes]
 gi|59940079|gb|AAX12578.1| LuxR-type transcriptional regulator [Aeromonas caviae]
 gi|59940147|gb|AAX12612.1| LuxR-type transcriptional regulator [Aeromonas sp. QM 70363]
          Length = 260

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940095|gb|AAX12586.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
 gi|59940097|gb|AAX12587.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
 gi|89027173|gb|ABD59317.1| AhyR [Aeromonas hydrophila]
          Length = 260

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940157|gb|AAX12617.1| LuxR-type transcriptional regulator [Aeromonas sp. 15m]
          Length = 260

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940081|gb|AAX12579.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. sobria]
 gi|59940101|gb|AAX12589.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
 gi|59940163|gb|AAX12620.1| LuxR-type transcriptional regulator [Aeromonas sp. 26m]
          Length = 260

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940091|gb|AAX12584.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
 gi|59940093|gb|AAX12585.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
          Length = 260

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|88859162|ref|ZP_01133803.1| LuxR, transcriptional regulator [Pseudoalteromonas tunicata D2]
 gi|88819388|gb|EAR29202.1| LuxR, transcriptional regulator [Pseudoalteromonas tunicata D2]
          Length = 233

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 55/96 (57%)

Query: 143 GLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKT 202
           G ++L  +   +L++  ++  ++  Y  + FK       K    T RE+ECL W +EGKT
Sbjct: 130 GCLILRTENNKLLKEEHFKSIVIVIYMYDAFKRCKKKSNKTVNFTKREIECLKWATEGKT 189

Query: 203 SDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           S EI+ IL I+  TVN +IA+ +RKT +  R  AIA
Sbjct: 190 SWEISKILTITDRTVNYHIANCIRKTNSSNRQQAIA 225


>gi|59940075|gb|AAX12576.1| LuxR-type transcriptional regulator [Aeromonas caviae]
          Length = 260

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940103|gb|AAX12590.1| LuxR-type transcriptional regulator [Aeromonas sp. AN-30]
 gi|59940105|gb|AAX12591.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
          Length = 260

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940131|gb|AAX12604.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
          Length = 260

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940111|gb|AAX12594.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. sobria]
          Length = 260

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940089|gb|AAX12583.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
          Length = 260

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940135|gb|AAX12606.1| LuxR-type transcriptional regulator [Aeromonas bestiarum]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|66277264|gb|AAY44563.1| LuxR-like protein [Aeromonas sp. SF8-170]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|66277278|gb|AAY44570.1| LuxR-like protein [Aeromonas sp. CCRC 13980]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|66277276|gb|AAY44569.1| LuxR-like protein [Aeromonas sp. CCRC 13881]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940063|gb|AAX12570.1| LuxR-type transcriptional regulator [Aeromonas popoffii]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|66277282|gb|AAY44572.1| LuxR-like protein [Aeromonas popoffii]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|145300631|ref|YP_001143472.1| transcriptional activator AsaR [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|61218504|sp|P0A3J5|AHYR_AERHY RecName: Full=Transcriptional activator protein AhyR/AsaR
 gi|61218505|sp|P0A3J6|AHYR_AERSA RecName: Full=Transcriptional activator protein AhyR/AsaR
 gi|899145|emb|CAA61654.1| AhyR [Aeromonas hydrophila]
 gi|1519237|gb|AAB70018.1| transcriptional activator [Aeromonas salmonicida]
 gi|142853403|gb|ABO91724.1| transcriptional activator AsaR [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940045|gb|AAX12561.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. sobria]
 gi|59940125|gb|AAX12601.1| LuxR-type transcriptional regulator [Aeromonas salmonicida subsp.
           salmonicida]
 gi|59940159|gb|AAX12618.1| LuxR-type transcriptional regulator [Aeromonas sp. 17m]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|66277272|gb|AAY44567.1| LuxR-like protein [Aeromonas sp. ym4]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940115|gb|AAX12596.1| LuxR-type transcriptional regulator [Aeromonas veronii]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940061|gb|AAX12569.1| LuxR-type transcriptional regulator [Aeromonas encheleia]
 gi|59940121|gb|AAX12599.1| LuxR-type transcriptional regulator [Aeromonas bestiarum]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940133|gb|AAX12605.1| LuxR-type transcriptional regulator [Aeromonas bestiarum]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940123|gb|AAX12600.1| LuxR-type transcriptional regulator [Aeromonas bestiarum]
 gi|59940137|gb|AAX12607.1| LuxR-type transcriptional regulator [Aeromonas bestiarum]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|117618881|ref|YP_855090.1| transcriptional activator protein AhyR [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117560288|gb|ABK37236.1| transcriptional activator protein AhyR [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 261

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 184 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 243

Query: 246 V 246
           +
Sbjct: 244 L 244


>gi|59940117|gb|AAX12597.1| LuxR-type transcriptional regulator [Aeromonas media]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|66277256|gb|AAY44559.1| LuxR-like protein [Aeromonas caviae]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTERETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940067|gb|AAX12572.1| LuxR-type transcriptional regulator [Aeromonas veronii]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940029|gb|AAX12553.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
          Length = 261

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 184 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 243

Query: 246 V 246
           +
Sbjct: 244 L 244


>gi|59940033|gb|AAX12555.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|66277254|gb|AAY44558.1| LuxR-like protein [Aeromonas caviae]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTERETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940031|gb|AAX12554.1| LuxR-type transcriptional regulator [Aeromonas bestiarum]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940035|gb|AAX12556.1| LuxR-type transcriptional regulator [Aeromonas caviae]
          Length = 260

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940037|gb|AAX12557.1| LuxR-type transcriptional regulator [Aeromonas media]
          Length = 260

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940049|gb|AAX12563.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. veronii]
          Length = 260

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNHVTRKTGSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|294055674|ref|YP_003549332.1| transcriptional regulator, LuxR family [Coraliomargarita
           akajimensis DSM 45221]
 gi|293615007|gb|ADE55162.1| transcriptional regulator, LuxR family [Coraliomargarita
           akajimensis DSM 45221]
          Length = 269

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 68/134 (50%), Gaps = 17/134 (12%)

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
           G+DN +C++    +R  I    +  KG         E  LL A QA++  +  + W +  
Sbjct: 117 GIDN-HCAVHVPSSRNEINFFGIERKGGPDFTSE--EKALLEAAQAHLTNARALAWERSL 173

Query: 185 E--------------LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTAT 230
                          LT RE E L+W++EGK++ EIA+++GIS   VN++I +I  KT T
Sbjct: 174 SNHSPINPEKLAQHGLTTRESEILSWLAEGKSNGEIAILMGISSYRVNDHIQAIHTKTNT 233

Query: 231 KTRSGAIAYAVRNN 244
            +R  A  +A+R N
Sbjct: 234 PSRPAAALWAIRAN 247


>gi|59940141|gb|AAX12609.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. sobria]
          Length = 260

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 42/66 (63%), Gaps = 1/66 (1%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           GKD  LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  
Sbjct: 179 GKD-PLTERETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKE 237

Query: 241 VRNNIV 246
           V   ++
Sbjct: 238 VSTGLL 243


>gi|59940083|gb|AAX12580.1| LuxR-type transcriptional regulator [Aeromonas schubertii]
          Length = 260

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSAI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940053|gb|AAX12565.1| LuxR-type transcriptional regulator [Aeromonas schubertii]
          Length = 260

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W S GKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + N I
Sbjct: 183 LTDRETECLFWASRGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAMGISNGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|66277280|gb|AAY44571.1| LuxR-like protein [Aeromonas caviae]
          Length = 258

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + + I
Sbjct: 181 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGI 240

Query: 246 V 246
           +
Sbjct: 241 L 241


>gi|59940107|gb|AAX12592.1| LuxR-type transcriptional regulator [Aeromonas enteropelogenes]
          Length = 258

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + + I
Sbjct: 181 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGI 240

Query: 246 V 246
           +
Sbjct: 241 L 241


>gi|66277284|gb|AAY44573.1| LuxR-like protein [Aeromonas veronii bv. sobria]
          Length = 258

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + + I
Sbjct: 181 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGI 240

Query: 246 V 246
           +
Sbjct: 241 L 241


>gi|66277258|gb|AAY44560.1| LuxR-like protein [Aeromonas veronii]
          Length = 258

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + + I
Sbjct: 181 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGI 240

Query: 246 V 246
           +
Sbjct: 241 L 241


>gi|59940065|gb|AAX12571.1| LuxR-type transcriptional regulator [Aeromonas veronii]
          Length = 258

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + + I
Sbjct: 181 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGI 240

Query: 246 V 246
           +
Sbjct: 241 L 241


>gi|59940119|gb|AAX12598.1| LuxR-type transcriptional regulator [Aeromonas veronii]
          Length = 258

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + + I
Sbjct: 181 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGI 240

Query: 246 V 246
           +
Sbjct: 241 L 241


>gi|66736599|gb|AAY54303.1| quorum sensing trancriptional regulator [Aeromonas veronii]
          Length = 258

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + + I
Sbjct: 181 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGI 240

Query: 246 V 246
           +
Sbjct: 241 L 241


>gi|66277260|gb|AAY44561.1| LuxR-like protein [Aeromonas veronii]
          Length = 258

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + + I
Sbjct: 181 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGI 240

Query: 246 V 246
           +
Sbjct: 241 L 241


>gi|59940043|gb|AAX12560.1| LuxR-type transcriptional regulator [Aeromonas sobria]
          Length = 258

 Score = 65.5 bits (158), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + + I
Sbjct: 181 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGI 240

Query: 246 V 246
           +
Sbjct: 241 L 241


>gi|59940129|gb|AAX12603.1| LuxR-type transcriptional regulator [Aeromonas sp. ABJ]
          Length = 260

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V   I
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSCGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940051|gb|AAX12564.1| LuxR-type transcriptional regulator [Aeromonas veronii]
          Length = 260

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + +
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYHAIANGVSSGM 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|306021776|gb|ADM80305.1| LuxR [Aeromonas sobria]
          Length = 237

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + + I
Sbjct: 163 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGI 222

Query: 246 V 246
           +
Sbjct: 223 L 223


>gi|222149185|ref|YP_002550142.1| transcriptional regulator protein [Agrobacterium vitis S4]
 gi|221736170|gb|ACM37133.1| transcriptional regulator protein [Agrobacterium vitis S4]
          Length = 243

 Score = 65.1 bits (157), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 84/187 (44%), Gaps = 33/187 (17%)

Query: 69  FQEQKLDSIVSSDWPF---DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
           FQ+  +  IVSS+  F   D  + + +S  +K+  ++ +  E F     TLP        
Sbjct: 80  FQDPAIRHIVSSEPSFVWSDFSKTLPISRDEKW--LMDQAKEFFVSNGFTLP-----ILS 132

Query: 126 MDNRYCSLTF------DVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVH 179
           +D R   +TF      D  + R G+ L+     +  R        L  Y AN  ++    
Sbjct: 133 LDGRRAGVTFAGSDIDDSPQARTGMALI--ASLVFAR-------ALELYGANQKQTT--- 180

Query: 180 WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
                 LT RE E + WI+ GKT  EI+VI G+S   V  ++ +IM K    +RS AIA 
Sbjct: 181 -----RLTPREREVIGWIANGKTDWEISVIFGVSEKAVTKHVGNIMMKLGAVSRSHAIAE 235

Query: 240 AVRNNIV 246
           A R  ++
Sbjct: 236 AFRQKLI 242


>gi|59940059|gb|AAX12568.1| LuxR-type transcriptional regulator [Aeromonas allosaccharophila]
          Length = 260

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TV  ++  + RKT + TR  AIA  V + I
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVIYHLNQVTRKTGSMTRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|328542023|ref|YP_004302132.1| transcriptional regulator, LuxR family [polymorphum gilvum
           SL003B-26A1]
 gi|326411773|gb|ADZ68836.1| Transcriptional regulator, LuxR family [Polymorphum gilvum
           SL003B-26A1]
          Length = 239

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 162 IGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYI 221
           +GL A          D  W     LT RE+ECL W++ GKTS EI+ +LGISR+T + Y+
Sbjct: 155 VGLYAYDHVRALSQGDPAWSAG-TLTPRELECLKWVAAGKTSWEISQVLGISRHTADWYL 213

Query: 222 ASIMRKTATKTRSGAIAYAVRNNIV 246
           A  +RK     R+ A+A A R  ++
Sbjct: 214 AEAVRKLGAANRTHAVAEAFRRAMI 238


>gi|66277266|gb|AAY44564.1| LuxR-like protein [Aeromonas sp. ym1]
          Length = 260

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V    
Sbjct: 183 LTDRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYHAIAKGVSTGH 242

Query: 246 V 246
           V
Sbjct: 243 V 243


>gi|66277268|gb|AAY44565.1| LuxR-like protein [Aeromonas sp. ym2]
          Length = 260

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS +IA ILGI+  TVN ++  + RKT +  R  AIA  V   I
Sbjct: 183 LTDRETECLFWASEGKTSGDIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSRGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|59940041|gb|AAX12559.1| LuxR-type transcriptional regulator [Aeromonas eucrenophila]
          Length = 260

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 37/56 (66%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V
Sbjct: 183 LTDRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYHAIAKGV 238


>gi|66277262|gb|AAY44562.1| LuxR-like protein [Aeromonas sp. SF6-7]
          Length = 260

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V    
Sbjct: 183 LTERETECLFWASEGKTSSEIACILGITERTVNYHLNHVTRKTGSMNRYQAIAKGVSTGH 242

Query: 246 V 246
           V
Sbjct: 243 V 243


>gi|222147695|ref|YP_002548652.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
 gi|221734683|gb|ACM35646.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
          Length = 230

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 44/61 (72%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+ECLTW + GKTS EIA I+G+S +T+N+Y+    RK  T  R+ A+A A+R ++
Sbjct: 169 LTEREIECLTWTAAGKTSVEIAEIMGLSEHTINHYLNRATRKLDTVNRTQAVAKALRLSL 228

Query: 246 V 246
           +
Sbjct: 229 I 229


>gi|46370360|gb|AAS89968.1| transcriptional regulator [Agrobacterium vitis]
          Length = 230

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 44/61 (72%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+ECLTW + GKTS EIA I+G+S +T+N+Y+    RK  T  R+ A+A A+R ++
Sbjct: 169 LTEREIECLTWTAAGKTSVEIAEIMGLSEHTINHYLNRATRKLDTVNRTQAVAKALRLSL 228

Query: 246 V 246
           +
Sbjct: 229 I 229


>gi|170745593|ref|YP_001776815.1| LuxR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170752150|ref|YP_001783296.1| LuxR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659247|gb|ACB28299.1| transcriptional regulator, LuxR family [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659277|gb|ACB28328.1| transcriptional regulator, LuxR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 248

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 43/61 (70%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LTGRE ECL W S GK++ EI VIL IS  TV +++ S +RK  + TR+ A+A A+R +I
Sbjct: 187 LTGREAECLKWSSTGKSAWEIGVILSISTRTVEHHLGSAVRKLNSVTRTQAVAEALRRHI 246

Query: 246 V 246
           +
Sbjct: 247 I 247


>gi|190890329|ref|YP_001976871.1| transcriptional regulator protein, LuxR family [Rhizobium etli CIAT
           652]
 gi|190695608|gb|ACE89693.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli CIAT 652]
          Length = 234

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E + W SEGKTS EIA+ILG+S +TVN++I +  RK     R   +A A+RN +
Sbjct: 173 LTQREAEIVKWTSEGKTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVHMVAIALRNGL 232

Query: 246 V 246
           V
Sbjct: 233 V 233


>gi|59940039|gb|AAX12558.1| LuxR-type transcriptional regulator [Aeromonas media]
          Length = 260

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W S+GKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTERETECLFWASDGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKRVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|218461489|ref|ZP_03501580.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli Kim 5]
          Length = 234

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E + W SEGKTS EIA+ILG+S +TVN++I +  RK     R   +A A+RN +
Sbjct: 173 LTQRESEIVKWTSEGKTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVHMVAIALRNGL 232

Query: 246 V 246
           V
Sbjct: 233 V 233


>gi|116250449|ref|YP_766287.1| GerE family transcriptional regulator [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255097|emb|CAK06171.1| putative GerE family transcriptional regulator [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 234

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E + W SEGKTS EIA+ILG+S +TVN++I +  RK     R   +A A+RN +
Sbjct: 173 LTQRESEIVKWTSEGKTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVHMVAIALRNGL 232

Query: 246 V 246
           V
Sbjct: 233 V 233


>gi|86356279|ref|YP_468171.1| LuxR family transcriptional regulator [Rhizobium etli CFN 42]
 gi|86280381|gb|ABC89444.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli CFN 42]
          Length = 234

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E + W SEGKTS EIA+ILG+S +TVN++I +  RK     R   +A A+RN +
Sbjct: 173 LTQRESEIVKWTSEGKTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVHMVAIALRNGL 232

Query: 246 V 246
           V
Sbjct: 233 V 233


>gi|241203072|ref|YP_002974168.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856962|gb|ACS54629.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 234

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E + W SEGKTS EIA+ILG+S +TVN++I +  RK     R   +A A+RN +
Sbjct: 173 LTQRESEIVKWTSEGKTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVHMVAIALRNGL 232

Query: 246 V 246
           V
Sbjct: 233 V 233


>gi|282866538|ref|ZP_06275581.1| two component transcriptional regulator, LuxR family [Streptomyces
           sp. ACTE]
 gi|282558585|gb|EFB64144.1| two component transcriptional regulator, LuxR family [Streptomyces
           sp. ACTE]
          Length = 220

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (54%)

Query: 156 RDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRN 215
           R  +  IG  AA           H G   EL+GREVE L  ++EG+++  I V +G+S  
Sbjct: 129 RPGMAPIGANAARMHRRPPGSPSHPGGYRELSGREVEVLRLVAEGQSNKAIGVSMGLSAL 188

Query: 216 TVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           TV +++A I RK  T  R+G +A A+R  I+
Sbjct: 189 TVKSHLARIARKLGTGDRAGMVAVALRTGII 219


>gi|320007816|gb|ADW02666.1| two component transcriptional regulator, LuxR family [Streptomyces
           flavogriseus ATCC 33331]
          Length = 220

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (54%)

Query: 156 RDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRN 215
           R  +  IG  AA           H G   EL+GREVE L  ++EG+++  I V +G+S  
Sbjct: 129 RPGMAPIGANAARMHRRPPGTPSHPGGYRELSGREVEVLRLVAEGQSNKAIGVSMGLSAL 188

Query: 216 TVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           TV +++A I RK  T  R+G +A A+R  I+
Sbjct: 189 TVKSHLARIARKLGTGDRAGMVAVALRTGII 219


>gi|209547895|ref|YP_002279812.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533651|gb|ACI53586.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 234

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E + W SEGKTS EIA+ILG+S +TVN++I +  RK     R   +A A+RN +
Sbjct: 173 LTQREQEIVKWTSEGKTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVHMVAIALRNGL 232

Query: 246 V 246
           V
Sbjct: 233 V 233


>gi|218662807|ref|ZP_03518737.1| LuxR family transcriptional regulator [Rhizobium etli IE4771]
          Length = 102

 Score = 62.4 bits (150), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E + W SEGKTS EIA+ILG+S +TVN++I +  RK     R   +A A+RN +
Sbjct: 41  LTQRESEIVKWTSEGKTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVHMVAIALRNGL 100

Query: 246 V 246
           V
Sbjct: 101 V 101


>gi|218678644|ref|ZP_03526541.1| transcriptional regulator, LuxR family protein [Rhizobium etli CIAT
           894]
          Length = 172

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E + W SEGKTS EIA+ILG+S +TVN++I +  RK     R   +A A+RN +
Sbjct: 111 LTQREQEIVKWTSEGKTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVHMVAIALRNGL 170

Query: 246 V 246
           V
Sbjct: 171 V 171


>gi|239945114|ref|ZP_04697051.1| putative two-component system response regulator [Streptomyces
           roseosporus NRRL 15998]
 gi|239991577|ref|ZP_04712241.1| putative two-component system response regulator [Streptomyces
           roseosporus NRRL 11379]
 gi|291448577|ref|ZP_06587967.1| two-component system response regulator [Streptomyces roseosporus
           NRRL 15998]
 gi|291351524|gb|EFE78428.1| two-component system response regulator [Streptomyces roseosporus
           NRRL 15998]
          Length = 220

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (54%)

Query: 156 RDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRN 215
           R  +  IG  AA           H G   EL+GREVE L  ++EG+++  I V +G+S  
Sbjct: 129 RPGVAPIGANAARMHRRPPGSPSHPGGYRELSGREVEVLRLVAEGQSNKAIGVSMGLSAL 188

Query: 216 TVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           TV +++A I RK  T  R+G +A A+R  I+
Sbjct: 189 TVKSHLARIARKLGTGDRAGMVAVALRTGII 219


>gi|182435268|ref|YP_001822987.1| putative two-component system response regulator [Streptomyces
           griseus subsp. griseus NBRC 13350]
 gi|326775907|ref|ZP_08235172.1| two component transcriptional regulator, LuxR family [Streptomyces
           cf. griseus XylebKG-1]
 gi|178463784|dbj|BAG18304.1| putative two-component system response regulator [Streptomyces
           griseus subsp. griseus NBRC 13350]
 gi|326656240|gb|EGE41086.1| two component transcriptional regulator, LuxR family [Streptomyces
           cf. griseus XylebKG-1]
          Length = 220

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (54%)

Query: 156 RDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRN 215
           R  +  IG  AA           H G   EL+GREVE L  ++EG+++  I V +G+S  
Sbjct: 129 RPGVAPIGANAARMHRRPPGSPSHPGGYRELSGREVEVLRLVAEGQSNKAIGVSMGLSAL 188

Query: 216 TVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           TV +++A I RK  T  R+G +A A+R  I+
Sbjct: 189 TVKSHLARIARKLGTGDRAGMVAVALRTGII 219


>gi|29828772|ref|NP_823406.1| two-component system response regulator [Streptomyces avermitilis
           MA-4680]
 gi|29605877|dbj|BAC69941.1| putative two-component system response regulator [Streptomyces
           avermitilis MA-4680]
          Length = 220

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 49/91 (53%)

Query: 156 RDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRN 215
           R     IG  AA           H G   EL+GREVE L  ++EG+++  I V +G+S  
Sbjct: 129 RPGAAPIGSAAARMHRRPPGAPSHPGGYRELSGREVEVLRLVAEGQSNKAIGVSMGLSAL 188

Query: 216 TVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           TV +++A I RK  T  R+G +A A+R  I+
Sbjct: 189 TVKSHLARIARKLGTGDRAGMVAVALRTGII 219


>gi|218515768|ref|ZP_03512608.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli 8C-3]
          Length = 234

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE + + W SEGKTS EIA+ILG+S +TVN++I +  RK     R   +A A+RN +
Sbjct: 173 LTQREADIVKWTSEGKTSAEIAIILGLSEHTVNSHITAAARKLDAVNRVHMVAIALRNGL 232

Query: 246 V 246
           V
Sbjct: 233 V 233


>gi|218663810|ref|ZP_03519740.1| hypothetical protein RetlI_33506 [Rhizobium etli IE4771]
          Length = 253

 Score = 61.6 bits (148), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 42/61 (68%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+GRE EC+ W++ GK+S +I  ILGIS+NTV+ +I ++MRK  T +R+ A   A    I
Sbjct: 191 LSGRERECIAWVARGKSSSDIGTILGISKNTVDFHIKNVMRKLDTASRTVAAITAATLGI 250

Query: 246 V 246
           +
Sbjct: 251 I 251


>gi|163758447|ref|ZP_02165535.1| putative LuxR/GerE family transcriptional regulator [Hoeflea
           phototrophica DFL-43]
 gi|162284736|gb|EDQ35019.1| putative LuxR/GerE family transcriptional regulator [Hoeflea
           phototrophica DFL-43]
          Length = 245

 Score = 61.6 bits (148), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (62%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  LT RE ECL W S GKTS EIA IL +S +TVN+Y+ +  RK     R+ A+A A+R
Sbjct: 181 DSPLTERERECLVWTSSGKTSVEIARILSLSEHTVNHYLNNAARKLDAVNRTQAVALAIR 240

Query: 243 NNIV 246
              +
Sbjct: 241 QGFI 244


>gi|239983037|ref|ZP_04705561.1| two-component system response regulator [Streptomyces albus J1074]
 gi|291454869|ref|ZP_06594259.1| two-component system response regulator [Streptomyces albus J1074]
 gi|291357818|gb|EFE84720.1| two-component system response regulator [Streptomyces albus J1074]
          Length = 220

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 49/91 (53%)

Query: 156 RDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRN 215
           R     IG  AA           H G   EL+GREVE L  ++EG+++  I V +G+S  
Sbjct: 129 RPGAAPIGSAAARMHRRPPGAPSHPGGYRELSGREVEVLRLVAEGQSNKAIGVSMGLSAL 188

Query: 216 TVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           TV +++A I RK  T  R+G +A A+R  I+
Sbjct: 189 TVKSHLARIARKLGTGDRAGMVAVALRTGII 219


>gi|237807075|ref|YP_002891515.1| transcriptional regulator, LuxR family [Tolumonas auensis DSM 9187]
 gi|237499336|gb|ACQ91929.1| transcriptional regulator, LuxR family [Tolumonas auensis DSM 9187]
          Length = 254

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 38/53 (71%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           L+GRE ECL W+SEGKTS EIA ILGI+  TVN ++ + +RK+  K R   +A
Sbjct: 173 LSGREKECLFWVSEGKTSWEIAQILGITERTVNFHLNNAIRKSGCKNRYQTVA 225


>gi|260461224|ref|ZP_05809472.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|319785401|ref|YP_004144877.1| Autoinducer-binding domain protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|259032761|gb|EEW34024.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|317171289|gb|ADV14827.1| Autoinducer-binding domain protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 248

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           ++++ RE EC+ WIS+GKTS EI  ILG S+NTV+ ++ ++MRK  T  R+   A AV  
Sbjct: 184 YKISDRERECIHWISKGKTSGEIGTILGRSQNTVDFHVKNVMRKLDTTRRTALAAKAVEL 243

Query: 244 NIV 246
            I+
Sbjct: 244 GII 246


>gi|310769028|gb|ADP21168.1| PhzR [Pseudomonas chlororaphis]
          Length = 241

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 39/59 (66%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           D E +GRE + L W ++GKTS+EI VI+G+  +TVN +  +I RK     R  A++YAV
Sbjct: 178 DVEFSGRECDVLRWTADGKTSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAV 236


>gi|297203085|ref|ZP_06920482.1| two-component system response regulator [Streptomyces sviceus ATCC
           29083]
 gi|197712083|gb|EDY56117.1| two-component system response regulator [Streptomyces sviceus ATCC
           29083]
          Length = 220

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 44/68 (64%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H G   EL+GREVE L  ++EG+++  I V +G+S  TV +++A I RK  T  R+G +A
Sbjct: 152 HPGGYRELSGREVEVLRLVAEGQSNKAIGVSMGLSALTVKSHLARIARKLGTGDRAGMVA 211

Query: 239 YAVRNNIV 246
            A+R  I+
Sbjct: 212 VALRTGII 219


>gi|294632015|ref|ZP_06710575.1| two-component system response regulator [Streptomyces sp. e14]
 gi|292835348|gb|EFF93697.1| two-component system response regulator [Streptomyces sp. e14]
          Length = 219

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 44/68 (64%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H G   EL+GREVE L  ++EG+++  I V +G+S  TV +++A I RK  T  R+G +A
Sbjct: 151 HPGGYRELSGREVEVLRLVAEGQSNKAIGVSMGLSALTVKSHLARIARKLGTGDRAGMVA 210

Query: 239 YAVRNNIV 246
            A+R  I+
Sbjct: 211 VALRTGII 218


>gi|149193353|gb|ABR21211.1| PhzR [Pseudomonas chlororaphis subsp. aureofaciens]
          Length = 241

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 39/59 (66%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           D E +GRE + L W ++GKTS+EI VI+G+  +TVN +  +I RK     R  A++YAV
Sbjct: 178 DVEFSGRECDVLRWTADGKTSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAV 236


>gi|6572977|gb|AAF17494.1|AF195615_2 transcriptional activator PhzR [Pseudomonas chlororaphis]
          Length = 241

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 39/59 (66%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           D E +GRE + L W ++GKTS+EI VI+G+  +TVN +  +I RK     R  A++YAV
Sbjct: 178 DVEFSGRECDVLRWTADGKTSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAV 236


>gi|329940179|ref|ZP_08289461.1| putative two-component system response regulator [Streptomyces
           griseoaurantiacus M045]
 gi|329301005|gb|EGG44901.1| putative two-component system response regulator [Streptomyces
           griseoaurantiacus M045]
          Length = 219

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 44/68 (64%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H G   EL+GREVE L  ++EG+++  I V +G+S  TV +++A I RK  T  R+G +A
Sbjct: 151 HPGGYRELSGREVEVLRLVAEGQSNKAIGVSMGLSALTVKSHLARIARKLGTGDRAGMVA 210

Query: 239 YAVRNNIV 246
            A+R  I+
Sbjct: 211 VALRTGII 218


>gi|239928247|ref|ZP_04685200.1| two-component system response regulator [Streptomyces ghanaensis
           ATCC 14672]
 gi|291436576|ref|ZP_06575966.1| two-component response regulator [Streptomyces ghanaensis ATCC
           14672]
 gi|302557677|ref|ZP_07310019.1| two-component system response regulator [Streptomyces griseoflavus
           Tu4000]
 gi|89274975|gb|ABD65938.1| two-component response regulator [Streptomyces fungicidicus]
 gi|291339471|gb|EFE66427.1| two-component response regulator [Streptomyces ghanaensis ATCC
           14672]
 gi|302475295|gb|EFL38388.1| two-component system response regulator [Streptomyces griseoflavus
           Tu4000]
          Length = 220

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 44/68 (64%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H G   EL+GREVE L  ++EG+++  I V +G+S  TV +++A I RK  T  R+G +A
Sbjct: 152 HPGGYRELSGREVEVLRLVAEGQSNKAIGVSMGLSALTVKSHLARIARKLGTGDRAGMVA 211

Query: 239 YAVRNNIV 246
            A+R  I+
Sbjct: 212 VALRTGII 219


>gi|302537555|ref|ZP_07289897.1| two-component system response regulator [Streptomyces sp. C]
 gi|302446450|gb|EFL18266.1| two-component system response regulator [Streptomyces sp. C]
          Length = 220

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 44/68 (64%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H G   EL+GREVE L  ++EG+++  I V +G+S  TV +++A I RK  T  R+G +A
Sbjct: 152 HPGGYRELSGREVEVLRLVAEGQSNKAIGVSMGLSALTVKSHLARIARKLGTGDRAGMVA 211

Query: 239 YAVRNNIV 246
            A+R  I+
Sbjct: 212 VALRTGII 219


>gi|302554896|ref|ZP_07307238.1| two-component system response regulator [Streptomyces
           viridochromogenes DSM 40736]
 gi|302472514|gb|EFL35607.1| two-component system response regulator [Streptomyces
           viridochromogenes DSM 40736]
          Length = 220

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 44/68 (64%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H G   EL+GREVE L  ++EG+++  I V +G+S  TV +++A I RK  T  R+G +A
Sbjct: 152 HPGGYRELSGREVEVLRLVAEGQSNKAIGVSMGLSALTVKSHLARIARKLGTGDRAGMVA 211

Query: 239 YAVRNNIV 246
            A+R  I+
Sbjct: 212 VALRTGII 219


>gi|21224361|ref|NP_630140.1| two-component regulator [Streptomyces coelicolor A3(2)]
 gi|256784453|ref|ZP_05522884.1| two-component regulator [Streptomyces lividans TK24]
 gi|289768332|ref|ZP_06527710.1| two-component system response regulator [Streptomyces lividans
           TK24]
 gi|3169043|emb|CAA19241.1| two-component regulator [Streptomyces coelicolor A3(2)]
 gi|289698531|gb|EFD65960.1| two-component system response regulator [Streptomyces lividans
           TK24]
          Length = 220

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 44/68 (64%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H G   EL+GREVE L  ++EG+++  I V +G+S  TV +++A I RK  T  R+G +A
Sbjct: 152 HPGGYRELSGREVEVLRLVAEGQSNKAIGVSMGLSALTVKSHLARIARKLGTGDRAGMVA 211

Query: 239 YAVRNNIV 246
            A+R  I+
Sbjct: 212 VALRTGII 219


>gi|295835904|ref|ZP_06822837.1| two-component system response regulator [Streptomyces sp. SPB74]
 gi|333023773|ref|ZP_08451837.1| putative two-component system response regulator [Streptomyces sp.
           Tu6071]
 gi|295825771|gb|EFG64471.1| two-component system response regulator [Streptomyces sp. SPB74]
 gi|332743625|gb|EGJ74066.1| putative two-component system response regulator [Streptomyces sp.
           Tu6071]
          Length = 219

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 44/68 (64%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H G   EL+GREVE L  ++EG+++  I V +G+S  TV +++A I RK  T  R+G +A
Sbjct: 151 HPGGYRELSGREVEVLRLVAEGQSNKAIGVSMGLSALTVKSHLARIARKLGTGDRAGMVA 210

Query: 239 YAVRNNIV 246
            A+R  I+
Sbjct: 211 VALRTGII 218


>gi|294815678|ref|ZP_06774321.1| Two-component regulator [Streptomyces clavuligerus ATCC 27064]
 gi|326444025|ref|ZP_08218759.1| putative two-component system response regulator [Streptomyces
           clavuligerus ATCC 27064]
 gi|294328277|gb|EFG09920.1| Two-component regulator [Streptomyces clavuligerus ATCC 27064]
          Length = 221

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 44/68 (64%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H G   EL+GREVE L  ++EG+++  I V +G+S  TV +++A I RK  T  R+G +A
Sbjct: 153 HPGGYRELSGREVEVLRLVAEGQSNKAIGVSMGLSALTVKSHLARIARKLGTGDRAGMVA 212

Query: 239 YAVRNNIV 246
            A+R  I+
Sbjct: 213 VALRTGII 220


>gi|328885874|emb|CCA59113.1| two-component regulator [Streptomyces venezuelae ATCC 10712]
          Length = 221

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 44/68 (64%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H G   EL+GREVE L  ++EG+++  I V +G+S  TV +++A I RK  T  R+G +A
Sbjct: 153 HPGGYRELSGREVEVLRLVAEGQSNKAIGVSMGLSALTVKSHLARIARKLGTGDRAGMVA 212

Query: 239 YAVRNNIV 246
            A+R  I+
Sbjct: 213 VALRTGII 220


>gi|302522529|ref|ZP_07274871.1| two-component system response regulator [Streptomyces sp. SPB78]
 gi|302431424|gb|EFL03240.1| two-component system response regulator [Streptomyces sp. SPB78]
          Length = 219

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 44/68 (64%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H G   EL+GREVE L  ++EG+++  I V +G+S  TV +++A I RK  T  R+G +A
Sbjct: 151 HPGGYRELSGREVEVLRLVAEGQSNKAIGVSMGLSALTVKSHLARIARKLGTGDRAGMVA 210

Query: 239 YAVRNNIV 246
            A+R  I+
Sbjct: 211 VALRTGII 218


>gi|297191334|ref|ZP_06908732.1| two-component system response regulator [Streptomyces
           pristinaespiralis ATCC 25486]
 gi|197720655|gb|EDY64563.1| two-component system response regulator [Streptomyces
           pristinaespiralis ATCC 25486]
          Length = 220

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 44/68 (64%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H G   EL+GREVE L  ++EG+++  I V +G+S  TV +++A I RK  T  R+G +A
Sbjct: 152 HPGGYRELSGREVEVLRLVAEGQSNKAIGVSMGLSALTVKSHLARIARKLGTGDRAGMVA 211

Query: 239 YAVRNNIV 246
            A+R  I+
Sbjct: 212 VALRTGII 219


>gi|269837643|ref|YP_003319871.1| two component transcriptional regulator, LuxR family [Sphaerobacter
           thermophilus DSM 20745]
 gi|269786906|gb|ACZ39049.1| two component transcriptional regulator, LuxR family [Sphaerobacter
           thermophilus DSM 20745]
          Length = 234

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 63/118 (53%), Gaps = 5/118 (4%)

Query: 130 YCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSY----DVHWGKDFE 185
           YC+   D A + + ++    +G  ++ + +     +A+   + F+      +V  G    
Sbjct: 103 YCTKDIDPAEL-VTVIRRVARGEYLINENVLSRPFVASRVLDQFRELAQIDEVSSGVFSP 161

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           LT REVE L  ++ G ++ EIA +L IS  TV N+I SI+RK A   R+ A+ YA+R+
Sbjct: 162 LTPREVEILDCVARGNSNKEIARLLNISDQTVKNHITSILRKLAVNDRTQAVIYALRH 219


>gi|290956584|ref|YP_003487766.1| two-component response regulator [Streptomyces scabiei 87.22]
 gi|260646110|emb|CBG69203.1| putative two-component response regulator [Streptomyces scabiei
           87.22]
          Length = 198

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 44/68 (64%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H G   EL+GREVE L  ++EG+++  I V +G+S  TV +++A I RK  T  R+G +A
Sbjct: 130 HPGGYRELSGREVEVLRLVAEGQSNKAIGVSMGLSALTVKSHLARIARKLGTGDRAGMVA 189

Query: 239 YAVRNNIV 246
            A+R  I+
Sbjct: 190 VALRTGII 197


>gi|218673534|ref|ZP_03523203.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli GR56]
          Length = 245

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE++CL W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  +
Sbjct: 184 LTDREIDCLNWTAAGKTSAEIAEILALSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGL 243

Query: 246 V 246
           +
Sbjct: 244 I 244


>gi|306850701|gb|ADN06870.1| transcriptional activator PhzR [Pseudomonas sp. CMR12a]
          Length = 241

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 58/111 (52%), Gaps = 7/111 (6%)

Query: 138 ARIRIGLMLLFPKGRII-------LRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGRE 190
           A+ R+GL+ L  + + I       L+       + A  + +  ++ D       E +GRE
Sbjct: 126 AQGRVGLLSLARRNKAISAEEFEALKPVTKAFAMAAHEKLSELENDDSSLNVQVEFSGRE 185

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
            + L W ++GKTS+EI VI+G+  +TVN +  +I RK     R  A++YAV
Sbjct: 186 CDVLRWTADGKTSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAV 236


>gi|218661906|ref|ZP_03517836.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli IE4771]
          Length = 245

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE++CL W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  +
Sbjct: 184 LTDREIDCLNWTAAGKTSAEIAEILSLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGL 243

Query: 246 V 246
           +
Sbjct: 244 I 244


>gi|227821019|ref|YP_002824989.1| putative LuxR/GerE family transcriptional regulator [Sinorhizobium
           fredii NGR234]
 gi|227340018|gb|ACP24236.1| putative LuxR/GerE family transcriptional regulator [Sinorhizobium
           fredii NGR234]
          Length = 257

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 101/238 (42%), Gaps = 18/238 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDS-IVSSDWPF 84
           LP   D  + +  L+        M  +T   G   FL+        ++L +  V S+ P 
Sbjct: 20  LPRGGDFASEIAKLETQFDIIRYMRRITHIFGFKTFLICSIPPIDMERLSAATVISNMPA 79

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTL----PENITPPAGMD-------NRYCSL 133
           +L+         ++   ++R  E   P   TL     E  TP +  D       N     
Sbjct: 80  ELLNKYDSLSMLRFSTGVRRLRETTTPFQITLEDWESEGGTPDSAADYIVMLRENGIFQA 139

Query: 134 TF----DVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW-GKDFELTG 188
            +    D    R  ++L+ P+  + +   + E+ ++A +  N        W      L+ 
Sbjct: 140 NYFPVHDAEGGRGAVILMGPEADLPMTAAM-ELQMIAIHVYNRLAEIGSVWKSSSTTLSE 198

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE++CL+W + GKTS EIA ILG+S +TVN+Y+  + +K     R+ A+  A++   +
Sbjct: 199 REIQCLSWTAAGKTSAEIAGILGLSEHTVNHYLNHVTKKLDAVNRTQAVVKAMKKGYI 256


>gi|318061060|ref|ZP_07979781.1| two-component response regulator [Streptomyces sp. SA3_actG]
          Length = 198

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 44/68 (64%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H G   EL+GREVE L  ++EG+++  I V +G+S  TV +++A I RK  T  R+G +A
Sbjct: 130 HPGGYRELSGREVEVLRLVAEGQSNKAIGVSMGLSALTVKSHLARIARKLGTGDRAGMVA 189

Query: 239 YAVRNNIV 246
            A+R  I+
Sbjct: 190 VALRTGII 197


>gi|86356503|ref|YP_468395.1| LuxR family transcriptional regulator [Rhizobium etli CFN 42]
 gi|86280605|gb|ABC89668.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CFN 42]
          Length = 248

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE++CL W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  +
Sbjct: 187 LTDREIDCLNWTAAGKTSAEIAEILALSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGL 246

Query: 246 V 246
           +
Sbjct: 247 I 247


>gi|218463393|ref|ZP_03503484.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli Kim 5]
          Length = 245

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE++CL W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  +
Sbjct: 184 LTEREIDCLNWTAAGKTSAEIAEILSLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGL 243

Query: 246 V 246
           +
Sbjct: 244 I 244


>gi|48375112|gb|AAT42219.1| PcoR [Pseudomonas fluorescens]
          Length = 234

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 53/98 (54%), Gaps = 4/98 (4%)

Query: 153 IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGREVECLTWISEGKTSDEIAV 208
           +I    L +  L+  Y    F+       K+FE    LT RE+ECL W++ GKTS EI+ 
Sbjct: 135 LINAQGLPQFALMRDYLIESFQKLQNASEKEFETPPXLTARELECLKWVAAGKTSWEISR 194

Query: 209 ILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           IL  +  TVN ++ + MRK   ++R  A+   +R+ +V
Sbjct: 195 ILSCAEVTVNYHVTNFMRKFNAESRQHAVISGIRSGLV 232


>gi|167567698|ref|ZP_02360614.1| response regulator receiver protein [Burkholderia oklahomensis
           EO147]
          Length = 347

 Score = 59.3 bits (142), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 39/59 (66%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           F LT RE E L W+S GKT+ +I  ILGI+  TVN ++  + RK   +TR+GA A A++
Sbjct: 284 FGLTMREAEVLLWVSHGKTNRDIGDILGITPRTVNKHLEHLFRKLHVETRAGATAAAIK 342


>gi|298247008|ref|ZP_06970813.1| transcriptional regulator, LuxR family [Ktedonobacter racemifer DSM
           44963]
 gi|297549667|gb|EFH83533.1| transcriptional regulator, LuxR family [Ktedonobacter racemifer DSM
           44963]
          Length = 644

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (66%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
            +L+ REVE L  ++ GK++ +I  IL IS  TV N+IASI  KT    R+GA A+A+R+
Sbjct: 581 LDLSEREVEVLRLVATGKSNRQIGEILVISERTVINHIASIFNKTGVSNRAGATAFAIRH 640

Query: 244 NIV 246
            +V
Sbjct: 641 KLV 643


>gi|90415637|ref|ZP_01223571.1| hypothetical protein GB2207_09976 [marine gamma proteobacterium
           HTCC2207]
 gi|90332960|gb|EAS48130.1| hypothetical protein GB2207_09976 [marine gamma proteobacterium
           HTCC2207]
          Length = 302

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 39/61 (63%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           + F LT RE E LTWIS+GKT+ EIA+IL  S  T N ++  I RK   + R+ A A ++
Sbjct: 236 EKFGLTAREAEVLTWISKGKTNHEIAIILDFSPRTANKHLEQIFRKLNVENRTTAAAVSL 295

Query: 242 R 242
           R
Sbjct: 296 R 296


>gi|116250693|ref|YP_766531.1| LuxR/GerE family transcriptional regulator [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115255341|emb|CAK06416.1| putative LuxR/GerE family transcriptional regulator [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 245

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE++CL W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  +
Sbjct: 184 LTDREIDCLNWTAAGKTSAEIAEILTLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGL 243

Query: 246 V 246
           +
Sbjct: 244 I 244


>gi|241203295|ref|YP_002974391.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857185|gb|ACS54852.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 244

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE++CL W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  +
Sbjct: 183 LTDREIDCLNWTAAGKTSAEIAEILTLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGL 242

Query: 246 V 246
           +
Sbjct: 243 I 243


>gi|167574776|ref|ZP_02367650.1| response regulator receiver protein [Burkholderia oklahomensis
           C6786]
          Length = 345

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 39/59 (66%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           F LT RE E L W+S GKT+ +I  ILGI+  TVN ++  + RK   +TR+GA A A++
Sbjct: 282 FGLTMREAEVLLWVSHGKTNRDIGDILGITPRTVNKHLEHLFRKLHVETRAGATAAAIK 340


>gi|150396769|ref|YP_001327236.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
 gi|150028284|gb|ABR60401.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
          Length = 246

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 42/65 (64%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +D  LTGRE E LTW + GK+  EIA ILGIS  TV  ++ +  RK    + + A+A+AV
Sbjct: 179 RDLRLTGRETEVLTWSAAGKSYWEIATILGISERTVRFFMTNARRKLNVVSNTQAVAHAV 238

Query: 242 RNNIV 246
           R+ ++
Sbjct: 239 RHALI 243


>gi|27802473|gb|AAO21111.1| BisR [Rhizobium leguminosarum bv. viciae]
          Length = 246

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L  REVECL W S GK S +IA ILG+S +T   Y+ S   K    T S AIA+AV  N+
Sbjct: 178 LGTREVECLHWASRGKDSKDIAEILGLSEHTARGYLKSARYKLGCPTLSAAIAHAVHLNL 237

Query: 246 V 246
           +
Sbjct: 238 I 238


>gi|12620586|gb|AAG60862.1|AF322012_167 ID375 [Bradyrhizobium japonicum]
          Length = 261

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 53/95 (55%), Gaps = 4/95 (4%)

Query: 156 RDRLWEIGLLA-AYQ---ANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILG 211
           +DR+  +  LA A+    A +    D     D  LT RE ECL W++EGK++  I  ++ 
Sbjct: 167 QDRMAHLTTLASAFHNAVAQITPPLDESCETDIPLTPRETECLYWVAEGKSAWVIGQLVN 226

Query: 212 ISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++ NTVN ++ +++RK     R+ A+A A R  I+
Sbjct: 227 VTDNTVNFHMKNVIRKLGAANRTNAVAKATRRGII 261


>gi|15964582|ref|NP_384935.1| putative transcription regulator protein [Sinorhizobium meliloti
           1021]
 gi|307309328|ref|ZP_07588991.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
 gi|307320064|ref|ZP_07599485.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|15073760|emb|CAC45401.1| Putative transcriptional regulator [Sinorhizobium meliloti 1021]
 gi|306894279|gb|EFN25044.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306900197|gb|EFN30815.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
          Length = 277

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 104/239 (43%), Gaps = 20/239 (8%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI-VSSDWPF 84
           LP   D  + +  L+        M  +T+  G   FL+      + ++L +  V S+ P 
Sbjct: 40  LPRGGDFASEIARLETQFDIIRYMRRITQIFGFKTFLICSIPAVEVERLSATTVISNMPA 99

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNR---YCSL-------- 133
           +L+         ++   ++R  E   P F  + E+     G  +    Y ++        
Sbjct: 100 ELLNKYDSLSMLRFSTGVRRLRETTTP-FQVMLEDWEREGGKPDSAADYIAMLRENGIFQ 158

Query: 134 -----TFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW-GKDFELT 187
                  D    R  ++L+ P+  + +   + E+ ++A +  N        W   +  L+
Sbjct: 159 ANYFPVHDAEGGRGAVILMGPEAELPMTAAM-ELQMIAIHVYNRLAEIGSVWKNTNTVLS 217

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE++CL+W + GKTS EIA ILG+S +TVN+Y+  + +K     R+ A+  A++   +
Sbjct: 218 EREIQCLSWTAAGKTSSEIAGILGLSEHTVNHYLNHVTKKLDAVNRTQAVVKAMKKGYI 276


>gi|74316369|ref|YP_314109.1| LuxR family transcriptional regulator [Thiobacillus denitrificans
           ATCC 25259]
 gi|74055864|gb|AAZ96304.1| Transcriptional Regulator, LuxR family [Thiobacillus denitrificans
           ATCC 25259]
          Length = 258

 Score = 58.9 bits (141), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +T RE E L W+ +GKT++EIA ILG+S  TV N++   M+K   +TR  A+A A+
Sbjct: 189 ITAREAEVLAWVRDGKTNEEIAAILGLSMLTVKNHLRHAMQKLVVRTRGQAVARAI 244


>gi|27376991|ref|NP_768520.1| transcriptional regulator [Bradyrhizobium japonicum USDA 110]
 gi|27350133|dbj|BAC47145.1| transcriptional regulatory protein [Bradyrhizobium japonicum USDA
           110]
          Length = 253

 Score = 58.9 bits (141), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 53/95 (55%), Gaps = 4/95 (4%)

Query: 156 RDRLWEIGLLA-AYQ---ANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILG 211
           +DR+  +  LA A+    A +    D     D  LT RE ECL W++EGK++  I  ++ 
Sbjct: 159 QDRMAHLTTLASAFHNAVAQITPPLDESCETDIPLTPRETECLYWVAEGKSAWVIGQLVN 218

Query: 212 ISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++ NTVN ++ +++RK     R+ A+A A R  I+
Sbjct: 219 VTDNTVNFHMKNVIRKLGAANRTNAVAKATRRGII 253


>gi|15965591|ref|NP_385944.1| putative transcription regulator HSL-dependent protein
           [Sinorhizobium meliloti 1021]
 gi|307302711|ref|ZP_07582467.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
 gi|307318559|ref|ZP_07597993.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|15074772|emb|CAC46417.1| Quorum sensing system, AHL autoinducer-binding, luxR family,
           regulator of sinI [Sinorhizobium meliloti 1021]
 gi|306895899|gb|EFN26651.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306903075|gb|EFN33666.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
          Length = 245

 Score = 58.9 bits (141), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 42/65 (64%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +D  LTGRE E LTW + GK+  EIA ILGIS  TV  ++ +  RK    + + A+A+AV
Sbjct: 178 RDLRLTGRETEVLTWSAAGKSYWEIATILGISERTVRFFMTNARRKLNVVSNTQAVAHAV 237

Query: 242 RNNIV 246
           R+ ++
Sbjct: 238 RHALI 242


>gi|218681045|ref|ZP_03528942.1| transcriptional regulator, LuxR family protein [Rhizobium etli CIAT
           894]
          Length = 244

 Score = 58.9 bits (141), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE++CL W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  +
Sbjct: 183 LTDREIDCLNWTAAGKTSAEIAEILTLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGL 242

Query: 246 V 246
           +
Sbjct: 243 I 243


>gi|209548111|ref|YP_002280028.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533867|gb|ACI53802.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 244

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE++CL W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  +
Sbjct: 183 LTDREIDCLNWTAAGKTSAEIAEILTLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGL 242

Query: 246 V 246
           +
Sbjct: 243 I 243


>gi|326797312|ref|YP_004315132.1| LuxR family transcriptional regulator [Marinomonas mediterranea
           MMB-1]
 gi|326548076|gb|ADZ93296.1| transcriptional regulator, LuxR family [Marinomonas mediterranea
           MMB-1]
          Length = 254

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 36/53 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           LT RE E L WIS GKT+ EI++ILGIS NTV N++ASI+ K     R  A A
Sbjct: 198 LTSREREVLNWISSGKTNGEISMILGISPNTVKNHVASILGKLNAPNRLAATA 250


>gi|150395666|ref|YP_001326133.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
 gi|150027181|gb|ABR59298.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
          Length = 286

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 102/239 (42%), Gaps = 20/239 (8%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI-VSSDWPF 84
           LP   D  + +  L+        M  +T+  G   FL+      + ++L +  V S+ P 
Sbjct: 49  LPRGGDFASEIARLETQFDIIRYMRRITQIFGFKTFLICSIPAVEVERLSATTVISNMPA 108

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTL-----PENITPPAGMD-------NRYCS 132
           +L+         ++   ++R  E   P F  L      E   P A  D       N    
Sbjct: 109 ELLNKYDSLSMLRFSTGVRRLRETTTP-FQILLEDWEKEGGKPDAAADYFAMLRENGLLQ 167

Query: 133 LTF----DVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW-GKDFELT 187
             +    D    R  ++L+ P+  + +   + E+ ++A +  N        W   +  L+
Sbjct: 168 ANYFPVHDAEGGRGAVILMGPEAGLPMTAAM-ELQMIAIHVYNRLAEIGSVWKNTNTVLS 226

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE++CL W + GKTS EIA ILG+S +TVN+Y+  + +K     R+ A+  A++   +
Sbjct: 227 EREIQCLNWTAAGKTSSEIAGILGLSEHTVNHYLNHVTKKLDAVNRTQAVVKAMKKGYI 285


>gi|311898876|dbj|BAJ31284.1| putative two-component system response regulator [Kitasatospora
           setae KM-6054]
          Length = 246

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 42/62 (67%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EL+GREVE L  ++EG+++  I V +G+S  TV +++A I RK  T  R+G +A A+R  
Sbjct: 184 ELSGREVEVLRLVAEGQSNKAIGVAMGLSALTVKSHLARIARKLGTGDRAGMVAVALRTG 243

Query: 245 IV 246
           I+
Sbjct: 244 II 245


>gi|62822972|gb|AAY15207.1| transcriptional activator PhzR [Pseudomonas chlororaphis]
          Length = 241

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 38/57 (66%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           E +GRE + L W ++GKTS+EI VI+G+  +TVN +  +I RK     R  A++YAV
Sbjct: 180 EFSGRECDVLRWTADGKTSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAV 236


>gi|315657544|ref|ZP_07910426.1| response regulator [Mobiluncus curtisii subsp. holmesii ATCC 35242]
 gi|315492016|gb|EFU81625.1| response regulator [Mobiluncus curtisii subsp. holmesii ATCC 35242]
          Length = 221

 Score = 58.5 bits (140), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (62%), Gaps = 2/70 (2%)

Query: 179 HWGK--DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           H G+  D  LT RE E LT +SE +T+ +IA  L IS NTV  +I SI++K     R+GA
Sbjct: 151 HAGEPSDTVLTPREKEILTLMSESRTNSQIASRLKISENTVKTHIKSILQKCDAADRAGA 210

Query: 237 IAYAVRNNIV 246
           +A+ +R  I+
Sbjct: 211 VAHGIRQGII 220


>gi|304390336|ref|ZP_07372289.1| possible response regulator [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|304326092|gb|EFL93337.1| possible response regulator [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
          Length = 221

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (62%), Gaps = 2/70 (2%)

Query: 179 HWGK--DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           H G+  D  LT RE E LT +SE +T+ +IA  L IS NTV  +I SI++K     R+GA
Sbjct: 151 HAGEPSDTVLTPREKEILTLMSESRTNSQIASRLKISENTVKTHIKSILQKCDAADRAGA 210

Query: 237 IAYAVRNNIV 246
           +A+ +R  I+
Sbjct: 211 VAHGIRQGII 220


>gi|190890568|ref|YP_001977110.1| transcriptional regulator protein, LuxR family [Rhizobium etli CIAT
           652]
 gi|190695847|gb|ACE89932.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli CIAT 652]
          Length = 246

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE++CL W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  +
Sbjct: 185 LTDREIDCLNWTAAGKTSAEIAEILVLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGL 244

Query: 246 V 246
           +
Sbjct: 245 I 245


>gi|240142578|ref|YP_002967091.1| hypothetical protein MexAM1_META2p0956 [Methylobacterium extorquens
           AM1]
 gi|240012525|gb|ACS43750.1| Hypothetical protein MexAM1_META2p0956 [Methylobacterium extorquens
           AM1]
          Length = 265

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 45/67 (67%)

Query: 180 WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           +G+  +LT REV+ L+W ++GKT+DE +VIL + R TV+ ++++  RK     ++ A+A 
Sbjct: 197 FGRPPKLTSREVDVLSWAAKGKTADETSVILALGRETVHTHLSNACRKLQASNKTHAVAM 256

Query: 240 AVRNNIV 246
           AV   ++
Sbjct: 257 AVHRRLI 263


>gi|327188113|gb|EGE55336.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli CNPAF512]
          Length = 245

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE++CL W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  +
Sbjct: 184 LTDREIDCLNWTAAGKTSAEIAEILVLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGL 243

Query: 246 V 246
           +
Sbjct: 244 I 244


>gi|218508993|ref|ZP_03506871.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli Brasil 5]
          Length = 245

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE++CL W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  +
Sbjct: 184 LTDREIDCLNWTAAGKTSAEIAEILVLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGL 243

Query: 246 V 246
           +
Sbjct: 244 I 244


>gi|307325178|ref|ZP_07604382.1| two component transcriptional regulator, LuxR family [Streptomyces
           violaceusniger Tu 4113]
 gi|306889324|gb|EFN20306.1| two component transcriptional regulator, LuxR family [Streptomyces
           violaceusniger Tu 4113]
          Length = 219

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 42/62 (67%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EL+GREVE L  ++EG+++  I V +G+S  TV +++A I RK  T  R+G +A A+R  
Sbjct: 157 ELSGREVEVLRLVAEGQSNKAIGVSMGLSALTVKSHLARIARKLGTGDRAGMVAVALRTG 216

Query: 245 IV 246
           I+
Sbjct: 217 II 218


>gi|297156497|gb|ADI06209.1| two-component system response regulator [Streptomyces
           bingchenggensis BCW-1]
          Length = 219

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 42/62 (67%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EL+GREVE L  ++EG+++  I V +G+S  TV +++A I RK  T  R+G +A A+R  
Sbjct: 157 ELSGREVEVLRLVAEGQSNKAIGVSMGLSALTVKSHLARIARKLGTGDRAGMVAVALRTG 216

Query: 245 IV 246
           I+
Sbjct: 217 II 218


>gi|1730567|sp|P54303|PHZR_PSECL RecName: Full=Transcriptional activator protein phzR
 gi|496217|gb|AAA21841.1| positive regulatory protein [Pseudomonas chlororaphis subsp.
           aureofaciens]
          Length = 241

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 37/59 (62%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           D E +GRE + L W ++GKTS+EI VI+G+  +TVN +  +I RK     R  A  YAV
Sbjct: 178 DVEFSGRECDVLRWTADGKTSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQASRYAV 236


>gi|14993797|gb|AAK73190.1| transcriptional activator CsaR [Pseudomonas chlororaphis subsp.
           aureofaciens]
          Length = 241

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 39/61 (63%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
            +  EL+ RE E L W ++GK+S EIA+ILGIS NTVN ++  I +K     ++ A AYA
Sbjct: 176 AEQLELSAREREILQWTADGKSSGEIALILGISVNTVNFHLKVIQKKFGAANKTLAAAYA 235

Query: 241 V 241
            
Sbjct: 236 A 236


>gi|222085036|ref|YP_002543565.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
 gi|221722484|gb|ACM25640.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
          Length = 245

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE++CL W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  +
Sbjct: 184 LTDRELDCLNWTAAGKTSAEIAEILTLSEHTVNHYLNRATKKLDTVNRTQAVAKALRVGL 243

Query: 246 V 246
           +
Sbjct: 244 I 244


>gi|28453859|gb|AAO43546.1| transcriptional activator CinR [Rhizobium etli CFN 42]
          Length = 246

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L  RE+ECL W S GK S +I  ILG+S +T   Y+ S   K    T S AIA+AV  N+
Sbjct: 178 LGSREIECLHWASRGKDSKDIGKILGLSEHTTRGYLKSARYKLGCPTLSAAIAHAVHLNL 237

Query: 246 V 246
           +
Sbjct: 238 I 238


>gi|13507195|gb|AAK28504.1| MupR [Pseudomonas fluorescens]
          Length = 234

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 52/98 (53%), Gaps = 4/98 (4%)

Query: 153 IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGREVECLTWISEGKTSDEIAV 208
           +I    L +  L+  Y    F+       K+ E    LT RE+ECL W++ GKTS EI+ 
Sbjct: 135 VIRSKGLPQFALMRDYLIESFQKIQSAAEKEVEKPPKLTARELECLKWVAAGKTSWEISR 194

Query: 209 ILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           IL  +  TVN ++ + MRK   ++R  A+   +R+ +V
Sbjct: 195 ILSCAEVTVNYHVTNFMRKFNAESRQHAVISGIRSGLV 232


>gi|86359866|ref|YP_471757.1| autoinducer transcriptional regulator protein [Rhizobium etli CFN
           42]
 gi|86283968|gb|ABC93030.1| autoinducer transcriptional regulator protein [Rhizobium etli CFN
           42]
          Length = 261

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L  RE+ECL W S GK S +I  ILG+S +T   Y+ S   K    T S AIA+AV  N+
Sbjct: 193 LGSREIECLHWASRGKDSKDIGKILGLSEHTTRGYLKSARYKLGCPTLSAAIAHAVHLNL 252

Query: 246 V 246
           +
Sbjct: 253 I 253


>gi|2495423|sp|Q51786|PHZR_PSEFL RecName: Full=Transcriptional activator protein phzR
 gi|1050313|gb|AAC18899.1| shows homology to luxR family; putative [Pseudomonas fluorescens]
          Length = 244

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 38/59 (64%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           D E + RE + L W ++GKTS+EI VI+G+  +TVN +  +I RK     R  A++YAV
Sbjct: 181 DVEFSERECDVLRWTADGKTSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAV 239


>gi|59940055|gb|AAX12566.1| LuxR-type transcriptional regulator [Aeromonas sp. 'CDC 2478-85']
          Length = 260

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL   +EGKTS EIA ILGI+   VN ++  + RKT +  R  AI   V + I
Sbjct: 183 LTARETECLFLATEGKTSGEIACILGITERPVNYHLNQVTRKTGSMNRCQAIIKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|296133351|ref|YP_003640598.1| two component transcriptional regulator, LuxR family [Thermincola
           sp. JR]
 gi|296031929|gb|ADG82697.1| two component transcriptional regulator, LuxR family [Thermincola
           potens JR]
          Length = 226

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L  +E   L  I+EGKT+ EIA IL +S NT+ NY++ I+ K     R+ A AYAVRNN+
Sbjct: 154 LNPQERRILGLIAEGKTNKEIAQILTLSNNTIKNYVSGILSKLNFSNRAEAAAYAVRNNL 213

Query: 246 V 246
           +
Sbjct: 214 M 214


>gi|148253086|ref|YP_001237671.1| LuxR transcriptional regulator [Bradyrhizobium sp. BTAi1]
 gi|146405259|gb|ABQ33765.1| Regulatory protein, LuxR [Bradyrhizobium sp. BTAi1]
          Length = 201

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%)

Query: 180 WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           W K+  L  RE+E LTW++ GKTS EIA ILG+S+ TV+ +I +   K    TR+ A   
Sbjct: 133 WVKEVNLNHREIETLTWVARGKTSAEIAKILGLSKRTVDFHIDNARIKLGVATRTQAAIK 192

Query: 240 AVRNNIV 246
           AV   ++
Sbjct: 193 AVTGKLI 199


>gi|156744333|ref|YP_001434462.1| two component LuxR family transcriptional regulator [Roseiflexus
           castenholzii DSM 13941]
 gi|156235661|gb|ABU60444.1| two component transcriptional regulator, LuxR family [Roseiflexus
           castenholzii DSM 13941]
          Length = 231

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 40/57 (70%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE++ L  ++ G+T+ EIA +L IS  TV N+I+SI+RK A   R+ A+ YA+R
Sbjct: 161 LSPRELQVLELVAAGRTNKEIAKVLDISNQTVKNHISSILRKLAVNDRTQAVVYAMR 217


>gi|7385149|gb|AAF61719.1|AF232769_1 acylhomoserine lactone dependent transcriptional regulator
           [Pseudomonas fluorescens]
          Length = 241

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (66%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           EL+ RE E L W ++GK+S EIA+ILGIS NTVN ++  I +K     ++ A AYA 
Sbjct: 180 ELSAREREILQWTADGKSSGEIALILGISVNTVNFHLKVIQKKFGAANKTLAAAYAA 236


>gi|218659948|ref|ZP_03515878.1| autoinducer transcriptional regulator protein [Rhizobium etli
           IE4771]
          Length = 246

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L  RE+ECL W S GK S +I  ILG+S +T   Y+ +   K    T S AIA+AV  N+
Sbjct: 178 LGSREIECLHWASRGKDSKDIGKILGLSEHTTRGYLKAARYKLGCPTLSAAIAHAVHLNL 237

Query: 246 V 246
           +
Sbjct: 238 I 238


>gi|163758741|ref|ZP_02165828.1| putative AHL-dependent transcriptional regulator [Hoeflea
           phototrophica DFL-43]
 gi|162284031|gb|EDQ34315.1| putative AHL-dependent transcriptional regulator [Hoeflea
           phototrophica DFL-43]
          Length = 239

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (59%), Gaps = 2/72 (2%)

Query: 177 DVHWGKD--FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRS 234
           ++H G D    L+ RE+ECLT  + GK   +IA+ILG+S +TV  Y+ S   K  +    
Sbjct: 166 EIHGGNDQALHLSPREIECLTLAARGKDHKDIALILGLSGHTVQGYLKSARHKLGSVNIP 225

Query: 235 GAIAYAVRNNIV 246
            AIA A+R+ I+
Sbjct: 226 QAIAEAIRSRII 237


>gi|302388953|ref|YP_003824774.1| two component transcriptional regulator, LuxR family
           [Thermosediminibacter oceani DSM 16646]
 gi|302199581|gb|ADL07151.1| two component transcriptional regulator, LuxR family
           [Thermosediminibacter oceani DSM 16646]
          Length = 213

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E + +I+EG ++ EI+  LGIS  TV N+++SI+RK     R+    YA++NN+
Sbjct: 153 LTAREKEVMAYIAEGMSNIEISEKLGISEKTVKNHVSSILRKLNLMDRTQVAVYALKNNL 212

Query: 246 V 246
           V
Sbjct: 213 V 213


>gi|219846976|ref|YP_002461409.1| LuxR family two component transcriptional regulator [Chloroflexus
           aggregans DSM 9485]
 gi|219541235|gb|ACL22973.1| two component transcriptional regulator, LuxR family [Chloroflexus
           aggregans DSM 9485]
          Length = 229

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE+E L  ++ G+T+ EIA  L IS  TV N+I+SI+RK A   R+ A+ YA+R
Sbjct: 161 LSARELEVLELVAAGRTNREIAAQLDISNQTVKNHISSILRKLAVNDRTQAVVYAMR 217


>gi|218134363|ref|ZP_03463167.1| hypothetical protein BACPEC_02257 [Bacteroides pectinophilus ATCC
           43243]
 gi|217989748|gb|EEC55759.1| hypothetical protein BACPEC_02257 [Bacteroides pectinophilus ATCC
           43243]
          Length = 218

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           D+  GK  +LT RE++ L  I+ G  + EIAV L IS  TV N+I++I RK     R+ A
Sbjct: 146 DIMTGKVNDLTKRELQVLKLIANGMFNREIAVQLKISERTVKNHISNIFRKINVSDRTQA 205

Query: 237 IAYAVRNNIV 246
             +A++N IV
Sbjct: 206 AVFAIKNKIV 215


>gi|238917970|ref|YP_002931487.1| two-component system, NarL family, response regulator DegU
           [Eubacterium eligens ATCC 27750]
 gi|238873330|gb|ACR73040.1| two-component system, NarL family, response regulator DegU
           [Eubacterium eligens ATCC 27750]
          Length = 214

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           DV   K  ELT RE+E L  I+ G  + EIA  L IS  TV N++++I +K     R+ A
Sbjct: 142 DVLKDKVSELTRRELEVLKMIASGAFNKEIASTLNISERTVKNHVSNIFKKIGVSDRTQA 201

Query: 237 IAYAVRNNIV 246
             +A++NNI+
Sbjct: 202 AVFAIKNNII 211


>gi|239820479|ref|YP_002947664.1| transcriptional regulator, LuxR family [Variovorax paradoxus S110]
 gi|239805332|gb|ACS22398.1| transcriptional regulator, LuxR family [Variovorax paradoxus S110]
          Length = 235

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (66%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           LT R+VE L W  +GKTSDEIA IL IS+ TV+ ++ + M +    T+S A A+A R
Sbjct: 174 LTKRQVEVLRWTGDGKTSDEIAAILCISKPTVDFHLRNAMARLGASTKSSAAAFASR 230


>gi|209863456|gb|ACI88828.1| PhzR [Pseudomonas sp. G5(2008b)]
          Length = 241

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 37/56 (66%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
            +GRE + L W ++GKTS+EI VI+G+  +TVN +  +I RK     R  A++YAV
Sbjct: 181 FSGRECDVLRWTADGKTSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAV 236


>gi|309792258|ref|ZP_07686730.1| two component LuxR family transcriptional regulator [Oscillochloris
           trichoides DG6]
 gi|308225799|gb|EFO79555.1| two component LuxR family transcriptional regulator [Oscillochloris
           trichoides DG6]
          Length = 229

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 40/57 (70%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE+E L  ++ G+T+ EIA+ L IS  TV N+++SI+RK A   R+ A+ YA+R
Sbjct: 161 LSPRELEVLELVAAGRTNKEIALNLDISNQTVKNHVSSILRKLAVNDRTQAVVYAMR 217


>gi|92109564|ref|YP_571851.1| LuxR family transcriptional regulator [Nitrobacter hamburgensis
           X14]
 gi|91802646|gb|ABE65019.1| transcriptional regulator, LuxR family [Nitrobacter hamburgensis
           X14]
          Length = 231

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE +CL W  EGKT+ EI+ ILGIS++TV  +I +   K    +++ AIA A+R  +
Sbjct: 170 LTAREWDCLLWAGEGKTNWEISAILGISKSTVTKHIMAARAKLGAVSKAHAIAMAIRTKL 229

Query: 246 V 246
           +
Sbjct: 230 L 230


>gi|88812489|ref|ZP_01127738.1| transcriptional regulator, LuxR family protein [Nitrococcus mobilis
           Nb-231]
 gi|88790275|gb|EAR21393.1| transcriptional regulator, LuxR family protein [Nitrococcus mobilis
           Nb-231]
          Length = 249

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE ECL W +EGKTS EIA ILGIS  T   ++ +  R+    +R  A+A AV   
Sbjct: 183 ELTAREHECLLWAAEGKTSWEIARILGISERTAIFHLQNAARRLNASSRQQAVARAVSQG 242

Query: 245 IV 246
           ++
Sbjct: 243 LI 244


>gi|311696551|gb|ADP99424.1| two-component response regulator [marine bacterium HP15]
          Length = 279

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 37/59 (62%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           FELT RE + L WI+ GKT+ EI  IL +S  TVN ++  + RK   + R+ A A A+R
Sbjct: 216 FELTLRESDVLLWIANGKTNREIGQILDMSPRTVNKHLEQVFRKLGVENRTAAAASAIR 274


>gi|150390890|ref|YP_001320939.1| two component LuxR family transcriptional regulator [Alkaliphilus
           metalliredigens QYMF]
 gi|149950752|gb|ABR49280.1| two component transcriptional regulator, LuxR family [Alkaliphilus
           metalliredigens QYMF]
          Length = 217

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 47/84 (55%), Gaps = 3/84 (3%)

Query: 165 LAAYQANMFKSYDVHWGKD---FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYI 221
           LA+     F   D H  K+    +LT RE E LT I+EG+ + EIA  L IS  TV N++
Sbjct: 131 LASQLVKEFNRRDDHHDKEPREGKLTKREYEVLTLIAEGQNNKEIASNLFISEKTVKNHV 190

Query: 222 ASIMRKTATKTRSGAIAYAVRNNI 245
           ++I +K     R+ A  YA ++NI
Sbjct: 191 SNIFKKIHVNDRTQAAIYAYKHNI 214


>gi|170694163|ref|ZP_02885318.1| transcriptional regulator, LuxR family [Burkholderia graminis
           C4D1M]
 gi|170140903|gb|EDT09076.1| transcriptional regulator, LuxR family [Burkholderia graminis
           C4D1M]
          Length = 262

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT R++ECLTW++ GKTS EI  ILG SR TV  +I   M     ++R+ A  +A    I
Sbjct: 200 LTARQLECLTWVARGKTSAEIGEILGRSRYTVEFHIKEAMDALNIRSRTAAAVHATVQGI 259

Query: 246 V 246
           +
Sbjct: 260 I 260


>gi|160895667|ref|YP_001561249.1| two component LuxR family transcriptional regulator [Delftia
           acidovorans SPH-1]
 gi|160361251|gb|ABX32864.1| two component transcriptional regulator, LuxR family [Delftia
           acidovorans SPH-1]
          Length = 339

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           +   LT RE E L+W+S+GKT+ +IA ILG+S  TVN ++  I  K   +TR+ A A A
Sbjct: 272 QQVALTPRETEVLSWLSKGKTNRDIADILGMSPRTVNKHLEHIFEKLGVETRTAAAAVA 330


>gi|192360065|ref|YP_001981449.1| two-component transcriptional regulator, LuxR family [Cellvibrio
           japonicus Ueda107]
 gi|190686230|gb|ACE83908.1| two-component transcriptional regulator, LuxR family [Cellvibrio
           japonicus Ueda107]
          Length = 312

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           + F +TGRE + L WI+ GKT+ EI  IL +S  TVN ++  I +K   + R+ A A A+
Sbjct: 247 QQFAVTGREADVLRWIANGKTNREIGQILDMSPRTVNKHLEQIFKKLGVENRTSAAAAAI 306

Query: 242 R 242
           +
Sbjct: 307 K 307


>gi|296161870|ref|ZP_06844671.1| transcriptional regulator, LuxR family [Burkholderia sp. Ch1-1]
 gi|295887889|gb|EFG67706.1| transcriptional regulator, LuxR family [Burkholderia sp. Ch1-1]
          Length = 262

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT R++ECLTW++ GKTS EI  ILG S  TV+ +I   M     ++R+ A  +A  + I
Sbjct: 200 LTARQLECLTWVARGKTSAEIGEILGRSHYTVDYHIKEAMEALNIRSRTAAAVHATVHGI 259

Query: 246 V 246
           +
Sbjct: 260 I 260


>gi|163758577|ref|ZP_02165664.1| probable transcriptional regulator protein, LuxR family [Hoeflea
           phototrophica DFL-43]
 gi|162283867|gb|EDQ34151.1| probable transcriptional regulator protein, LuxR family [Hoeflea
           phototrophica DFL-43]
          Length = 237

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           +T RE+E L W + GKTS EIA IL +S +TVN Y+ S MRK     R+  +A A+R ++
Sbjct: 176 ITTRELEVLHWAANGKTSTEIAAILSLSDHTVNTYMNSAMRKLDCVNRTQLVAKALRLHL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|209886745|ref|YP_002290602.1| transcriptional regulator, LuxR family [Oligotropha carboxidovorans
           OM5]
 gi|209874941|gb|ACI94737.1| transcriptional regulator, LuxR family [Oligotropha carboxidovorans
           OM5]
          Length = 195

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE++CL W  EGKT  EI+VILGISR+TV  +I S   K     +  AIA A+R  I
Sbjct: 134 LSPRELDCLLWAGEGKTDWEISVILGISRSTVTKHITSAREKLNAVNKPHAIAIAMRLKI 193

Query: 246 V 246
           +
Sbjct: 194 L 194


>gi|59940155|gb|AAX12616.1| LuxR-type transcriptional regulator [Aeromonas sp. 13m]
          Length = 260

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL   SEGKTS +IA IL I+  TVN ++  + RKT +  R  AIA  V + I
Sbjct: 183 LTDRETECLFCASEGKTSGDIACILRITERTVNYHLNHVTRKTVSMNRYQAIAKGVSSGI 242

Query: 246 V 246
           +
Sbjct: 243 L 243


>gi|300787038|ref|YP_003767329.1| two-component system response regulator [Amycolatopsis mediterranei
           U32]
 gi|299796552|gb|ADJ46927.1| two-component system response regulator [Amycolatopsis mediterranei
           U32]
          Length = 215

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 39/66 (59%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G    LT RE E L  ++EG T+DEI   LG+SRNT  N++  ++ K   +++  A+A A
Sbjct: 149 GGGAALTARERETLDLLAEGATTDEIGARLGVSRNTTRNHVQRVLEKLGARSKLEAVAVA 208

Query: 241 VRNNIV 246
            R  ++
Sbjct: 209 RREGLI 214


>gi|71279244|ref|YP_268811.1| LuxR family transcriptional regulator [Colwellia psychrerythraea
           34H]
 gi|71144984|gb|AAZ25457.1| transcriptional regulator, LuxR family [Colwellia psychrerythraea
           34H]
          Length = 269

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 40/57 (70%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +LT RE +CL W ++GKT++EIA ILG+   T+  YI ++M++   ++++ A+  A+
Sbjct: 196 KLTAREKDCLYWSAQGKTANEIADILGLKTETIRKYIKNVMKRLNARSKTQAVVKAI 252


>gi|298251689|ref|ZP_06975492.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
 gi|297546281|gb|EFH80149.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
          Length = 225

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H   DF LT RE E L  I+ G+   E+   LGI+R TV +Y+ SI  K    +R+ A+A
Sbjct: 151 HENSDFHLTAREREVLAGIASGERGKEVGARLGITRRTVESYLNSIYTKLNVDSRAAAVA 210

Query: 239 YAVRNNIV 246
            A+ + ++
Sbjct: 211 IAIEHGLL 218


>gi|241765736|ref|ZP_04763682.1| two component transcriptional regulator, LuxR family [Acidovorax
           delafieldii 2AN]
 gi|241364396|gb|EER59519.1| two component transcriptional regulator, LuxR family [Acidovorax
           delafieldii 2AN]
          Length = 301

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +  LT RE E L W+++GKT+ +IA ILG+S  TVN ++  I  K   +TRS A A A +
Sbjct: 236 EVPLTPRETEVLAWLAKGKTNRDIADILGMSPRTVNKHLEHIFEKLGVETRSAATAVASK 295


>gi|296448320|ref|ZP_06890211.1| transcriptional regulator, LuxR family [Methylosinus trichosporium
           OB3b]
 gi|296254166|gb|EFH01302.1| transcriptional regulator, LuxR family [Methylosinus trichosporium
           OB3b]
          Length = 254

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (63%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G+  ELT R++E L W+ +GKT+ EI+VILG+S + V  ++  I RK     R+ A+A A
Sbjct: 189 GRGAELTPRQIEILEWLRQGKTNWEISVILGMSVDNVKYHVKQITRKLQVANRTQAVAEA 248

Query: 241 VRNNIV 246
              +++
Sbjct: 249 ASRSVI 254


>gi|167628890|ref|YP_001679389.1| transcriptional regulator, luxr family, putative [Heliobacterium
           modesticaldum Ice1]
 gi|167591630|gb|ABZ83378.1| transcriptional regulator, luxr family, putative [Heliobacterium
           modesticaldum Ice1]
          Length = 214

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (56%), Gaps = 2/74 (2%)

Query: 173 FKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKT 232
           F     H G   ELT RE E L  I++G T+ +IA  L IS  TV N+I +I RK   K 
Sbjct: 141 FNRTVAHSGD--ELTEREKEVLGLIAQGSTNADIASALFISEKTVKNHITNIFRKLQVKD 198

Query: 233 RSGAIAYAVRNNIV 246
           R+ A  YA++N +V
Sbjct: 199 RTQAALYAIKNRLV 212


>gi|92109527|ref|YP_571814.1| LuxR family transcriptional regulator [Nitrobacter hamburgensis
           X14]
 gi|91802609|gb|ABE64982.1| transcriptional regulator, LuxR family [Nitrobacter hamburgensis
           X14]
          Length = 228

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE +CL W  EGKT+ E + ILGISR+TV  +I +   K    +++ AIA A+R  +
Sbjct: 167 LTAREWDCLLWAGEGKTNWETSAILGISRSTVTKHIMAARAKLGAVSKAHAIATAIRTKL 226

Query: 246 V 246
           +
Sbjct: 227 L 227


>gi|326315054|ref|YP_004232726.1| LuxR family two component transcriptional regulator [Acidovorax
           avenae subsp. avenae ATCC 19860]
 gi|323371890|gb|ADX44159.1| two component transcriptional regulator, LuxR family [Acidovorax
           avenae subsp. avenae ATCC 19860]
          Length = 308

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (66%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
            +LT RE E L+WI++GKT+ +IA ILG+S  TVN ++  I  K   +TR+ A A A
Sbjct: 245 VDLTPRETEVLSWIAKGKTNRDIADILGMSPRTVNKHLEHIFEKLGVETRTAAAALA 301


>gi|300870842|ref|YP_003785713.1| two-component system regulator [Brachyspira pilosicoli 95/1000]
 gi|300688541|gb|ADK31212.1| two-component system regulator [Brachyspira pilosicoli 95/1000]
          Length = 320

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (70%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           DF LT RE + L+++  GKT+ EI++I  IS NTVNN++A+I  K+  K R
Sbjct: 260 DFNLTKREKQILSYLLSGKTNKEISLIFDISLNTVNNHVANIYYKSGVKNR 310


>gi|307943595|ref|ZP_07658939.1| LuxR family transcriptional regulator [Roseibium sp. TrichSKD4]
 gi|307773225|gb|EFO32442.1| LuxR family transcriptional regulator [Roseibium sp. TrichSKD4]
          Length = 232

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT REVECL W S G TS EIA  LGISR+T + Y+    +K   + R+ A+  A R  
Sbjct: 170 DLTPREVECLKWSSNGLTSSEIAEKLGISRHTADWYLKEATQKLGAQNRTHAVMIAYRKG 229

Query: 245 IV 246
           ++
Sbjct: 230 LI 231


>gi|13474964|ref|NP_106527.1| hypothetical protein mll8752 [Mesorhizobium loti MAFF303099]
 gi|14025713|dbj|BAB52313.1| mll8752 [Mesorhizobium loti MAFF303099]
          Length = 248

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (64%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +L+ RE EC+ WI+ GK+S EI  ILGIS NTVN ++ + MRK  T +R+ A   A    
Sbjct: 185 DLSLREKECILWIARGKSSWEIGKILGISGNTVNFHLKNAMRKLDTASRTVAAIKATSLG 244

Query: 245 IV 246
           IV
Sbjct: 245 IV 246


>gi|327190710|gb|EGE57792.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli CNPAF512]
          Length = 240

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (61%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           K    T  E++CL   + G+ S EIA +L +S N VNN+I S+++K    TR+ A+  A+
Sbjct: 174 KPIAFTSSELDCLRLTAGGRKSSEIAKLLDLSENAVNNHIGSVIKKLGCTTRTQAVVSAL 233

Query: 242 RNNIV 246
           R NI+
Sbjct: 234 RLNII 238


>gi|225620688|ref|YP_002721946.1| DNA-binding response regulator, LuxR family protein [Brachyspira
           hyodysenteriae WA1]
 gi|225215508|gb|ACN84242.1| DNA-binding response regulator, LuxR family protein [Brachyspira
           hyodysenteriae WA1]
          Length = 317

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (72%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           D  LT RE E L+++ +GKT+ E+++IL IS NTVNN++A+I  K+  K R
Sbjct: 257 DINLTRREKEILSYLLDGKTNKEVSLILSISLNTVNNHVANIYEKSGVKNR 307


>gi|255608035|ref|XP_002538833.1| Transcriptional activator protein ahyR/asaR, putative [Ricinus
           communis]
 gi|223510221|gb|EEF23550.1| Transcriptional activator protein ahyR/asaR, putative [Ricinus
           communis]
          Length = 234

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+ECL W++ GKT  +IA +LG+S+ T   +I    RK   +TRS A+A  V + +
Sbjct: 174 LTHRELECLRWVAAGKTDLQIARLLGVSQTTARTHIDQARRKLGARTRSQAVARLVLSGL 233


>gi|162148611|ref|YP_001603072.1| LuxR family transcriptional regulator [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787188|emb|CAP56781.1| putative transcriptional regulator, luxR family [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 239

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 39/58 (67%)

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE ECL W+S GKT+ +I+VILGIS NT+N Y+ +++ K     R  A+  A+  N++
Sbjct: 180 REKECLLWVSRGKTTWDISVILGISENTINAYLKNVILKLGCSGRIQAVLRAIDLNLI 237


>gi|163848189|ref|YP_001636233.1| regulatory protein LuxR [Chloroflexus aurantiacus J-10-fl]
 gi|222526094|ref|YP_002570565.1| LuxR family two component transcriptional regulator [Chloroflexus
           sp. Y-400-fl]
 gi|163669478|gb|ABY35844.1| regulatory protein LuxR [Chloroflexus aurantiacus J-10-fl]
 gi|222449973|gb|ACM54239.1| two component transcriptional regulator, LuxR family [Chloroflexus
           sp. Y-400-fl]
          Length = 228

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (66%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE+E L  ++ G T+ EIA  L IS  TV N+I+SI+RK A   R+ A+ YA+R
Sbjct: 161 LSARELEVLELVAAGHTNREIAARLDISNQTVKNHISSILRKLAVNDRTQAVVYAMR 217


>gi|163854702|ref|YP_001629000.1| LuxR family transcriptional regulator [Bordetella petrii DSM 12804]
 gi|163258430|emb|CAP40729.1| transcriptional regulator, LuxR-family [Bordetella petrii]
          Length = 71

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 28/61 (45%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE ECL W + GKTS EIAVILG+S  TVN +I +   K     R  A+A A+   +
Sbjct: 6   LSNREHECLHWSAMGKTSWEIAVILGVSERTVNFHIGNACSKLGVYNRRAAVAIALSQGL 65

Query: 246 V 246
           +
Sbjct: 66  L 66


>gi|167564011|ref|ZP_02356927.1| transcriptional regulator, LuxR family protein [Burkholderia
           oklahomensis EO147]
 gi|167571156|ref|ZP_02364030.1| transcriptional regulator, LuxR family protein [Burkholderia
           oklahomensis C6786]
          Length = 238

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+ECL WI+ GK+S EIA+ILGIS N V  ++  +M K   ++R  A+  A+ + +
Sbjct: 178 LTHRELECLKWIAAGKSSWEIAMILGISENGVLYHVKKLMAKFDVQSRHLAVLKAMASGV 237

Query: 246 V 246
           V
Sbjct: 238 V 238


>gi|159184428|ref|NP_353732.2| LuxR family transcriptional regulator [Agrobacterium tumefaciens
           str. C58]
 gi|159139741|gb|AAK86517.2| transcriptional regulator, LuxR family [Agrobacterium tumefaciens
           str. C58]
          Length = 201

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE++CL W + GKTS EIA I+ +S +T+N+Y+    +K  T  R+ A+A A+R  +
Sbjct: 140 LSEREIDCLNWTAAGKTSAEIAEIMMLSEHTINHYLNRATKKLDTVNRTQAVAKALRVGL 199

Query: 246 V 246
           +
Sbjct: 200 I 200


>gi|218515977|ref|ZP_03512817.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli 8C-3]
          Length = 173

 Score = 55.1 bits (131), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (61%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           K    T  E++CL   + G+ S EIA +L +S N VNN+I S+++K    TR+ A+  A+
Sbjct: 107 KPIAFTSSELDCLRLTAGGRKSSEIAKLLDLSENAVNNHIGSVIKKLGCTTRTQAVVSAL 166

Query: 242 RNNIV 246
           R NI+
Sbjct: 167 RLNII 171


>gi|251799733|ref|YP_003014464.1| LuxR family transcriptional regulator [Paenibacillus sp. JDR-2]
 gi|247547359|gb|ACT04378.1| two component transcriptional regulator, LuxR family [Paenibacillus
           sp. JDR-2]
          Length = 242

 Score = 55.1 bits (131), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 68/137 (49%), Gaps = 6/137 (4%)

Query: 112 VFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPK--GRIILRDR----LWEIGLL 165
           VF TL +  T     D    SL   +  +  G   + PK  G++I + R    L E+G++
Sbjct: 100 VFETLRKGATGYLLKDMEAESLINAIRSVVNGHAYIHPKVTGKLINQLRRMTYLDEMGVI 159

Query: 166 AAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIM 225
           +   A M        G+D  LT RE E L  ++EGK++  I   L IS  TV N+++SI+
Sbjct: 160 SGAAAGMEPGVKFVAGEDNPLTRREAEVLRLMAEGKSNKMIGEYLFISEKTVKNHVSSIL 219

Query: 226 RKTATKTRSGAIAYAVR 242
           +K     R+ A+  +++
Sbjct: 220 QKMEVDDRTQAVIQSIK 236


>gi|144900185|emb|CAM77049.1| regulatory protein, LuxR:Autoinducer-binding [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 242

 Score = 55.1 bits (131), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W + GK+S +I VIL IS NTVN ++ + M K    TR  AI  A+R  +
Sbjct: 180 LTARERECLIWSARGKSSWDIGVILNISDNTVNFHLKNAMGKLKASTRVLAIVKAIRMGL 239

Query: 246 V 246
           +
Sbjct: 240 I 240


>gi|190890862|ref|YP_001977404.1| transcriptional regulator protein, LuxR family [Rhizobium etli CIAT
           652]
 gi|190696141|gb|ACE90226.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CIAT 652]
          Length = 240

 Score = 55.1 bits (131), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (61%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           K    T  E++CL   + G+ S EIA +L +S N VNN+I S+++K    TR+ A+  A+
Sbjct: 174 KPIAFTSSELDCLRLTAGGRKSSEIAKLLDLSENAVNNHIGSVIKKLGCTTRTQAVVSAL 233

Query: 242 RNNIV 246
           R NI+
Sbjct: 234 RLNII 238


>gi|218663535|ref|ZP_03519465.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli IE4771]
          Length = 240

 Score = 55.1 bits (131), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (61%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           K    T  E++CL   + G+ S EIA +L +S N VNN+I S+++K    TR+ A+  A+
Sbjct: 174 KPIAFTSSELDCLRLTAGGRKSSEIAKLLHLSENAVNNHIGSVIKKLGCTTRTQAVVSAL 233

Query: 242 RNNIV 246
           R NI+
Sbjct: 234 RLNII 238


>gi|196231768|ref|ZP_03130625.1| two component transcriptional regulator, LuxR family
           [Chthoniobacter flavus Ellin428]
 gi|196224240|gb|EDY18753.1| two component transcriptional regulator, LuxR family
           [Chthoniobacter flavus Ellin428]
          Length = 216

 Score = 55.1 bits (131), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E + +I+EG+T+ E+A +LG+S  T  ++ A++M+K   KT    I YA+RN I
Sbjct: 154 LTSREREAVKFIAEGRTNKELADVLGVSLRTAESHRAAVMQKLGLKTIGELIRYALRNGI 213

Query: 246 V 246
           +
Sbjct: 214 I 214


>gi|170719977|ref|YP_001747665.1| LuxR family transcriptional regulator [Pseudomonas putida W619]
 gi|169757980|gb|ACA71296.1| transcriptional regulator, LuxR family [Pseudomonas putida W619]
          Length = 236

 Score = 55.1 bits (131), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 43/63 (68%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
            +++ RE+E L W + GKT+ ++A IL +S++TVN +I S++ KT    ++GA+A A+  
Sbjct: 172 LKMSDRELEVLKWSAAGKTAADVACILSLSQSTVNFHIRSVITKTNASNKAGAVAIAMMR 231

Query: 244 NIV 246
            ++
Sbjct: 232 GLI 234


>gi|222149400|ref|YP_002550357.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
 gi|221736383|gb|ACM37346.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
          Length = 241

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 76/171 (44%), Gaps = 40/171 (23%)

Query: 109 FCPVFHTLPENITP---------PAGMDNRYCSLTFDVA---RIRIGLMLLFPKGRIILR 156
           FCPV      +I P         P  M   +     D+    ++ +G++ +FP     L 
Sbjct: 77  FCPVVKKFAGSILPRTWDMKFREPNDMAEEWPPAMRDLMMRFKLIVGVVFIFPS----LD 132

Query: 157 DRLW-----------------EIGLLAAYQANMFKSYDVHWGKDFE----LTGREVECLT 195
            RL+                 E+G+LA     +F +YD     +      L+ RE+E L 
Sbjct: 133 SRLYFMRFDGDRSPLSQCEVNELGMLAM---AVFDTYDRLRRTELMNVDVLSVRELEVLR 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W ++GKTS EI  IL +S +T+N Y+ + M+K     R+  +A A+R  ++
Sbjct: 190 WTAQGKTSVEIGQILSLSDHTINAYMTTAMKKLDCVNRTQLVAKAIRLKLI 240


>gi|296134303|ref|YP_003641550.1| two component transcriptional regulator, LuxR family [Thermincola
           sp. JR]
 gi|296032881|gb|ADG83649.1| two component transcriptional regulator, LuxR family [Thermincola
           potens JR]
          Length = 214

 Score = 55.1 bits (131), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E +  I+EGK + EIA  L IS  TV N+I+SI RK     R+ A  YA++ N
Sbjct: 154 ELTAREREIIRLIAEGKNNREIAAELFISEKTVKNHISSIFRKIKVHDRTQAALYAIKTN 213

Query: 245 I 245
           +
Sbjct: 214 L 214


>gi|170736657|ref|YP_001777917.1| LuxR family transcriptional regulator [Burkholderia cenocepacia
           MC0-3]
 gi|169818845|gb|ACA93427.1| transcriptional regulator, LuxR family [Burkholderia cenocepacia
           MC0-3]
          Length = 321

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 40/63 (63%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
            EL+ R+ ECL W++ GK+S  IA I+GIS +TV+ +IA  M+     +R+ A  +AV  
Sbjct: 257 LELSPRQQECLAWVARGKSSWAIAAIVGISPHTVDYHIAEAMKILGINSRTAAAVHAVTT 316

Query: 244 NIV 246
            ++
Sbjct: 317 GLI 319


>gi|325292093|ref|YP_004277957.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
 gi|325059946|gb|ADY63637.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
          Length = 246

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L  RE++CL W + GKTS EIA I+ +S +T+N+Y+    +K  T  R+ A+A A+R  +
Sbjct: 185 LNEREIDCLNWTAAGKTSAEIAEIMMLSEHTINHYLNRATKKLDTVNRTQAVAKALRVGL 244

Query: 246 V 246
           +
Sbjct: 245 I 245


>gi|206562110|ref|YP_002232873.1| N-acylhomoserine lactone dependent regulatory protein [Burkholderia
           cenocepacia J2315]
 gi|198038150|emb|CAR54100.1| N-acylhomoserine lactone dependent regulatory protein [Burkholderia
           cenocepacia J2315]
          Length = 262

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 40/63 (63%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
            EL+ R+ ECL W++ GK+S  IA I+GIS +TV+ +IA  M+     +R+ A  +AV  
Sbjct: 198 LELSPRQQECLAWVARGKSSWAIASIVGISPHTVDYHIAEAMKILGINSRTAAAVHAVTT 257

Query: 244 NIV 246
            ++
Sbjct: 258 GLI 260


>gi|227822236|ref|YP_002826207.1| transcriptional regulator NgrR, LuxR family [Sinorhizobium fredii
           NGR234]
 gi|227341236|gb|ACP25454.1| transcriptional regulator NgrR, LuxR family [Sinorhizobium fredii
           NGR234]
          Length = 244

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +D  LT RE E LTW + GK+  EIA ILGIS  TV  ++++  RK    + + A+A AV
Sbjct: 177 RDTRLTSRETEVLTWSAAGKSYWEIATILGISERTVRFFMSNARRKLNVVSNTQAVAQAV 236

Query: 242 RNNIV 246
           R+ ++
Sbjct: 237 RHALI 241


>gi|16519915|ref|NP_444035.1| LuxR-type transcription regulator BxrH [Sinorhizobium fredii
           NGR234]
 gi|2495427|sp|P55629|Y4QH_RHISN RecName: Full=Putative HTH-type transcriptional regulator y4qH
 gi|2182594|gb|AAB92463.1| LuxR-type transcription regulator BxrH [Sinorhizobium fredii
           NGR234]
          Length = 326

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE EC+ W++ GK+S +I VI+ IS NTVN +I ++MRK  T +R+ A   A+   I
Sbjct: 264 LSLREKECVLWVARGKSSWDIGVIMRISENTVNFHIKNVMRKLGTSSRTVAAIKAISLGI 323

Query: 246 V 246
           +
Sbjct: 324 I 324


>gi|291287188|ref|YP_003504004.1| transcriptional regulator, LuxR family [Denitrovibrio acetiphilus
           DSM 12809]
 gi|290884348|gb|ADD68048.1| transcriptional regulator, LuxR family [Denitrovibrio acetiphilus
           DSM 12809]
          Length = 245

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 84/191 (43%), Gaps = 5/191 (2%)

Query: 59  SHFLLVRWDLFQEQKLDSIVS-SDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLP 117
           +H ++   + F ++  D +V   D+  D V    L+ K+    V   P  +   +F    
Sbjct: 56  THKIIYSDNAFMQRTDDYVVPMEDYAADKVFPQILAGKE-VIKVTNSPVYVHDVIFQHAG 114

Query: 118 ENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIG--LLAAYQANMFKS 175
              + P   ++RY     +    +I  +++F         +  +I   L A    N  + 
Sbjct: 115 NAGSKPCENEDRYILAKMN-HETQIASLIVFVVNAKESEGKFEQIACYLHAHLLTNYVRI 173

Query: 176 YDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSG 235
             V      +L+GRE   LTW+  GKTS E+A IL I+ NTVN +I +I  K     R  
Sbjct: 174 LSVSNENIIKLSGREKSVLTWLKYGKTSWEVAKILNITENTVNFHIKNIKNKLNATNRQH 233

Query: 236 AIAYAVRNNIV 246
           A+A A+  +I+
Sbjct: 234 AVAIAIAKSII 244


>gi|261856181|ref|YP_003263464.1| LuxR family transcriptional regulator [Halothiobacillus
           neapolitanus c2]
 gi|261836650|gb|ACX96417.1| two component transcriptional regulator, LuxR family
           [Halothiobacillus neapolitanus c2]
          Length = 292

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 52/92 (56%), Gaps = 2/92 (2%)

Query: 147 LFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEI 206
           L+ +G  +L  R+ E GLL+  Q +  ++      + F+LT RE E L W++ GKT+ EI
Sbjct: 195 LWHQGERLLFTRI-EPGLLS-IQRHAAQAEPEALARIFQLTAREAESLYWVALGKTNKEI 252

Query: 207 AVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
             IL IS  TVN ++  +  K   +TR+ A A
Sbjct: 253 GEILQISPRTVNKHLEHVFEKLGVETRTAAAA 284


>gi|124265864|ref|YP_001019868.1| two component LuxR family transcriptional regulator [Methylibium
           petroleiphilum PM1]
 gi|124258639|gb|ABM93633.1| two component transcriptional regulator, LuxR family [Methylibium
           petroleiphilum PM1]
          Length = 333

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (63%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           F LTGRE E L W+++GKT+ +I  ILG S  TV+ ++  +  K   +TR+ A A A+
Sbjct: 268 FRLTGREAEVLHWVAQGKTNRDIGDILGTSPRTVHKHLEHVFAKLGVETRTSAAAMAL 325


>gi|297622936|ref|YP_003704370.1| LuxR family transcriptional regulator [Truepera radiovictrix DSM
           17093]
 gi|297164116|gb|ADI13827.1| transcriptional regulator, LuxR family [Truepera radiovictrix DSM
           17093]
          Length = 478

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 42/62 (67%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE + L  I+EG+ ++EIA+ LG+S+NTV NY+A++  K   + R+ A+ +A    
Sbjct: 401 DLTARERQVLELIAEGQKNEEIALALGLSKNTVRNYVANLYAKIGVQGRAEAVIWARERG 460

Query: 245 IV 246
           ++
Sbjct: 461 VI 462


>gi|303248220|ref|ZP_07334483.1| transcriptional regulator, LuxR family [Desulfovibrio
           fructosovorans JJ]
 gi|302490358|gb|EFL50269.1| transcriptional regulator, LuxR family [Desulfovibrio
           fructosovorans JJ]
          Length = 258

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE E L W+ EGK+S +IA++LGI   TV  ++A++MRK     R+  +A A+R  +
Sbjct: 195 LSRREREVLDWLKEGKSSWDIAMVLGIRERTVRFHVANLMRKLGAVNRAQTVALALRRGL 254

Query: 246 V 246
           +
Sbjct: 255 I 255


>gi|332799645|ref|YP_004461144.1| LuxR family two component transcriptional regulator
           [Tepidanaerobacter sp. Re1]
 gi|332697380|gb|AEE91837.1| two component transcriptional regulator, LuxR family
           [Tepidanaerobacter sp. Re1]
          Length = 215

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  I++G ++ EI++ LGIS  TV N+++SI+RK     R+ A  +A++N +
Sbjct: 155 LTAREKEVLADIAKGMSNREISIDLGISEKTVKNHVSSILRKLNLMDRTQAAVFAIKNRL 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|327480105|gb|AEA83415.1| DNA-binding response regulator, LuxR family [Pseudomonas stutzeri
           DSM 4166]
          Length = 222

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 37/61 (60%)

Query: 174 KSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           K       + F+LTGREVE L W+S GKT+ +I  ILG+S  TVN ++  +  K   +TR
Sbjct: 150 KQIQAMLSQRFQLTGREVEVLHWVSCGKTNRDIGDILGLSPRTVNKHLEHVYVKLGVETR 209

Query: 234 S 234
           +
Sbjct: 210 T 210


>gi|218463347|ref|ZP_03503438.1| transcriptional regulator, LuxR family protein [Rhizobium etli Kim
           5]
          Length = 240

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 41/65 (63%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           K  E T  E++CL   + G+  +EIA +L ++ N VNN+I S+++K    TR+ A+  A+
Sbjct: 174 KPIEFTRSELDCLRLTAGGRKGNEIAKLLDLTENAVNNHIGSVIKKLGCTTRTQAVVSAL 233

Query: 242 RNNIV 246
           R NI+
Sbjct: 234 RLNII 238


>gi|325271203|ref|ZP_08137751.1| LuxR family transcriptional regulator [Pseudomonas sp. TJI-51]
 gi|324103661|gb|EGC00960.1| LuxR family transcriptional regulator [Pseudomonas sp. TJI-51]
          Length = 235

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 40/57 (70%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +++ RE+E L W + GKT+ ++A IL +S++TVN +I S++ KT    ++GAIA A 
Sbjct: 174 KMSARELEVLKWSAAGKTAADVACILSLSQSTVNFHIRSVITKTNAANKAGAIAIAA 230


>gi|258510526|ref|YP_003183960.1| two component transcriptional regulator, LuxR family
           [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
 gi|257477252|gb|ACV57571.1| two component transcriptional regulator, LuxR family
           [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
          Length = 231

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L ++S G ++ EIA  L IS NTV N++  I+ K     R+ A AYAVRN 
Sbjct: 161 ELTEREREVLQYLSAGASNKEIARALFISENTVRNHVRHILDKLHLSNRAQAAAYAVRNG 220

Query: 245 I 245
           I
Sbjct: 221 I 221


>gi|317050861|ref|YP_004111977.1| regulatory protein LuxR [Desulfurispirillum indicum S5]
 gi|316945945|gb|ADU65421.1| regulatory protein LuxR [Desulfurispirillum indicum S5]
          Length = 243

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 41/64 (64%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  L+ RE E L W +EGK+++EI++IL ISR+TV  ++  I +K     R  AIA A+R
Sbjct: 179 DTNLSERERELLFWTAEGKSTEEISMILAISRDTVKYHLKRIYQKLDAVNRHHAIAKALR 238

Query: 243 NNIV 246
             ++
Sbjct: 239 AGLI 242


>gi|254473001|ref|ZP_05086399.1| transcriptional regulator, LuxR family [Pseudovibrio sp. JE062]
 gi|211957722|gb|EEA92924.1| transcriptional regulator, LuxR family [Pseudovibrio sp. JE062]
          Length = 239

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 57/106 (53%), Gaps = 5/106 (4%)

Query: 145 MLLFPKGRIILRDR----LWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEG 200
           ML+F    + L +R    L  +G+ A+ +       + +  +   LT RE+ECL W + G
Sbjct: 134 MLIFGGPEVRLNEREISVLHLVGIYASNKVRELVGANTNRPR-HRLTPRELECLKWSAAG 192

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           KTS EI+ IL IS++T + Y+AS  RK     R+ A+A   R  ++
Sbjct: 193 KTSWEISQILNISQHTADWYLASAARKLHAANRTHAVAEGFRLGLI 238


>gi|262196287|ref|YP_003267496.1| LuxR family transcriptional regulator [Haliangium ochraceum DSM
           14365]
 gi|262079634|gb|ACY15603.1| transcriptional regulator, LuxR family [Haliangium ochraceum DSM
           14365]
          Length = 254

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 41/63 (65%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           ++L+ RE ECL W++ GKTS EI  ILGI+  T   ++ + M+K     RS A+A A+++
Sbjct: 190 YKLSERERECLRWVAAGKTSWEIGHILGIAERTAIFHLNNAMKKLGAVNRSHAVARALQH 249

Query: 244 NIV 246
            ++
Sbjct: 250 GVI 252


>gi|298244586|ref|ZP_06968392.1| transcriptional regulator, LuxR family [Ktedonobacter racemifer DSM
           44963]
 gi|297552067|gb|EFH85932.1| transcriptional regulator, LuxR family [Ktedonobacter racemifer DSM
           44963]
          Length = 523

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 52/85 (61%), Gaps = 1/85 (1%)

Query: 163 GLLAAYQA-NMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYI 221
            L+A+ QA ++ K   +   +  +LT RE+E +  +++G+ + +IA  L IS+ TV +++
Sbjct: 439 ALVASLQAGDVGKKAVLKRSQATDLTQREIEVVRLLTQGQNTPQIARTLSISKKTVEHHL 498

Query: 222 ASIMRKTATKTRSGAIAYAVRNNIV 246
           A I  K     R+ A+AYAV+ N+V
Sbjct: 499 AHIYTKFGVSCRTAAVAYAVQQNLV 523


>gi|297538769|ref|YP_003674538.1| LuxR family transcriptional regulator [Methylotenera sp. 301]
 gi|297258116|gb|ADI29961.1| transcriptional regulator, LuxR family [Methylotenera sp. 301]
          Length = 281

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 58/105 (55%), Gaps = 8/105 (7%)

Query: 134 TFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVEC 193
           TF+V    +GL++  P    +LR ++  I  + A +A       V   K + L+ RE+E 
Sbjct: 180 TFNVQDSLMGLLM--PHIDNVLR-KIQHIEPVDASEAE-----SVSVIKSYNLSVRELEI 231

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           + W+ +GKT  EIA+IL IS+NTV +++  +  K     R+ A+A
Sbjct: 232 IDWVKQGKTDSEIAMILFISQNTVKSHLKHVFEKLNVSRRAQAVA 276


>gi|78222725|ref|YP_384472.1| LuxR family transcriptional regulator [Geobacter metallireducens
           GS-15]
 gi|78193980|gb|ABB31747.1| transcriptional regulator, LuxR family [Geobacter metallireducens
           GS-15]
          Length = 246

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E ++W++ GK   EI+VILGIS  TV  + ++I++K     RS A+A A+   +
Sbjct: 183 LTPREIEVISWLANGKNYWEISVILGISERTVKFHTSTIVQKLGAANRSHAVAIAISTGL 242

Query: 246 V 246
           +
Sbjct: 243 I 243


>gi|282863833|ref|ZP_06272891.1| two component transcriptional regulator, LuxR family [Streptomyces
           sp. ACTE]
 gi|282561534|gb|EFB67078.1| two component transcriptional regulator, LuxR family [Streptomyces
           sp. ACTE]
          Length = 219

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 47/83 (56%), Gaps = 2/83 (2%)

Query: 164 LLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           L+  Y A +  + D    +D  LT RE+E L  I++G +++EIA  L ISR TV  +++ 
Sbjct: 138 LVGRYAARIRPTGD--AARDIPLTPRELEVLRLIADGLSNNEIAAALVISRETVKTFVSR 195

Query: 224 IMRKTATKTRSGAIAYAVRNNIV 246
           I+ K   + R  A+ YA R  +V
Sbjct: 196 ILTKLGLRDRVQAVIYAYRQGLV 218


>gi|296114148|ref|ZP_06832803.1| LuxR family transcriptional regulator [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295979224|gb|EFG85947.1| LuxR family transcriptional regulator [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 237

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 38/60 (63%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +D  L+ RE ECL W+++GK + EI+ IL IS NTV  ++ +IM+K     R  A+  A+
Sbjct: 171 EDCSLSDRERECLLWVAQGKNTLEISSILNISDNTVKYHLKNIMQKLGAHNRIQAVVQAI 230


>gi|119116629|dbj|BAF40892.1| LuxR [Shewanella hanedai]
          Length = 243

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (66%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +LT RE ECL WISEGKT+ EI+ IL  S  TV+ +I ++  K  T  RS +I+ ++
Sbjct: 177 QLTPREKECLAWISEGKTTWEISKILDCSERTVSFHITNLQTKLGTNNRSQSISKSI 233


>gi|89093728|ref|ZP_01166675.1| two-component transcriptional regulator, LuxR family protein
           [Oceanospirillum sp. MED92]
 gi|89082124|gb|EAR61349.1| two-component transcriptional regulator, LuxR family protein
           [Oceanospirillum sp. MED92]
          Length = 303

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
            E+T RE E L WI+ GKT+ EIA ILG+S  TVN ++  +  K   + R+ A   A+R
Sbjct: 239 LEITERESEVLHWIANGKTNREIAEILGMSPRTVNKHLEQLFPKLGVENRTAAAGVALR 297


>gi|304407706|ref|ZP_07389357.1| two component transcriptional regulator, LuxR family [Paenibacillus
           curdlanolyticus YK9]
 gi|304343189|gb|EFM09032.1| two component transcriptional regulator, LuxR family [Paenibacillus
           curdlanolyticus YK9]
          Length = 242

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 67/137 (48%), Gaps = 6/137 (4%)

Query: 112 VFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPK--GRIILRDR----LWEIGLL 165
           VF TL +  T     D    +L   +  +  G   + PK  G++I + R    L E+G +
Sbjct: 100 VFETLRKGATGYLLKDMEAEALINAIRSVMTGHSYIHPKVTGKLINQLRRMTYLDEMGAV 159

Query: 166 AAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIM 225
           +   A          G+D  LT RE E L  ++EGK++  I   L IS  TV N+++SI+
Sbjct: 160 SGAAAGKETGVKFVAGEDNPLTRREAEVLRLMAEGKSNKTIGEFLFISEKTVKNHVSSIL 219

Query: 226 RKTATKTRSGAIAYAVR 242
           +K     R+ A+ ++++
Sbjct: 220 QKMEVDDRTQAVIHSIK 236


>gi|221633642|ref|YP_002522868.1| transcriptional regulatory protein degU [Thermomicrobium roseum DSM
           5159]
 gi|221156159|gb|ACM05286.1| transcriptional regulatory protein degU [Thermomicrobium roseum DSM
           5159]
          Length = 245

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           LT RE+E L  ++ G ++ EIA  L IS  TV N+I SI+RK A   R+ A+ YA+R+ 
Sbjct: 162 LTPREIEILDCVARGYSNKEIAQALNISDQTVKNHITSILRKLAVNDRTQAVIYALRHG 220


>gi|238895474|ref|YP_002920209.1| DNA-binding transcriptional activator SdiA [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262043448|ref|ZP_06016571.1| regulatory protein SdiA [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330001006|ref|ZP_08303866.1| regulatory protein SdiA [Klebsiella sp. MS 92-3]
 gi|238547791|dbj|BAH64142.1| LuxR/UhpA-family transcriptional activator for cell division
           [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|259039190|gb|EEW40338.1| regulatory protein SdiA [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328537810|gb|EGF64005.1| regulatory protein SdiA [Klebsiella sp. MS 92-3]
          Length = 240

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + + + RE+E L W +EGKTS E+A+IL IS NTVN +  ++ RK     ++    YAV 
Sbjct: 177 EMKFSRRELEILKWTAEGKTSAEVAMILSISENTVNFHQKNMQRKFNAPNKTQIACYAVA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|206576935|ref|YP_002237709.1| regulatory protein SdiA [Klebsiella pneumoniae 342]
 gi|290508769|ref|ZP_06548140.1| DNA-binding transcriptional activator SdiA [Klebsiella sp. 1_1_55]
 gi|206565993|gb|ACI07769.1| regulatory protein SdiA [Klebsiella pneumoniae 342]
 gi|289778163|gb|EFD86160.1| DNA-binding transcriptional activator SdiA [Klebsiella sp. 1_1_55]
          Length = 240

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + + + RE+E L W +EGKTS E+A+IL IS NTVN +  ++ RK     ++    YAV 
Sbjct: 177 EMKFSRRELEILKWTAEGKTSAEVAMILSISENTVNFHQKNMQRKFNAPNKTQIACYAVA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|120556773|ref|YP_961124.1| response regulator receiver protein [Marinobacter aquaeolei VT8]
 gi|120326622|gb|ABM20937.1| two component transcriptional regulator, LuxR family [Marinobacter
           aquaeolei VT8]
          Length = 301

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (62%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           F+LT RE + L WI+ GKT+ EI  IL +S  TVN ++  + RK   + R+ A A A+R
Sbjct: 238 FDLTLRESDVLLWIANGKTNREIGQILEMSPRTVNKHLEQVFRKMNVENRTAAAANAIR 296


>gi|152970958|ref|YP_001336067.1| DNA-binding transcriptional activator SdiA [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|150955807|gb|ABR77837.1| transcriptional activator for cell division (LuxR/UhpA family)
           [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
          Length = 228

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + + + RE+E L W +EGKTS E+A+IL IS NTVN +  ++ RK     ++    YAV 
Sbjct: 165 EMKFSRRELEILKWTAEGKTSAEVAMILSISENTVNFHQKNMQRKFNAPNKTQIACYAVA 224

Query: 243 NNIV 246
             ++
Sbjct: 225 TGLI 228


>gi|288934569|ref|YP_003438628.1| LuxR family transcriptional regulator [Klebsiella variicola At-22]
 gi|288889278|gb|ADC57596.1| transcriptional regulator, LuxR family [Klebsiella variicola At-22]
          Length = 240

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + + + RE+E L W +EGKTS E+A+IL IS NTVN +  ++ RK     ++    YAV 
Sbjct: 177 EMKFSRRELEILKWTAEGKTSAEVAMILSISENTVNFHQKNMQRKFNAPNKTQIACYAVA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|222066056|emb|CAX21483.1| ppoR luxR family protein [Pseudomonas putida]
          Length = 235

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 41/57 (71%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +++ RE+E L W + GKT+ ++A IL +S++TVN +I S++ KT+   ++GA+A A 
Sbjct: 174 KMSKRELEVLKWSAAGKTAADVACILSLSQSTVNFHIRSVITKTSAANKAGAVAIAA 230


>gi|171912646|ref|ZP_02928116.1| methyl-accepting chemotaxis sensory transducer [Verrucomicrobium
           spinosum DSM 4136]
          Length = 331

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (58%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           D  LT RE E L W+ EGK++ EI VILGIS +TV  ++  ++ K   + R  A  Y 
Sbjct: 265 DETLTAREKEVLEWMQEGKSNPEIGVILGISTHTVKRHVERVLAKLGVENRVAAALYG 322


>gi|152994993|ref|YP_001339828.1| response regulator receiver protein [Marinomonas sp. MWYL1]
 gi|150835917|gb|ABR69893.1| response regulator receiver protein [Marinomonas sp. MWYL1]
          Length = 304

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (60%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           K+ +LT RE E L WI+ GKT+ EIA IL +S  TVN ++  I  K   + R+ A   A+
Sbjct: 238 KELDLTDRESEVLHWIANGKTNREIAEILEMSPRTVNKHLEQIFPKLGVENRTSAAGVAL 297

Query: 242 R 242
           R
Sbjct: 298 R 298


>gi|330810585|ref|YP_004355047.1| Response regulator, NarL family [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327378693|gb|AEA70043.1| putative Response regulator, NarL family [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 230

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (65%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           F+LTGREVE L W++ GKT+ +I  IL +S  TVN ++  +  K   +TR+ A + A+
Sbjct: 161 FQLTGREVEVLRWVACGKTNRDIGTILDLSPRTVNKHLEHVYVKLGVETRTAATSVAL 218


>gi|163761139|ref|ZP_02168216.1| probable transcriptional regulator protein, LuxR family [Hoeflea
           phototrophica DFL-43]
 gi|162281690|gb|EDQ31984.1| probable transcriptional regulator protein, LuxR family [Hoeflea
           phototrophica DFL-43]
          Length = 246

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 34/57 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L  RE E L W +EGKTS EIA I G+S +TVN+Y     +K     R+ A+  A+R
Sbjct: 185 LNARETEVLQWTAEGKTSAEIARITGLSEHTVNHYATIATQKLGCSNRTQAVVQAIR 241


>gi|240142577|ref|YP_002967090.1| hypothetical protein MexAM1_META2p0955 [Methylobacterium extorquens
           AM1]
 gi|240012524|gb|ACS43749.1| Hypothetical protein MexAM1_META2p0955 [Methylobacterium extorquens
           AM1]
          Length = 296

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+GRE + L W + GKT+ E A+ILG+S  TVN+++    +K     ++ A+A A+   +
Sbjct: 234 LSGRERDVLAWAAHGKTAGETALILGLSMETVNHHLGKAQKKLMAANKTHAVAIAINRGV 293

Query: 246 V 246
           +
Sbjct: 294 I 294


>gi|149184172|ref|ZP_01862490.1| transcriptional regulator, LuxR family protein [Erythrobacter sp.
           SD-21]
 gi|148831492|gb|EDL49925.1| transcriptional regulator, LuxR family protein [Erythrobacter sp.
           SD-21]
          Length = 217

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE E L WI+ GKT+ EIA ILGI   TV  YI  +  K   K RS A   A+R  I
Sbjct: 155 LSNRETEILHWIALGKTNSEIATILGIGGPTVATYIKRVFDKLDVKDRSSAAVKAIRWGI 214

Query: 246 V 246
           +
Sbjct: 215 I 215


>gi|222055510|ref|YP_002537872.1| transcriptional regulator, LuxR family [Geobacter sp. FRC-32]
 gi|221564799|gb|ACM20771.1| transcriptional regulator, LuxR family [Geobacter sp. FRC-32]
          Length = 248

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 43/64 (67%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +FEL+ RE+E L W+ +GK+S +I+VIL IS  TV  ++ +IM K    +R+ A+A A+ 
Sbjct: 182 NFELSKREIEVLNWVKKGKSSWDISVILAISVRTVKFHVENIMVKLNAVSRTHAVAIALS 241

Query: 243 NNIV 246
             ++
Sbjct: 242 AGVI 245


>gi|295134891|ref|YP_003585567.1| Response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Zunongwangia profunda SM-A87]
 gi|294982906|gb|ADF53371.1| Response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Zunongwangia profunda SM-A87]
          Length = 207

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 1/87 (1%)

Query: 158 RLWEIGLLAAYQANMFKSYDVH-WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNT 216
           R   IG  A Y+ +     ++  W  DF+LT RE+E L  I +GK++ EI+ IL  S+ T
Sbjct: 118 RKVRIGETAFYEEHTKAVSNIKIWTSDFKLTNRELEILQLIKDGKSTKEISEILHRSQFT 177

Query: 217 VNNYIASIMRKTATKTRSGAIAYAVRN 243
           +  +  +++RK   K  SG + +A++N
Sbjct: 178 IETHRKNMIRKLNLKNSSGLLHFAMKN 204


>gi|118589407|ref|ZP_01546813.1| putative two-component response regulator protein [Stappia
           aggregata IAM 12614]
 gi|118438107|gb|EAV44742.1| putative two-component response regulator protein [Stappia
           aggregata IAM 12614]
          Length = 304

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 6/94 (6%)

Query: 147 LFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEI 206
           L P GR+   + L+ +   A  +A   ++        FELT RE E L WI++GK++ +I
Sbjct: 210 LHPLGRVGPDENLFRV--TAEDEAGQVQALQ----GSFELTQREAEVLIWIAKGKSNKDI 263

Query: 207 AVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
             ILG+S  TVN ++  I  K   + R+ A   A
Sbjct: 264 GEILGLSPRTVNKHLEQIFVKLGVENRASAAVRA 297


>gi|170700574|ref|ZP_02891575.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           IOP40-10]
 gi|170134522|gb|EDT02849.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           IOP40-10]
          Length = 240

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 37/55 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           L+ R+ ECL W+ +GKTS EI +I+GIS +TV+ +++  M+     +R+ A  +A
Sbjct: 178 LSPRQQECLYWVGQGKTSPEIGMIMGISHHTVDYHLSEAMKILNVNSRTKAAVFA 232


>gi|303241719|ref|ZP_07328216.1| two component transcriptional regulator, LuxR family [Acetivibrio
           cellulolyticus CD2]
 gi|302590720|gb|EFL60471.1| two component transcriptional regulator, LuxR family [Acetivibrio
           cellulolyticus CD2]
          Length = 216

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 46/87 (52%), Gaps = 10/87 (11%)

Query: 169 QANMFKS----------YDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVN 218
           QANM +           +D    ++  LT REVE L  I+EG  + EIA  L IS  TV 
Sbjct: 128 QANMTRELVREFNKITLHDKSKSEESNLTAREVEVLELIAEGMINKEIAKRLYISEKTVK 187

Query: 219 NYIASIMRKTATKTRSGAIAYAVRNNI 245
           N++++I RK     R+ A  YA ++N+
Sbjct: 188 NHVSNIFRKLNVSDRTQAAIYAFKHNM 214


>gi|114565755|ref|YP_752909.1| response regulator receiver protein [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114336690|gb|ABI67538.1| response regulator receiver protein [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 213

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 40/64 (62%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +  LT RE + LT + +G T+ E+A ++ IS  TV N++ SI RK   K R+ A  YA++
Sbjct: 147 EIRLTKREKDVLTLLVKGNTNKEMAEVMFISEKTVKNHLTSIFRKLGVKDRTHAAIYALK 206

Query: 243 NNIV 246
           N IV
Sbjct: 207 NRIV 210


>gi|148549711|ref|YP_001269813.1| autoinducer-binding domain-containing protein [Pseudomonas putida
           F1]
 gi|148513769|gb|ABQ80629.1| transcriptional regulator, LuxR family [Pseudomonas putida F1]
          Length = 235

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 40/57 (70%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +++ RE+E L W + GKT+ ++A IL +S++TVN +I S++ KT    ++GAIA A 
Sbjct: 174 KMSERELEVLKWSAAGKTAADVASILSLSQSTVNFHIRSVITKTNAANKAGAIAIAA 230


>gi|146343657|ref|YP_001208705.1| CheY/LuxR family two-component transcriptional regulator
           [Bradyrhizobium sp. ORS278]
 gi|146196463|emb|CAL80490.1| Two-component transcriptional regulator, CheY-LuxR families
           (two-component signal transduction system)
           [Bradyrhizobium sp. ORS278]
          Length = 305

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 39/62 (62%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
            +  +F LT RE E L+W+S+GKT+ +IA ILG+S  TV+ ++  I  K   + R+ A A
Sbjct: 236 EFSSEFGLTTREGEVLSWLSKGKTNRDIAQILGLSPRTVDKHLEQIYAKLGVENRTAAAA 295

Query: 239 YA 240
            A
Sbjct: 296 IA 297


>gi|116694039|ref|YP_728250.1| response regulator [Ralstonia eutropha H16]
 gi|113528538|emb|CAJ94885.1| response regulator, NarL-family [Ralstonia eutropha H16]
          Length = 297

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 37/58 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           LT RE E + W++ GKT+ +IA ILG+S  TVN ++  I  K   +TR+ A+A   RN
Sbjct: 236 LTLREAEVMAWVARGKTNRDIADILGMSPRTVNKHLEHIYEKLGVETRTAAVAATRRN 293


>gi|163847185|ref|YP_001635229.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222525026|ref|YP_002569497.1| LuxR family two component transcriptional regulator [Chloroflexus
           sp. Y-400-fl]
 gi|163668474|gb|ABY34840.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222448905|gb|ACM53171.1| two component transcriptional regulator, LuxR family [Chloroflexus
           sp. Y-400-fl]
          Length = 246

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 39/57 (68%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE+E L  I+ G ++ EIA  LGIS  TV N+I+SI+RK +   R+ A+ +A+R
Sbjct: 172 LSEREIEVLERIAAGNSNKEIADALGISTQTVKNHISSILRKLSLNDRTQAVIFALR 228


>gi|313500551|gb|ADR61917.1| LuxR family transcriptional regulator [Pseudomonas putida BIRD-1]
          Length = 235

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 40/57 (70%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +++ RE+E L W + GKT+ ++A IL +S++TVN +I S++ KT    ++GAIA A 
Sbjct: 174 KMSERELEVLKWSAAGKTAADVASILSLSQSTVNFHIRSVITKTNAANKAGAIAIAA 230


>gi|311279135|ref|YP_003941366.1| transcriptional regulator, LuxR family [Enterobacter cloacae SCF1]
 gi|308748330|gb|ADO48082.1| transcriptional regulator, LuxR family [Enterobacter cloacae SCF1]
          Length = 240

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 39/64 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + + + RE+E L W +EGKTS EI++IL IS NTVN +  ++ +K     ++    YAV 
Sbjct: 177 EMKFSKRELEILKWTAEGKTSAEISIILSISENTVNFHQKNMQKKFNAPNKTQIACYAVA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|28871223|ref|NP_793842.1| DNA-binding response regulator, LuxR family [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|28854473|gb|AAO57537.1| DNA-binding response regulator, LuxR family [Pseudomonas syringae
           pv. tomato str. DC3000]
          Length = 222

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (61%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H    F+LT REV+ L W++ GKT+ +IA IL +S  TVN ++  I  K   +TR+ A +
Sbjct: 154 HLSSSFQLTEREVDVLRWVACGKTNKDIADILQLSPRTVNKHLEHIYVKLGVETRTAATS 213

Query: 239 YAV 241
            A+
Sbjct: 214 VAL 216


>gi|91776279|ref|YP_546035.1| LuxR family transcriptional regulator [Methylobacillus flagellatus
           KT]
 gi|91710266|gb|ABE50194.1| transcriptional regulator, LuxR family [Methylobacillus flagellatus
           KT]
          Length = 257

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           L+GRE+E + W+++GKT+ EI +IL IS  TV N++  I +K     R+ A+A
Sbjct: 201 LSGRELEIMDWVTKGKTNQEIGMILDISAFTVKNHLQRIFKKLNVMNRAQAVA 253


>gi|300693708|ref|YP_003749681.1| transcriptional activator of quorum sensing autoinducer synthesis
           transcription regulator protein (luxr family) [Ralstonia
           solanacearum PSI07]
 gi|299075745|emb|CBJ35050.1| transcriptional activator of quorum sensing autoinducer synthesis
           transcription regulator protein (LuxR family) [Ralstonia
           solanacearum PSI07]
          Length = 238

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 41/65 (63%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           D+    D  LTGREVE + W ++GK++ +IA IL IS+NTV+ ++ + ++K     ++ A
Sbjct: 168 DLAGDSDDSLTGREVEVMKWTADGKSAQDIADILAISKNTVDFHVKNAVKKLQAVNKTAA 227

Query: 237 IAYAV 241
           +  A 
Sbjct: 228 VVRAA 232


>gi|288960054|ref|YP_003450394.1| two-component response regulator [Azospirillum sp. B510]
 gi|288912362|dbj|BAI73850.1| two-component response regulator [Azospirillum sp. B510]
          Length = 310

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (58%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           LT RE E L WI+ GK + +I  ILGIS  TVN ++  +  K   + R+ A A A+R 
Sbjct: 248 LTAREAEVLLWIANGKPNRDIGEILGISPRTVNKHLEQVFAKLGVENRASAAALAIRT 305


>gi|167035632|ref|YP_001670863.1| LuxR family transcriptional regulator [Pseudomonas putida GB-1]
 gi|166862120|gb|ABZ00528.1| transcriptional regulator, LuxR family [Pseudomonas putida GB-1]
          Length = 235

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 39/56 (69%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           ++ RE+E L W + GKT+ ++A IL +S++TVN +I S++ KT    ++GAIA A 
Sbjct: 175 MSERELEVLKWSAAGKTAADVACILSLSQSTVNFHIRSVITKTNAANKAGAIAIAA 230


>gi|326202012|ref|ZP_08191882.1| two component transcriptional regulator, LuxR family [Clostridium
           papyrosolvens DSM 2782]
 gi|325987807|gb|EGD48633.1| two component transcriptional regulator, LuxR family [Clostridium
           papyrosolvens DSM 2782]
          Length = 216

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 37/60 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REVE L  I+EG  + EIA  L IS  TV N+I++I +K     R+ A  YA ++NI
Sbjct: 155 LTNREVEVLKLIAEGMINKEIAKTLYISEKTVKNHISNIFKKLDVNDRTQAAIYAFKHNI 214


>gi|26991331|ref|NP_746756.1| LuxR family transcriptional regulator [Pseudomonas putida KT2440]
 gi|24986392|gb|AAN70220.1|AE016661_6 transcriptional regulator, LuxR family [Pseudomonas putida KT2440]
          Length = 279

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 40/57 (70%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +++ RE+E L W + GKT+ ++A IL +S++TVN +I S++ KT    ++GAIA A 
Sbjct: 218 KMSERELEVLKWSAAGKTAADVASILSLSQSTVNFHIRSVITKTNAANKAGAIAIAA 274


>gi|325294100|ref|YP_004279964.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
 gi|325061953|gb|ADY65644.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
          Length = 258

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (61%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
            ELT RE+E LT +++G TS EI   L IS +TV+ YI  I R+ + K R   +A A RN
Sbjct: 195 LELTRREMEVLTLMADGMTSTEIGRQLSISNHTVDWYINGIQRRFSAKNRQHTVALAFRN 254

Query: 244 NIV 246
            ++
Sbjct: 255 GLL 257


>gi|219849240|ref|YP_002463673.1| LuxR family two component transcriptional regulator [Chloroflexus
           aggregans DSM 9485]
 gi|219543499|gb|ACL25237.1| two component transcriptional regulator, LuxR family [Chloroflexus
           aggregans DSM 9485]
          Length = 247

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 39/57 (68%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE+E L  I+ G ++ EIA  LGIS  TV N+I+SI+RK +   R+ A+ +A+R
Sbjct: 174 LSEREIEVLERIAAGSSNKEIADALGISTQTVKNHISSILRKLSLNDRTQAVIFALR 230


>gi|38230162|gb|AAR14178.1| AHL receptor-like protein [Aeromonas veronii]
          Length = 75

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/42 (59%), Positives = 30/42 (71%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRK 227
           LT RE ECL W SEGKTS EIA ILGI+  TVN ++  + R+
Sbjct: 33  LTERETECLFWASEGKTSGEIACILGITERTVNYHLNPVTRR 74


>gi|205352355|ref|YP_002226156.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|205272136|emb|CAR36989.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|326627405|gb|EGE33748.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
          Length = 240

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 57/118 (48%), Gaps = 18/118 (15%)

Query: 129 RYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTG 188
           R  S T+D   +R+ L         + R+ L     L  ++ +M  + ++ + K      
Sbjct: 141 RCSSFTYDEVELRLQL---------LARESL---SALTRFEDDMVMAPEMRFSK------ 182

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 183 REKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|148252241|ref|YP_001236826.1| two component LuxR family transcriptional regulator [Bradyrhizobium
           sp. BTAi1]
 gi|146404414|gb|ABQ32920.1| two component transcriptional regulator, LuxR family
           [Bradyrhizobium sp. BTAi1]
          Length = 305

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 39/62 (62%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
            +  +F LT RE E L+W+S+GKT+ +IA ILG+S  TV+ ++  I  K   + R+ A A
Sbjct: 236 EFSSEFGLTVRESEVLSWLSKGKTNRDIAQILGLSPRTVDKHLEQIYAKLGVENRTAAAA 295

Query: 239 YA 240
            A
Sbjct: 296 IA 297


>gi|296137313|ref|YP_003644555.1| two component transcriptional regulator, LuxR family [Thiomonas
           intermedia K12]
 gi|294341618|emb|CAZ90035.1| putative two-component system response regulator; CheY domain
           [Thiomonas sp. 3As]
 gi|295797435|gb|ADG32225.1| two component transcriptional regulator, LuxR family [Thiomonas
           intermedia K12]
          Length = 223

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (56%)

Query: 175 SYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRS 234
           S ++   +   LT RE E L  + +G T  EIAV LG+SR+TV +Y+  I RK    +R+
Sbjct: 151 SSNLPQEEHIALTERESEVLQLVGKGYTLPEIAVQLGLSRHTVADYVKQIYRKLNISSRA 210

Query: 235 GAIAYAVRNNIV 246
            A   AVR  +V
Sbjct: 211 EAALEAVRRGLV 222


>gi|168239186|ref|ZP_02664244.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194735895|ref|YP_002114983.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|198243442|ref|YP_002215136.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|194711397|gb|ACF90618.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197288026|gb|EDY27413.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197937958|gb|ACH75291.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|322616943|gb|EFY13851.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322618183|gb|EFY15075.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322625853|gb|EFY22672.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322626305|gb|EFY23115.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322632720|gb|EFY29465.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322639062|gb|EFY35755.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322640503|gb|EFY37156.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322645988|gb|EFY42505.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322649891|gb|EFY46312.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322655499|gb|EFY51807.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322660277|gb|EFY56515.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322662958|gb|EFY59165.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322668143|gb|EFY64302.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674097|gb|EFY70191.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322675550|gb|EFY71624.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322683038|gb|EFY79054.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322686732|gb|EFY82710.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|323195379|gb|EFZ80559.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323199270|gb|EFZ84365.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323204435|gb|EFZ89441.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323207525|gb|EFZ92473.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323211850|gb|EFZ96681.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323217510|gb|EGA02229.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323219586|gb|EGA04070.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323223588|gb|EGA07903.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323231532|gb|EGA15645.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323235975|gb|EGA20054.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323240545|gb|EGA24588.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323245437|gb|EGA29437.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323250207|gb|EGA34099.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323253982|gb|EGA37806.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323255491|gb|EGA39252.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323262088|gb|EGA45651.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323266211|gb|EGA49701.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323270680|gb|EGA54121.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
 gi|326622885|gb|EGE29230.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 240

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           D+    +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++  
Sbjct: 171 DMVMAPEMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQI 230

Query: 237 IAYAVRNNIV 246
             YA    ++
Sbjct: 231 ACYAAATGLI 240


>gi|225182003|ref|ZP_03735435.1| two component transcriptional regulator, LuxR family [Dethiobacter
           alkaliphilus AHT 1]
 gi|225167288|gb|EEG76107.1| two component transcriptional regulator, LuxR family [Dethiobacter
           alkaliphilus AHT 1]
          Length = 217

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 38/64 (59%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  L+ RE + LT I+ GK++ EI   L IS  TV N+I +I RK     R+ A  YAV+
Sbjct: 152 DEPLSRRETDVLTLIARGKSNKEIGDELYISEKTVKNHITNIFRKIQVTDRTQAALYAVK 211

Query: 243 NNIV 246
           N IV
Sbjct: 212 NRIV 215


>gi|194468906|ref|ZP_03074890.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194455270|gb|EDX44109.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
          Length = 240

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           D+    +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++  
Sbjct: 171 DMVMAPEMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQI 230

Query: 237 IAYAVRNNIV 246
             YA    ++
Sbjct: 231 ACYAAATGLI 240


>gi|161613489|ref|YP_001587454.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|168244797|ref|ZP_02669729.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168462512|ref|ZP_02696443.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168822990|ref|ZP_02834990.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194445102|ref|YP_002041215.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194448751|ref|YP_002046001.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|197250905|ref|YP_002146073.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|204931037|ref|ZP_03221863.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|207856536|ref|YP_002243187.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|238912477|ref|ZP_04656314.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
 gi|161362853|gb|ABX66621.1| hypothetical protein SPAB_01206 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403765|gb|ACF63987.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194407055|gb|ACF67274.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|195634505|gb|EDX52857.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197214608|gb|ACH52005.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|204320081|gb|EDZ05286.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205336361|gb|EDZ23125.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205340659|gb|EDZ27423.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|206708339|emb|CAR32642.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|320085432|emb|CBY95213.1| Regulatory protein sdiA [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 240

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           D+    +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++  
Sbjct: 171 DMVMAPEMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQI 230

Query: 237 IAYAVRNNIV 246
             YA    ++
Sbjct: 231 ACYAAATGLI 240


>gi|62180524|ref|YP_216941.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|224583549|ref|YP_002637347.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|62128157|gb|AAX65860.1| transcriptional regulator of ftsQAZ gene cluster (LuxR/UhpA family)
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|224468076|gb|ACN45906.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|322715000|gb|EFZ06571.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
          Length = 240

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           D+    +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++  
Sbjct: 171 DMVMAPEMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQI 230

Query: 237 IAYAVRNNIV 246
             YA    ++
Sbjct: 231 ACYAAATGLI 240


>gi|104783716|ref|YP_610214.1| LuxR family transcriptional regulator [Pseudomonas entomophila L48]
 gi|95112703|emb|CAK17431.1| putative transcriptional regulator, LuxR family [Pseudomonas
           entomophila L48]
          Length = 234

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 38/55 (69%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           L+ RE+E L W + GKT+ ++A IL +S +TVN +I S++ KT    ++GAIA A
Sbjct: 174 LSERELEVLKWSAGGKTAADVATILSLSTSTVNFHIRSVINKTNAANKAGAIAVA 228


>gi|16760896|ref|NP_456513.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|29141412|ref|NP_804754.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|213053513|ref|ZP_03346391.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
 gi|213426356|ref|ZP_03359106.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213616131|ref|ZP_03371957.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-2068]
 gi|213650336|ref|ZP_03380389.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|289824072|ref|ZP_06543670.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
 gi|25302436|pir||AH0749 cell-division regulatory protein STY2158 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16503193|emb|CAD05699.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29137039|gb|AAO68603.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 240

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           D+    +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++  
Sbjct: 171 DMVMAPEMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQI 230

Query: 237 IAYAVRNNIV 246
             YA    ++
Sbjct: 231 ACYAAATGLI 240


>gi|168259766|ref|ZP_02681739.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|200391066|ref|ZP_03217677.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199603511|gb|EDZ02057.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205351245|gb|EDZ37876.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 240

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           D+    +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++  
Sbjct: 171 DMVMAPEMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQI 230

Query: 237 IAYAVRNNIV 246
             YA    ++
Sbjct: 231 ACYAAATGLI 240


>gi|16765288|ref|NP_460903.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|167993519|ref|ZP_02574613.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|2992525|gb|AAC08299.1| SdiA [Salmonella enterica subsp. enterica serovar Typhimurium]
 gi|16420484|gb|AAL20862.1| transcriptional regulator of ftsQAZ gene cluster [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|205328435|gb|EDZ15199.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|261247116|emb|CBG24939.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267993936|gb|ACY88821.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301158464|emb|CBW17974.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312912940|dbj|BAJ36914.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|321224593|gb|EFX49656.1| N-3-oxohexanoyl-L-homoserine lactone quorum-sensing transcriptional
           activator [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|323130228|gb|ADX17658.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|332988839|gb|AEF07822.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 240

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           D+    +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++  
Sbjct: 171 DMVMAPEMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQI 230

Query: 237 IAYAVRNNIV 246
             YA    ++
Sbjct: 231 ACYAAATGLI 240


>gi|237731962|ref|ZP_04562443.1| DNA-binding transcriptional activator SdiA [Citrobacter sp. 30_2]
 gi|226907501|gb|EEH93419.1| DNA-binding transcriptional activator SdiA [Citrobacter sp. 30_2]
          Length = 240

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           D+    +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++  
Sbjct: 171 DMVMAPEMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQI 230

Query: 237 IAYAVRNNIV 246
             YA    ++
Sbjct: 231 ACYAAATGLI 240


>gi|167552822|ref|ZP_02346573.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205322659|gb|EDZ10498.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 240

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           D+    +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++  
Sbjct: 171 DMVMAPEMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQI 230

Query: 237 IAYAVRNNIV 246
             YA    ++
Sbjct: 231 ACYAAATGLI 240


>gi|56413135|ref|YP_150210.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197362061|ref|YP_002141698.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|56127392|gb|AAV76898.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197093538|emb|CAR59000.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 240

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           D+    +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++  
Sbjct: 171 DMVMAPEMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQI 230

Query: 237 IAYAVRNNIV 246
             YA    ++
Sbjct: 231 ACYAAATGLI 240


>gi|66047443|ref|YP_237284.1| regulatory protein, LuxR [Pseudomonas syringae pv. syringae B728a]
 gi|63258150|gb|AAY39246.1| regulatory protein, LuxR [Pseudomonas syringae pv. syringae B728a]
          Length = 254

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 156 RDRLWEIGLLA-AYQANMFKSYD--VHWGKDFELTGREVECLTWISEGKTSDEIAVILGI 212
           R  L E GLLA A+Q   +  +D  +       LT RE ECL+W +EG T+ EIA  L  
Sbjct: 159 RQSLAEFGLLAHAFQEVAYPLFDQKIRSCNAIRLTPRERECLSWSAEGLTAREIADQLNR 218

Query: 213 SRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           S  TV  ++ S M+K   K R  A+  AV 
Sbjct: 219 SVATVTLHLNSAMQKLGAKNRVQAVVRAVH 248


>gi|330969598|gb|EGH69664.1| regulatory protein, LuxR [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 254

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 156 RDRLWEIGLLA-AYQANMFKSYD--VHWGKDFELTGREVECLTWISEGKTSDEIAVILGI 212
           R  L E GLLA A+Q   +  +D  +       LT RE ECL+W +EG T+ EIA  L  
Sbjct: 159 RQSLAEFGLLAHAFQEVAYPLFDQKIRSCNAIRLTPRERECLSWSAEGLTAREIADQLNR 218

Query: 213 SRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           S  TV  ++ S M+K   K R  A+  AV 
Sbjct: 219 SVATVTLHLNSAMQKLGAKNRVQAVVRAVH 248


>gi|298245147|ref|ZP_06968953.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
 gi|297552628|gb|EFH86493.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
          Length = 230

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           L+ REVE L +I+ G ++ EIA  L IS  TV N+I SI++K +   R+ A+ +A+R+
Sbjct: 164 LSSREVEILDYIARGNSNKEIAKSLKISDQTVKNHITSILKKLSVSDRTAAVVHALRH 221


>gi|222066054|emb|CAX21482.1| ppoR luxR family protein [Pseudomonas putida]
          Length = 235

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 40/57 (70%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +++ RE+E L W + GKT+ ++A IL +S++TVN +I S++ KT    ++GAIA A 
Sbjct: 174 KMSERELEVLRWSAAGKTAADVASILSLSQSTVNFHIRSVITKTNASNKAGAIAIAA 230


>gi|229590001|ref|YP_002872120.1| putative LuxR family regulatory protein [Pseudomonas fluorescens
           SBW25]
 gi|229361867|emb|CAY48766.1| putative LuxR-family regulatory protein [Pseudomonas fluorescens
           SBW25]
          Length = 221

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (65%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           F+LT REVE L W++ GKT+ +I  ILG+S  TVN ++  +  K   +TR+ A + A+
Sbjct: 161 FQLTEREVEVLRWVACGKTNRDIGDILGLSPRTVNKHLEHVYVKLGVETRTAATSVAL 218


>gi|269925915|ref|YP_003322538.1| two component transcriptional regulator, LuxR family [Thermobaculum
           terrenum ATCC BAA-798]
 gi|269789575|gb|ACZ41716.1| two component transcriptional regulator, LuxR family [Thermobaculum
           terrenum ATCC BAA-798]
          Length = 226

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 53/98 (54%), Gaps = 7/98 (7%)

Query: 150 KGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-----LTGREVECLTWISEGKTSD 204
           KG  I+ + L     +A+     F+  D+   +D E     LT REVE L  I+ G ++ 
Sbjct: 121 KGEYIINENLITKPFVASRVLKQFR--DLAALEDEENLFTPLTSREVEILDCIARGMSNK 178

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           EIA  + IS  TV N+I SI+RK A   R+ A+ YA++
Sbjct: 179 EIARQMSISDQTVKNHITSILRKLAVNDRTQAVIYALK 216


>gi|254562561|ref|YP_003069656.1| response regulator [Methylobacterium extorquens DM4]
 gi|254269839|emb|CAX25817.1| putative response regulator; input and output domains: CheY and
           LuxR family [Methylobacterium extorquens DM4]
          Length = 302

 Score = 52.8 bits (125), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 35/60 (58%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             +TGRE E L W+S GK+S +I  ILG+S  TV  ++  I  K   + R+ A A A R+
Sbjct: 238 LPITGREAEVLLWLSRGKSSRDIGEILGLSPRTVTKHLEGIYAKLGVENRTAASAVAARH 297


>gi|330952863|gb|EGH53123.1| regulatory protein, LuxR [Pseudomonas syringae Cit 7]
          Length = 254

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 156 RDRLWEIGLLA-AYQANMFKSYD--VHWGKDFELTGREVECLTWISEGKTSDEIAVILGI 212
           R  L E GLLA A+Q   +  +D  +       LT RE ECL+W +EG T+ EIA  L  
Sbjct: 159 RQSLAEFGLLAHAFQEVAYPLFDQKIRSCNAIRLTPRERECLSWSAEGLTAREIADQLNR 218

Query: 213 SRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           S  TV  ++ S M+K   K R  A+  AV 
Sbjct: 219 SVATVTLHLNSAMQKLGAKNRVQAVVRAVH 248


>gi|260575467|ref|ZP_05843466.1| transcriptional regulator, LuxR family [Rhodobacter sp. SW2]
 gi|259022387|gb|EEW25684.1| transcriptional regulator, LuxR family [Rhodobacter sp. SW2]
          Length = 245

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT REV+CL+W++ G   D+IA  LGI   TV+ YI S   K   +TR  A+A A+
Sbjct: 183 LTPREVDCLSWLAAGLRPDQIAETLGIGYRTVDKYIVSARGKLRARTRDQAVAKAL 238


>gi|218548547|ref|YP_002382338.1| DNA-binding transcriptional activator SdiA [Escherichia fergusonii
           ATCC 35469]
 gi|218356088|emb|CAQ88705.1| DNA-binding transcriptional activator [Escherichia fergusonii ATCC
           35469]
          Length = 251

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
            + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    I
Sbjct: 191 FSKRETEILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKFNAPNKTQVACYAAATGI 250

Query: 246 V 246
           +
Sbjct: 251 I 251


>gi|188582813|ref|YP_001926258.1| LuxR family transcriptional regulator [Methylobacterium populi
           BJ001]
 gi|179346311|gb|ACB81723.1| two component transcriptional regulator, LuxR family
           [Methylobacterium populi BJ001]
          Length = 301

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 35/60 (58%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             +TGRE E L W+S GK+S +I  ILG+S  TV  ++  I  K   + R+ A A A R+
Sbjct: 237 LPITGREAEVLLWLSRGKSSRDIGEILGLSPRTVTKHLEGIYAKLGVENRTAASAVAARH 296


>gi|196228675|ref|ZP_03127541.1| two component transcriptional regulator, LuxR family
           [Chthoniobacter flavus Ellin428]
 gi|196226956|gb|EDY21460.1| two component transcriptional regulator, LuxR family
           [Chthoniobacter flavus Ellin428]
          Length = 217

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%)

Query: 174 KSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           K  D     D  LT RE E +  ++EG ++ E+A  LGIS  TV  + A+IM+K   K+ 
Sbjct: 143 KPKDEEQTVDGRLTDREREIVQLLAEGASNKEVADSLGISVKTVETHRAAIMKKLKFKSF 202

Query: 234 SGAIAYAVRNNIV 246
           S  + YA+RN+I+
Sbjct: 203 SDLVRYAIRNHII 215


>gi|325496964|gb|EGC94823.1| DNA-binding transcriptional activator SdiA [Escherichia fergusonii
           ECD227]
          Length = 240

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
            + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    I
Sbjct: 180 FSKRETEILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKFNAPNKTQVACYAAATGI 239

Query: 246 V 246
           +
Sbjct: 240 I 240


>gi|218531623|ref|YP_002422439.1| LuxR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218523926|gb|ACK84511.1| two component transcriptional regulator, LuxR family
           [Methylobacterium chloromethanicum CM4]
          Length = 300

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 35/60 (58%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             +TGRE E L W+S GK+S +I  ILG+S  TV  ++  I  K   + R+ A A A R+
Sbjct: 236 LPITGREAEVLLWLSRGKSSRDIGEILGLSPRTVTKHLEGIYAKLGVENRTAASAVAARH 295


>gi|254519325|ref|ZP_05131381.1| two-component system response regulator [Clostridium sp. 7_2_43FAA]
 gi|226913074|gb|EEH98275.1| two-component system response regulator [Clostridium sp. 7_2_43FAA]
          Length = 226

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 36/60 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+  L  IS+G  + EIA  L +S  TV NYI SI +K   + R  A  YA+RNNI
Sbjct: 158 LTNRELNILYEISKGLKNKEIAEKLFLSEKTVKNYITSIFKKIEVEDRVQATIYAIRNNI 217


>gi|163852797|ref|YP_001640840.1| response regulator receiver [Methylobacterium extorquens PA1]
 gi|163664402|gb|ABY31769.1| response regulator receiver [Methylobacterium extorquens PA1]
          Length = 300

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 35/60 (58%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             +TGRE E L W+S GK+S +I  ILG+S  TV  ++  I  K   + R+ A A A R+
Sbjct: 236 LPITGREAEVLLWLSRGKSSRDIGEILGLSPRTVTKHLEGIYAKLGVENRTAASAVAARH 295


>gi|324113634|gb|EGC07609.1| autoinducer binding domain-containing protein [Escherichia
           fergusonii B253]
          Length = 251

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
            + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    I
Sbjct: 191 FSKRETEILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKFNAPNKTQVACYAAATGI 250

Query: 246 V 246
           +
Sbjct: 251 I 251


>gi|240140122|ref|YP_002964599.1| putative response regulator; input and output domains: CheY and
           LuxR family [Methylobacterium extorquens AM1]
 gi|240010096|gb|ACS41322.1| putative response regulator; input and output domains: CheY and
           LuxR family [Methylobacterium extorquens AM1]
          Length = 300

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 35/60 (58%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             +TGRE E L W+S GK+S +I  ILG+S  TV  ++  I  K   + R+ A A A R+
Sbjct: 236 LPITGREAEVLLWLSRGKSSRDIGEILGLSPRTVTKHLEGIYAKLGVENRTAASAVAARH 295


>gi|229073471|ref|ZP_04206602.1| DNA-binding response regulator [Bacillus cereus F65185]
 gi|228709645|gb|EEL61688.1| DNA-binding response regulator [Bacillus cereus F65185]
          Length = 131

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN 
Sbjct: 67  ELTEREKEILFELVKGLSNKEIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQ 126

Query: 245 IV 246
           +V
Sbjct: 127 LV 128


>gi|220929282|ref|YP_002506191.1| LuxR family transcriptional regulator [Clostridium cellulolyticum
           H10]
 gi|219999610|gb|ACL76211.1| two component transcriptional regulator, LuxR family [Clostridium
           cellulolyticum H10]
          Length = 216

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 37/60 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REVE L  I+EG  + EIA  L IS  TV N+I++I +K     R+ A  YA ++NI
Sbjct: 155 LTNREVEVLKLIAEGMINKEIAKALYISEKTVKNHISNIFKKLDVNDRTQAAIYAFKHNI 214


>gi|170769400|ref|ZP_02903853.1| regulatory protein SdiA [Escherichia albertii TW07627]
 gi|170121724|gb|EDS90655.1| regulatory protein SdiA [Escherichia albertii TW07627]
          Length = 228

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 165 EMHFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 224

Query: 243 NNIV 246
             ++
Sbjct: 225 TGLI 228


>gi|197263477|ref|ZP_03163551.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197241732|gb|EDY24352.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
          Length = 240

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           D+    +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++  
Sbjct: 171 DMVMAPEMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNPPNKTQI 230

Query: 237 IAYAVRNNIV 246
             YA    ++
Sbjct: 231 ACYAAATGLI 240


>gi|320010128|gb|ADW04978.1| two component transcriptional regulator, LuxR family [Streptomyces
           flavogriseus ATCC 33331]
          Length = 219

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  LT RE+E L  I+EG ++ EIA  L ISR TV  +++ I+ K   + R  A+ YA R
Sbjct: 155 DIPLTPRELEVLRLIAEGLSNSEIAASLVISRETVKTFVSRILTKLGLRDRVQAVVYAYR 214

Query: 243 NNIV 246
             +V
Sbjct: 215 QGLV 218


>gi|218677689|ref|ZP_03525586.1| transcriptional regulator, LuxR family protein [Rhizobium etli CIAT
           894]
          Length = 240

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 39/65 (60%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           K  E T  E++CL   + G+   EIA +L ++ N VNN+I S ++K    TR+ A+  A+
Sbjct: 174 KPIEFTPGELDCLRLTAGGRKGSEIAKLLDLTENVVNNHIGSAIKKLGCTTRTQAVVSAL 233

Query: 242 RNNIV 246
           R NI+
Sbjct: 234 RLNII 238


>gi|160882054|ref|YP_001561022.1| two component LuxR family transcriptional regulator [Clostridium
           phytofermentans ISDg]
 gi|160430720|gb|ABX44283.1| two component transcriptional regulator, LuxR family [Clostridium
           phytofermentans ISDg]
          Length = 213

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE++ L  ++EG  + EIA  L IS  TV N++++I +K +   R+ A  YA++NN 
Sbjct: 150 LTRREIDVLKLLAEGLFNKEIAYRLSISEKTVKNHVSNIFKKISVSDRTQAAVYAIKNNF 209

Query: 246 V 246
           V
Sbjct: 210 V 210


>gi|213418834|ref|ZP_03351900.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. E01-6750]
          Length = 192

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           D+    +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++  
Sbjct: 123 DMVMAPEMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQI 182

Query: 237 IAYAVRNNIV 246
             YA    ++
Sbjct: 183 ACYAAATGLI 192


>gi|170751099|ref|YP_001757359.1| two component LuxR family transcriptional regulator
           [Methylobacterium radiotolerans JCM 2831]
 gi|170657621|gb|ACB26676.1| two component transcriptional regulator, LuxR family
           [Methylobacterium radiotolerans JCM 2831]
          Length = 196

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LTGRE E LTW S GKTS EIA+IL +   TVN +    M++     R+ A+A A+
Sbjct: 135 LTGREREVLTWASRGKTSAEIALILDLRERTVNFHFDQAMKRLNVVNRTHAVARAL 190


>gi|213966697|ref|ZP_03394848.1| transcriptional regulator, LuxR family, autoinducer-regulated
           [Pseudomonas syringae pv. tomato T1]
 gi|301383210|ref|ZP_07231628.1| transcriptional regulator, LuxR family, autoinducer-regulated
           [Pseudomonas syringae pv. tomato Max13]
 gi|302059053|ref|ZP_07250594.1| transcriptional regulator, LuxR family, autoinducer-regulated
           [Pseudomonas syringae pv. tomato K40]
 gi|302133729|ref|ZP_07259719.1| transcriptional regulator, LuxR family, autoinducer-regulated
           [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213928547|gb|EEB62091.1| transcriptional regulator, LuxR family, autoinducer-regulated
           [Pseudomonas syringae pv. tomato T1]
 gi|331018431|gb|EGH98487.1| transcriptional regulator, LuxR family, autoinducer-regulated
           [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 254

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 156 RDRLWEIGLLA-AYQANMFKSYD--VHWGKDFELTGREVECLTWISEGKTSDEIAVILGI 212
           R  L E GLLA A+Q   +  +D  +      +LT RE ECL+W +EG T+ EIA  L  
Sbjct: 159 RQSLAEFGLLAHAFQEVAYPLFDQKMRSCNAIKLTRRERECLSWSAEGLTAREIADQLNR 218

Query: 213 SRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           S  TV  ++ S M+K   K R  A+  AV 
Sbjct: 219 SVATVTLHLNSAMQKLGAKNRVQAVVRAVH 248


>gi|28871673|ref|NP_794292.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|28854925|gb|AAO57987.1| transcriptional regulator, LuxR family, autoinducer-regulated
           [Pseudomonas syringae pv. tomato str. DC3000]
          Length = 254

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 156 RDRLWEIGLLA-AYQANMFKSYD--VHWGKDFELTGREVECLTWISEGKTSDEIAVILGI 212
           R  L E GLLA A+Q   +  +D  +      +LT RE ECL+W +EG T+ EIA  L  
Sbjct: 159 RQSLAEFGLLAHAFQEVAYPLFDQKMRSCNAIKLTRRERECLSWSAEGLTAREIADQLNR 218

Query: 213 SRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           S  TV  ++ S M+K   K R  A+  AV 
Sbjct: 219 SVATVTLHLNSAMQKLGAKNRVQAVVRAVH 248


>gi|283832684|ref|ZP_06352425.1| regulatory protein SdiA [Citrobacter youngae ATCC 29220]
 gi|291072359|gb|EFE10468.1| regulatory protein SdiA [Citrobacter youngae ATCC 29220]
          Length = 240

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|197103145|ref|YP_002128523.1| transcriptional regulator, LuxR family [Phenylobacterium zucineum
           HLK1]
 gi|196480421|gb|ACG79948.1| transcriptional regulator, LuxR family [Phenylobacterium zucineum
           HLK1]
          Length = 252

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 35/56 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           +L+ R++ECL W  EGK+S  I  IL +S  TV+ ++AS  RK    TR  A+A A
Sbjct: 186 KLSARQIECLRWAREGKSSYVIGQILSLSARTVDEHLASACRKLGVHTRMQAVAQA 241


>gi|218459661|ref|ZP_03499752.1| LuxR family transcriptional regulator [Rhizobium etli Kim 5]
          Length = 65

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 25/61 (40%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           +T RE+E + W++ GKT+ EI  ILGIS  TVN +I++   K +    +  +A A+RN I
Sbjct: 4   VTPRELEIIGWMAAGKTAAEIGAILGISPITVNTHISNAKAKLSVFKETALVAAALRNGI 63

Query: 246 V 246
           +
Sbjct: 64  I 64


>gi|88797997|ref|ZP_01113584.1| two-component transcriptional regulator, LuxR family protein
           [Reinekea sp. MED297]
 gi|88779194|gb|EAR10382.1| two-component transcriptional regulator, LuxR family protein
           [Reinekea sp. MED297]
          Length = 303

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 35/60 (58%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + +LTGRE E L WI+ GKT+ E A IL +S  TVN ++  I  K     R+ A   A++
Sbjct: 235 ELDLTGRESEVLYWIANGKTNRETAEILAMSPRTVNKHLEQIFSKLGVDNRTSAAGVALK 294


>gi|298247701|ref|ZP_06971506.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
 gi|297550360|gb|EFH84226.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
          Length = 231

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 40/65 (61%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +  ELT RE E L  ++ G+ S EIAV LGIS  TV +++ASI  K    +R+ A+A A+
Sbjct: 159 EGMELTEREREILQGVARGERSKEIAVRLGISIRTVGSHLASIYTKLGVDSRASAVALAI 218

Query: 242 RNNIV 246
              ++
Sbjct: 219 ERGLL 223


>gi|148557255|ref|YP_001264837.1| regulatory protein LuxR [Sphingomonas wittichii RW1]
 gi|148502445|gb|ABQ70699.1| regulatory protein, LuxR [Sphingomonas wittichii RW1]
          Length = 301

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 38/57 (66%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
            L+ RE+ECLTW + GKT ++IAVIL +S +TV  Y+  + +K     RS A+A A+
Sbjct: 237 SLSKRELECLTWSARGKTVEDIAVILDLSADTVRVYLKRVNQKLDAVNRSHAVAKAM 293


>gi|289642814|ref|ZP_06474951.1| two component transcriptional regulator, LuxR family [Frankia
           symbiont of Datisca glomerata]
 gi|289507383|gb|EFD28345.1| two component transcriptional regulator, LuxR family [Frankia
           symbiont of Datisca glomerata]
          Length = 233

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++EG+ + EIA  L IS NTV N++ +I+ K    +R  A+ YAVR  +
Sbjct: 170 LTARELEVLKLVAEGRANREIARKLFISENTVKNHVRNILDKLQLHSRMEAVMYAVRQGL 229


>gi|116254365|ref|YP_770203.1| GerE family transcriptional regulator [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115259013|emb|CAK10122.1| LuxR-family regulator [Rhizobium leguminosarum bv. viciae 3841]
          Length = 251

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 78/171 (45%), Gaps = 20/171 (11%)

Query: 83  PFDLVRCMALSEKDKYYNVLQRPTELFCPVF-HTLPEN-ITPPAGMDNRYCSLTF----- 135
           PF     MA   KD Y+   +R  ++    F H L +  I P  G +    SL+      
Sbjct: 93  PFRWREAMAAFRKDAYH---RRMEQMMVDAFGHGLEDGYIFPIHGRNGILASLSLAGKPI 149

Query: 136 DVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLT 195
           +++ + I L+        + R   W +  L        ++ +     D  LT RE+E L 
Sbjct: 150 ELSPVEIALL------EAVARKAFWRLLDLKGEA----QALETVLPADTPLTRREMEILH 199

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +++EG TS EI+ +L IS +TV+ Y+  +  K   K R  A+A A R+ ++
Sbjct: 200 YLAEGMTSMEISKMLKISNHTVDWYMNGLQDKLKAKNRQQAVALAFRHGLI 250


>gi|258510158|ref|YP_003183592.1| GAF modulated transcriptional regulator, LuxR family
           [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
 gi|257476884|gb|ACV57203.1| GAF modulated transcriptional regulator, LuxR family
           [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
          Length = 506

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 78/169 (46%), Gaps = 12/169 (7%)

Query: 90  MALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCS--LTFDVA--RIRIGLM 145
           M + + D+    L +  ++  PVF     NI P + ++  + S  L   V   R  +G+M
Sbjct: 337 MRIRQTDRDIPSLTQFVQIAKPVFLKDVGNILPQSYVNKFHLSSLLVCPVIDNRRMLGIM 396

Query: 146 LLFPKGRIILRD----RLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGREVECLTWI 197
           LL   GR    D    R+ E  L  A +  + + Y             LT RE E L  I
Sbjct: 397 LLDHGGRPFTPDNATIRMVEAMLARAGRMIVMQMYRQAGAAPITPLTTLTKREREILQLI 456

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++G  + EI   L IS  TV  +++SI+RK   K R+ A+A A+R  I+
Sbjct: 457 ADGVDTKEIGRALHISDYTVTEHVSSILRKLGAKNRTEAVAKAMRERII 505


>gi|86356800|ref|YP_468692.1| transcriptional regulator protein [Rhizobium etli CFN 42]
 gi|86280902|gb|ABC89965.1| probable transcriptional regulator protein [Rhizobium etli CFN 42]
          Length = 240

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           K    T  E++CL   + G+ S EIA +L +S + VNN I S++RK    TR+ A+  A+
Sbjct: 174 KPVAFTQSELDCLRLTAGGRKSSEIAKLLDLSESAVNNQIGSVIRKLGCTTRTQAVVSAL 233

Query: 242 RNNIV 246
           R NI+
Sbjct: 234 RLNII 238


>gi|218291050|ref|ZP_03495082.1| GAF modulated transcriptional regulator, LuxR family
           [Alicyclobacillus acidocaldarius LAA1]
 gi|218239004|gb|EED06210.1| GAF modulated transcriptional regulator, LuxR family
           [Alicyclobacillus acidocaldarius LAA1]
          Length = 506

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 77/170 (45%), Gaps = 14/170 (8%)

Query: 90  MALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSL-----TFDVARIRIGL 144
           M + + D+    L +  ++  PVF     NI P   ++  + S        D  R+ +G+
Sbjct: 337 MRIRQTDRDIPSLTQFVQIAKPVFLKDVGNILPQPYVNKFHLSSLLVCPVIDQRRL-LGI 395

Query: 145 MLLFPKGRIILRD----RLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGREVECLTW 196
           MLL   GR    D    R+ E  L  A +  + + Y             LT RE E L  
Sbjct: 396 MLLDHGGRPFTPDNAAIRMVEAMLARAGRMIVMQMYRQAGAAPITPLTTLTKREREILQL 455

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           I++G  + EI   L IS  TV  +++SI+RK   K R+ A+A A+R  I+
Sbjct: 456 IADGVDTKEIGRALHISDYTVTEHVSSILRKLGAKNRTEAVAKAMRERII 505


>gi|254427282|ref|ZP_05040989.1| Sigma-70, region 4 family [Alcanivorax sp. DG881]
 gi|196193451|gb|EDX88410.1| Sigma-70, region 4 family [Alcanivorax sp. DG881]
          Length = 301

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 35/59 (59%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
             +T RE + L WI+ GKT+ EIA IL +S  TVN ++  I RK   + R+ A A  ++
Sbjct: 237 LHVTHREAQVLVWIAHGKTNREIAQILELSPRTVNKHLEQIFRKLGVENRTAAAAMVIQ 295


>gi|225181500|ref|ZP_03734942.1| two component transcriptional regulator, LuxR family [Dethiobacter
           alkaliphilus AHT 1]
 gi|225167748|gb|EEG76557.1| two component transcriptional regulator, LuxR family [Dethiobacter
           alkaliphilus AHT 1]
          Length = 212

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 41/63 (65%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           K+  LT +EV+ L  IS GK + EIA I+ IS  TV NY+++I++K     R+ A +Y +
Sbjct: 147 KEHNLTPKEVQILDMISVGKANKEIAEIMKISDKTVRNYVSNILQKLNVSNRTEAASYWM 206

Query: 242 RNN 244
           RN+
Sbjct: 207 RNS 209


>gi|320160834|ref|YP_004174058.1| putative NarL family two-component system response regulator
           [Anaerolinea thermophila UNI-1]
 gi|319994687|dbj|BAJ63458.1| putative NarL family two-component system response regulator
           [Anaerolinea thermophila UNI-1]
          Length = 222

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ +E   L  +SEGKT+ EIA  L +   TV NY++SI+ K     R+ A AYAV +N+
Sbjct: 159 LSQQEKHVLLLVSEGKTNREIAKALFLGEGTVRNYVSSILSKLGVSNRAEAAAYAVEHNL 218


>gi|71907077|ref|YP_284664.1| two component LuxR family transcriptional regulator [Dechloromonas
           aromatica RCB]
 gi|71846698|gb|AAZ46194.1| two component transcriptional regulator, LuxR family [Dechloromonas
           aromatica RCB]
          Length = 308

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           F LT RE E L W+ +GKTS++I  ILG S  TVN ++  +  K   +TR+ A   A+
Sbjct: 245 FRLTQREAEVLYWVVQGKTSNDIGDILGNSPRTVNKHLEHVFEKLGVETRTAAANLAM 302


>gi|229062451|ref|ZP_04199766.1| DNA-binding response regulator [Bacillus cereus AH603]
 gi|228716840|gb|EEL68528.1| DNA-binding response regulator [Bacillus cereus AH603]
          Length = 186

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  +++G ++ EIA  L IS  TV  +I  I RK   K+RS A+ YAVRN 
Sbjct: 122 ELTEREKEILFELAKGLSNKEIAEALYISDKTVKIHINKIFRKLNVKSRSQAVIYAVRNQ 181

Query: 245 IV 246
           +V
Sbjct: 182 LV 183


>gi|159898087|ref|YP_001544334.1| two component LuxR family transcriptional regulator [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|159891126|gb|ABX04206.1| two component transcriptional regulator, LuxR family [Herpetosiphon
           aurantiacus ATCC 23779]
          Length = 257

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 38/57 (66%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE+E L  I+ G T+ +IA  L IS  TV N+I+SI+RK +   R+ A+ YA+R
Sbjct: 167 LSDREIEVLEHIASGATNKDIADALKISTQTVKNHISSILRKLSLNDRTQAVLYALR 223


>gi|71736210|ref|YP_276356.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257482085|ref|ZP_05636126.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|71556763|gb|AAZ35974.1| transcriptional regulator, LuxR family, autoinducer-regulated
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|320322567|gb|EFW78660.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320330180|gb|EFW86166.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330875327|gb|EGH09476.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330987492|gb|EGH85595.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011444|gb|EGH91500.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 254

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 156 RDRLWEIGLLA-AYQANMFKSYD--VHWGKDFELTGREVECLTWISEGKTSDEIAVILGI 212
           R  L E GLLA A+Q   +  +D  +      +LT RE ECL+W +EG T+ EIA  L  
Sbjct: 159 RQSLAEFGLLAHAFQEVAYPLFDQKMRSCNAIKLTRRERECLSWSAEGLTAREIADQLNR 218

Query: 213 SRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           S  TV  ++ S M+K   K R  A+  AV 
Sbjct: 219 SVATVTLHLNSAMQKLGAKNRVQAVVRAVH 248


>gi|182413103|ref|YP_001818169.1| two component LuxR family transcriptional regulator [Opitutus
           terrae PB90-1]
 gi|177840317|gb|ACB74569.1| two component transcriptional regulator, LuxR family [Opitutus
           terrae PB90-1]
          Length = 209

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE++ L  I++GK + EIA +L IS  TV +++ +IM K     R+ A+  AV+  
Sbjct: 146 ELTSREIQVLQEIAKGKANKEIAAVLAISEYTVKDHLKNIMGKLHVAVRTEAVTAAVQRG 205

Query: 245 IV 246
           I+
Sbjct: 206 II 207


>gi|289625636|ref|ZP_06458590.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289646651|ref|ZP_06477994.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|298488410|ref|ZP_07006441.1| Transcriptional regulator ahyR/asaR family [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
 gi|298157035|gb|EFH98124.1| Transcriptional regulator ahyR/asaR family [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
 gi|330868197|gb|EGH02906.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 254

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 156 RDRLWEIGLLA-AYQANMFKSYD--VHWGKDFELTGREVECLTWISEGKTSDEIAVILGI 212
           R  L E GLLA A+Q   +  +D  +      +LT RE ECL+W +EG T+ EIA  L  
Sbjct: 159 RQSLAEFGLLAQAFQEVAYPLFDQKMRSCNAIKLTRRERECLSWSAEGLTAREIADQLNR 218

Query: 213 SRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           S  TV  ++ S M+K   K R  A+  AV 
Sbjct: 219 SVATVTLHLNSAMQKLGAKNRVQAVVRAVH 248


>gi|167590019|ref|ZP_02382407.1| transcriptional regulator, LuxR family protein [Burkholderia
           ubonensis Bu]
          Length = 233

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (65%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
            ELT REVE L W+++GKT+ EI++I+ IS  TVN ++ + + K  T   + A+A A 
Sbjct: 170 IELTAREVEVLKWVADGKTASEISMIMLISVYTVNFHVKNAVTKLKTSNTTAAVARAA 227


>gi|261340314|ref|ZP_05968172.1| regulatory protein SdiA [Enterobacter cancerogenus ATCC 35316]
 gi|288317405|gb|EFC56343.1| regulatory protein SdiA [Enterobacter cancerogenus ATCC 35316]
          Length = 240

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 37/64 (57%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + + + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMKFSKREREILKWTAEGKTSAEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|156345617|ref|XP_001621420.1| hypothetical protein NEMVEDRAFT_v1g144964 [Nematostella vectensis]
 gi|156207332|gb|EDO29320.1| predicted protein [Nematostella vectensis]
          Length = 213

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (65%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           F+LT REVE L W++ GKT+ +I  ILG+S  TVN ++  +  K   +TR+ A + A+
Sbjct: 149 FQLTEREVEVLRWVACGKTNRDIGDILGLSPRTVNKHLEHVYVKLGVETRTAATSVAL 206


>gi|330888704|gb|EGH21365.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           mori str. 301020]
          Length = 254

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 156 RDRLWEIGLLA-AYQANMFKSYD--VHWGKDFELTGREVECLTWISEGKTSDEIAVILGI 212
           R  L E GLLA A+Q   +  +D  +      +LT RE ECL+W +EG T+ EIA  L  
Sbjct: 159 RQSLAEFGLLAHAFQEVAYPLFDQKMRSCNAIKLTRRERECLSWSAEGLTAREIADHLNR 218

Query: 213 SRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           S  TV  ++ S M+K   K R  A+  AV 
Sbjct: 219 SVATVTLHLNSAMQKLGAKNRVQAVVRAVH 248


>gi|111221195|ref|YP_711989.1| putative two-component system response regulator [Frankia alni
           ACN14a]
 gi|111148727|emb|CAJ60403.1| Putative two-component system response regulator [Frankia alni
           ACN14a]
          Length = 213

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++EG+ + EIA  L IS NTV N++ +I+ K    +R  A+ YAVR  +
Sbjct: 150 LTARELEVLKLVAEGRANREIARKLFISENTVKNHVRNILDKLQLHSRMEAVMYAVRQGL 209


>gi|229079676|ref|ZP_04212209.1| DNA-binding response regulator [Bacillus cereus Rock4-2]
 gi|228703516|gb|EEL55969.1| DNA-binding response regulator [Bacillus cereus Rock4-2]
          Length = 213

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN 
Sbjct: 149 ELTEREKEILFELVKGLSNKEIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQ 208

Query: 245 IV 246
           +V
Sbjct: 209 LV 210


>gi|32472133|ref|NP_865127.1| nitrate/nitrite regulatory protein narP [Rhodopirellula baltica SH
           1]
 gi|32397505|emb|CAD72811.1| nitrate/nitrite regulatory protein narP [Rhodopirellula baltica SH
           1]
 gi|327539236|gb|EGF25859.1| two-component system response regulator [Rhodopirellula baltica
           WH47]
          Length = 210

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 38/64 (59%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  LT RE E L  ++ G T+ EIA +LGIS  TV  ++  I+RK     R+ A  +AVR
Sbjct: 147 DVPLTQRESEVLRQMALGLTNKEIAKMLGISYETVKEHVQHILRKLGVSDRTQAAVWAVR 206

Query: 243 NNIV 246
            N+V
Sbjct: 207 KNLV 210


>gi|74311738|ref|YP_310157.1| DNA-binding transcriptional activator SdiA [Shigella sonnei Ss046]
 gi|82543616|ref|YP_407563.1| DNA-binding transcriptional activator SdiA [Shigella boydii Sb227]
 gi|157156210|ref|YP_001463220.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           E24377A]
 gi|187730097|ref|YP_001879705.1| DNA-binding transcriptional activator SdiA [Shigella boydii CDC
           3083-94]
 gi|193071152|ref|ZP_03052076.1| regulatory protein SdiA [Escherichia coli E110019]
 gi|194439563|ref|ZP_03071636.1| regulatory protein SdiA [Escherichia coli 101-1]
 gi|300822312|ref|ZP_07102453.1| autoinducer binding domain protein [Escherichia coli MS 119-7]
 gi|300917358|ref|ZP_07134027.1| autoinducer binding domain protein [Escherichia coli MS 115-1]
 gi|73855215|gb|AAZ87922.1| transcriptional regulator of ftsQAZ gene cluster [Shigella sonnei
           Ss046]
 gi|81245027|gb|ABB65735.1| transcriptional regulator of ftsQAZ gene cluster [Shigella boydii
           Sb227]
 gi|157078240|gb|ABV17948.1| regulatory protein SdiA [Escherichia coli E24377A]
 gi|187427089|gb|ACD06363.1| regulatory protein SdiA [Shigella boydii CDC 3083-94]
 gi|192955547|gb|EDV86026.1| regulatory protein SdiA [Escherichia coli E110019]
 gi|194421472|gb|EDX37486.1| regulatory protein SdiA [Escherichia coli 101-1]
 gi|300415404|gb|EFJ98714.1| autoinducer binding domain protein [Escherichia coli MS 115-1]
 gi|300525195|gb|EFK46264.1| autoinducer binding domain protein [Escherichia coli MS 119-7]
 gi|309702211|emb|CBJ01527.1| regulatory protein [Escherichia coli ETEC H10407]
 gi|320176080|gb|EFW51148.1| DNA-binding transcriptional activator SdiA [Shigella dysenteriae
           CDC 74-1112]
 gi|323165288|gb|EFZ51076.1| regulatory protein sdiA [Shigella sonnei 53G]
 gi|323174570|gb|EFZ60191.1| regulatory protein sdiA [Escherichia coli LT-68]
 gi|323937191|gb|EGB33471.1| autoinducer binding domain-containing protein [Escherichia coli
           E1520]
 gi|323972721|gb|EGB67922.1| autoinducer binding domain-containing protein [Escherichia coli
           TA007]
 gi|332343642|gb|AEE56976.1| regulatory protein SdiA [Escherichia coli UMNK88]
          Length = 240

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|332278913|ref|ZP_08391326.1| regulatory protein sdiA [Shigella sp. D9]
 gi|332101265|gb|EGJ04611.1| regulatory protein sdiA [Shigella sp. D9]
          Length = 244

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 181 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 240

Query: 243 NNIV 246
             ++
Sbjct: 241 TGLI 244


>gi|301018234|ref|ZP_07182749.1| autoinducer binding domain protein [Escherichia coli MS 69-1]
 gi|300399821|gb|EFJ83359.1| autoinducer binding domain protein [Escherichia coli MS 69-1]
          Length = 240

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|312199008|ref|YP_004019069.1| LuxR family transcriptional regulator [Frankia sp. EuI1c]
 gi|311230344|gb|ADP83199.1| two component transcriptional regulator, LuxR family [Frankia sp.
           EuI1c]
          Length = 239

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++EG+ + EIA  L IS NTV N++ +I+ K    +R  A+ YAVR  +
Sbjct: 176 LTARELEVLKLVAEGRANREIARKLFISENTVKNHVRNILDKLQLHSRMEAVMYAVRQGL 235


>gi|229143361|ref|ZP_04271792.1| DNA-binding response regulator [Bacillus cereus BDRD-ST24]
 gi|228640168|gb|EEK96567.1| DNA-binding response regulator [Bacillus cereus BDRD-ST24]
          Length = 213

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN 
Sbjct: 149 ELTEREKEILFELVKGLSNKEIAKVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQ 208

Query: 245 IV 246
           +V
Sbjct: 209 LV 210


>gi|184156458|ref|YP_001844797.1| DNA-binding HTH domain-containing protein [Acinetobacter baumannii
           ACICU]
 gi|183208052|gb|ACC55450.1| DNA-binding HTH domain-containing protein [Acinetobacter baumannii
           ACICU]
          Length = 238

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 177 DVHWGK-DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSG 235
           DV + K +  LT RE E L W +EGKTS EIA ILG++  TVN ++++ M+K     +  
Sbjct: 168 DVEFAKFNLYLTNREKEALRWTAEGKTSAEIAQILGVTERTVNFHLSNSMQKLNVNNKIS 227

Query: 236 AIAYAV 241
           A   AV
Sbjct: 228 AAIRAV 233


>gi|330811856|ref|YP_004356318.1| response regulator, NarL family [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379964|gb|AEA71314.1| putative response regulator, NarL family [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 237

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            L+ RE+E L W +EGKT+ E+  IL +S  TVN ++ S MRK     +  A+A A + +
Sbjct: 176 HLSPREIEVLRWSAEGKTASEVGRILCLSERTVNFHVCSCMRKLNVSNKISAVAKAAQIH 235

Query: 245 IV 246
           ++
Sbjct: 236 VI 237


>gi|301052287|ref|YP_003790498.1| transcriptional regulator [Bacillus anthracis CI]
 gi|300374456|gb|ADK03360.1| transcriptional regulator [Bacillus cereus biovar anthracis str.
           CI]
          Length = 213

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN 
Sbjct: 149 ELTEREKEILFELVKGLSNKEIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQ 208

Query: 245 IV 246
           +V
Sbjct: 209 LV 210


>gi|218695523|ref|YP_002403190.1| DNA-binding transcriptional activator SdiA [Escherichia coli 55989]
 gi|300904802|ref|ZP_07122630.1| autoinducer binding domain protein [Escherichia coli MS 84-1]
 gi|218352255|emb|CAU98011.1| DNA-binding transcriptional activator [Escherichia coli 55989]
 gi|300403316|gb|EFJ86854.1| autoinducer binding domain protein [Escherichia coli MS 84-1]
 gi|315257253|gb|EFU37221.1| autoinducer binding domain protein [Escherichia coli MS 85-1]
          Length = 240

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|237705872|ref|ZP_04536353.1| regulatory protein sdiA [Escherichia sp. 3_2_53FAA]
 gi|26108586|gb|AAN80789.1|AE016762_42 Regulatory protein sdiA [Escherichia coli CFT073]
 gi|91072709|gb|ABE07590.1| regulatory protein SdiA [Escherichia coli UTI89]
 gi|226900629|gb|EEH86888.1| regulatory protein sdiA [Escherichia sp. 3_2_53FAA]
          Length = 244

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 181 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 240

Query: 243 NNIV 246
             ++
Sbjct: 241 TGLI 244


>gi|323961965|gb|EGB57564.1| autoinducer binding domain-containing protein [Escherichia coli
           H489]
          Length = 240

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|312967117|ref|ZP_07781335.1| regulatory protein sdiA [Escherichia coli 2362-75]
 gi|312288581|gb|EFR16483.1| regulatory protein sdiA [Escherichia coli 2362-75]
          Length = 228

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 165 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 224

Query: 243 NNIV 246
             ++
Sbjct: 225 TGLI 228


>gi|300935891|ref|ZP_07150848.1| autoinducer binding domain protein [Escherichia coli MS 21-1]
 gi|300458941|gb|EFK22434.1| autoinducer binding domain protein [Escherichia coli MS 21-1]
          Length = 240

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|253996413|ref|YP_003048477.1| MalT-like ATP-dependent transcriptional regulator [Methylotenera
           mobilis JLW8]
 gi|253983092|gb|ACT47950.1| ATP-dependent transcriptional regulator, MalT-like, LuxR family
           [Methylotenera mobilis JLW8]
          Length = 274

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           L+ RE+E ++WI  GKT+ EI +IL IS+NTV +++  I +K     R+ A+A
Sbjct: 198 LSEREIEVISWIKAGKTNQEIGMILSISQNTVKSHLKRIFQKLNIGRRAQAVA 250


>gi|209919338|ref|YP_002293422.1| DNA-binding transcriptional activator SdiA [Escherichia coli SE11]
 gi|293446298|ref|ZP_06662720.1| regulatory protein sdiA [Escherichia coli B088]
 gi|209912597|dbj|BAG77671.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli
           SE11]
 gi|291323128|gb|EFE62556.1| regulatory protein sdiA [Escherichia coli B088]
          Length = 244

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 181 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 240

Query: 243 NNIV 246
             ++
Sbjct: 241 TGLI 244


>gi|157161388|ref|YP_001458706.1| DNA-binding transcriptional activator SdiA [Escherichia coli HS]
 gi|170019746|ref|YP_001724700.1| DNA-binding transcriptional activator SdiA [Escherichia coli ATCC
           8739]
 gi|218689909|ref|YP_002398121.1| DNA-binding transcriptional activator SdiA [Escherichia coli ED1a]
 gi|218705411|ref|YP_002412930.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           UMN026]
 gi|300899169|ref|ZP_07117448.1| autoinducer binding domain protein [Escherichia coli MS 198-1]
 gi|300928947|ref|ZP_07144451.1| autoinducer binding domain protein [Escherichia coli MS 187-1]
 gi|331673434|ref|ZP_08374202.1| regulatory protein SdiA [Escherichia coli TA280]
 gi|331683468|ref|ZP_08384069.1| regulatory protein SdiA [Escherichia coli H299]
 gi|157067068|gb|ABV06323.1| regulatory protein SdiA [Escherichia coli HS]
 gi|169754674|gb|ACA77373.1| transcriptional regulator, LuxR family [Escherichia coli ATCC 8739]
 gi|218427473|emb|CAR08247.1| DNA-binding transcriptional activator [Escherichia coli ED1a]
 gi|218432508|emb|CAR13401.1| DNA-binding transcriptional activator [Escherichia coli UMN026]
 gi|300357228|gb|EFJ73098.1| autoinducer binding domain protein [Escherichia coli MS 198-1]
 gi|300463101|gb|EFK26594.1| autoinducer binding domain protein [Escherichia coli MS 187-1]
 gi|331069632|gb|EGI41019.1| regulatory protein SdiA [Escherichia coli TA280]
 gi|331079683|gb|EGI50880.1| regulatory protein SdiA [Escherichia coli H299]
          Length = 240

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|300951540|ref|ZP_07165374.1| autoinducer binding domain protein [Escherichia coli MS 116-1]
 gi|300956569|ref|ZP_07168849.1| autoinducer binding domain protein [Escherichia coli MS 175-1]
 gi|300316616|gb|EFJ66400.1| autoinducer binding domain protein [Escherichia coli MS 175-1]
 gi|300449215|gb|EFK12835.1| autoinducer binding domain protein [Escherichia coli MS 116-1]
 gi|323940421|gb|EGB36612.1| autoinducer binding domain-containing protein [Escherichia coli
           E482]
 gi|332089650|gb|EGI94752.1| regulatory protein sdiA [Shigella boydii 5216-82]
          Length = 240

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|296101736|ref|YP_003611882.1| DNA-binding transcriptional activator SdiA [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295056195|gb|ADF60933.1| DNA-binding transcriptional activator SdiA [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 240

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 37/64 (57%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + + + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMKFSKREREILKWTAEGKTSAEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|311280044|ref|YP_003942275.1| transcriptional regulator, LuxR family [Enterobacter cloacae SCF1]
 gi|308749239|gb|ADO48991.1| transcriptional regulator, LuxR family [Enterobacter cloacae SCF1]
          Length = 216

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 76/184 (41%), Gaps = 35/184 (19%)

Query: 68  LFQEQKLDSIVSSDWPFDLVRC------MALSEKDKYYN--VLQRPTELFCPVFHTLPEN 119
           LF  Q +DS     W F L  C      +  +    Y+N  +++ P  +   VFHT  + 
Sbjct: 58  LFDMQSIDSQAMHQWCFALQNCPKQFKVLLFNTPQHYHNRDIVEWP--MISGVFHTETDE 115

Query: 120 ITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVH 179
                G+ N        V R        FPK             ++  Y           
Sbjct: 116 EHLIDGIKN--------VCRGE----KCFPK-------------VINDYIVQQLNLSHPQ 150

Query: 180 WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           W +  ELT RE E L  + +G ++ EIA +L IS NTV  +I ++ +K + K R+ A+ +
Sbjct: 151 WNECVELTRREKEILCKLRQGASNIEIAHLLFISENTVKTHIYNLFKKLSVKNRTQAVFW 210

Query: 240 AVRN 243
           A RN
Sbjct: 211 ANRN 214


>gi|301029367|ref|ZP_07192464.1| autoinducer binding domain protein [Escherichia coli MS 196-1]
 gi|301645566|ref|ZP_07245495.1| autoinducer binding domain protein [Escherichia coli MS 146-1]
 gi|307138583|ref|ZP_07497939.1| DNA-binding transcriptional activator SdiA [Escherichia coli H736]
 gi|331642538|ref|ZP_08343673.1| regulatory protein SdiA [Escherichia coli H736]
 gi|299877793|gb|EFI86004.1| autoinducer binding domain protein [Escherichia coli MS 196-1]
 gi|301076098|gb|EFK90904.1| autoinducer binding domain protein [Escherichia coli MS 146-1]
 gi|323186308|gb|EFZ71658.1| regulatory protein sdiA [Escherichia coli 1357]
 gi|323948203|gb|EGB44191.1| autoinducer binding domain-containing protein [Escherichia coli
           H120]
 gi|324017952|gb|EGB87171.1| autoinducer binding domain protein [Escherichia coli MS 117-3]
 gi|324118970|gb|EGC12859.1| autoinducer binding domain-containing protein [Escherichia coli
           E1167]
 gi|331039336|gb|EGI11556.1| regulatory protein SdiA [Escherichia coli H736]
          Length = 240

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|169797684|ref|YP_001715477.1| autoinducer-binding transcriptional regulator [Acinetobacter
           baumannii AYE]
 gi|213155522|ref|YP_002317567.1| eR transcriptional regulator [Acinetobacter baumannii AB0057]
 gi|215485038|ref|YP_002327279.1| Transcriptional activator protein phzR [Acinetobacter baumannii
           AB307-0294]
 gi|239503083|ref|ZP_04662393.1| Transcriptional activator protein phzR [Acinetobacter baumannii
           AB900]
 gi|301348492|ref|ZP_07229233.1| Transcriptional activator protein phzR [Acinetobacter baumannii
           AB056]
 gi|301513441|ref|ZP_07238678.1| Transcriptional activator protein phzR [Acinetobacter baumannii
           AB058]
 gi|301597204|ref|ZP_07242212.1| Transcriptional activator protein phzR [Acinetobacter baumannii
           AB059]
 gi|332853574|ref|ZP_08434826.1| putative autoinducer-binding transcriptional regulator BmaR5
           [Acinetobacter baumannii 6013150]
 gi|332869309|ref|ZP_08438707.1| putative autoinducer-binding transcriptional regulator BmaR5
           [Acinetobacter baumannii 6013113]
 gi|169150611|emb|CAM88520.1| putative Autoinducer-binding transcriptional regulator (LuxR
           family) [Acinetobacter baumannii AYE]
 gi|193076010|gb|ABO10598.2| eR transcriptional regulator [Acinetobacter baumannii ATCC 17978]
 gi|213054682|gb|ACJ39584.1| eR transcriptional regulator [Acinetobacter baumannii AB0057]
 gi|213987791|gb|ACJ58090.1| Transcriptional activator protein phzR [Acinetobacter baumannii
           AB307-0294]
 gi|323516195|gb|ADX90576.1| autoinducer-binding transcriptional regulator [Acinetobacter
           baumannii TCDC-AB0715]
 gi|332728538|gb|EGJ59911.1| putative autoinducer-binding transcriptional regulator BmaR5
           [Acinetobacter baumannii 6013150]
 gi|332732817|gb|EGJ64032.1| putative autoinducer-binding transcriptional regulator BmaR5
           [Acinetobacter baumannii 6013113]
          Length = 238

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 177 DVHWGK-DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSG 235
           DV + K +  LT RE E L W +EGKTS EIA ILG++  TVN ++++ M+K     +  
Sbjct: 168 DVEFAKFNLYLTNREKEALRWTAEGKTSAEIAQILGVTERTVNFHLSNSMQKLNVNNKIS 227

Query: 236 AIAYAV 241
           A   AV
Sbjct: 228 AAIRAV 233


>gi|126640216|ref|YP_001083200.1| eR transcriptional regulator [Acinetobacter baumannii ATCC 17978]
          Length = 198

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 177 DVHWGK-DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSG 235
           DV + K +  LT RE E L W +EGKTS EIA ILG++  TVN ++++ M+K     +  
Sbjct: 128 DVEFAKFNLYLTNREKEALRWTAEGKTSAEIAQILGVTERTVNFHLSNSMQKLNVNNKIS 187

Query: 236 AIAYAV 241
           A   AV
Sbjct: 188 AAIRAV 193


>gi|119484778|ref|ZP_01619260.1| two-component response regulator [Lyngbya sp. PCC 8106]
 gi|119457596|gb|EAW38720.1| two-component response regulator [Lyngbya sp. PCC 8106]
          Length = 215

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 98/208 (47%), Gaps = 22/208 (10%)

Query: 51  ALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKY---YNVLQRPTE 107
           ++++Y+  S + ++  +  QE     +V    P  +V  + + E D Y     +  RP  
Sbjct: 17  SISDYLEISGYTVISAENGQEAL--ELVDKHKPHLIVTDITMPEMDGYDLVKRIRSRPAF 74

Query: 108 LFCPVF----HTLPENITP--PAGMDNRYCSLTFDVARIRIGLMLLFPKGRII---LRDR 158
              PV     HT  ++       G DN Y    F++  + + +  L  + ++I   LR R
Sbjct: 75  RLLPVIFLTAHTAIQSRIRGYQLGCDN-YLPKPFELDELGVVIRALLERSQLIESELRSR 133

Query: 159 LWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVN 218
           + E  ++     + F         +  LT RE + L  ++EG+++ +I   L +S  T+ 
Sbjct: 134 VSESPVVTNGATSTF-------SHEISLTEREQQVLDLLTEGRSNVKIGEKLHLSPRTIE 186

Query: 219 NYIASIMRKTATKTRSGAIAYAVRNNIV 246
            Y++S++RKT +  R+  + +A++N+++
Sbjct: 187 KYVSSLLRKTESNNRAELVRFALKNHLI 214


>gi|117624058|ref|YP_852971.1| DNA-binding transcriptional activator SdiA [Escherichia coli APEC
           O1]
 gi|161486200|ref|NP_754222.2| DNA-binding transcriptional activator SdiA [Escherichia coli
           CFT073]
 gi|162138422|ref|YP_541121.2| DNA-binding transcriptional activator SdiA [Escherichia coli UTI89]
 gi|191173269|ref|ZP_03034799.1| regulatory protein SdiA [Escherichia coli F11]
 gi|218558774|ref|YP_002391687.1| DNA-binding transcriptional activator SdiA [Escherichia coli S88]
 gi|218699520|ref|YP_002407149.1| DNA-binding transcriptional activator SdiA [Escherichia coli IAI39]
 gi|227885657|ref|ZP_04003462.1| LuxR family protein [Escherichia coli 83972]
 gi|300982244|ref|ZP_07175956.1| autoinducer binding domain protein [Escherichia coli MS 200-1]
 gi|300993973|ref|ZP_07180620.1| autoinducer binding domain protein [Escherichia coli MS 45-1]
 gi|301050730|ref|ZP_07197588.1| autoinducer binding domain protein [Escherichia coli MS 185-1]
 gi|306814260|ref|ZP_07448426.1| DNA-binding transcriptional activator SdiA [Escherichia coli NC101]
 gi|331647509|ref|ZP_08348601.1| regulatory protein SdiA [Escherichia coli M605]
 gi|115513182|gb|ABJ01257.1| DNA-binding transcriptional activator [Escherichia coli APEC O1]
 gi|190906386|gb|EDV65995.1| regulatory protein SdiA [Escherichia coli F11]
 gi|218365543|emb|CAR03270.1| DNA-binding transcriptional activator [Escherichia coli S88]
 gi|218369506|emb|CAR17273.1| DNA-binding transcriptional activator [Escherichia coli IAI39]
 gi|222033657|emb|CAP76398.1| Regulatory protein sdiA [Escherichia coli LF82]
 gi|227837230|gb|EEJ47696.1| LuxR family protein [Escherichia coli 83972]
 gi|281178978|dbj|BAI55308.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli
           SE15]
 gi|294493959|gb|ADE92715.1| regulatory protein SdiA [Escherichia coli IHE3034]
 gi|300297547|gb|EFJ53932.1| autoinducer binding domain protein [Escherichia coli MS 185-1]
 gi|300307314|gb|EFJ61834.1| autoinducer binding domain protein [Escherichia coli MS 200-1]
 gi|300406419|gb|EFJ89957.1| autoinducer binding domain protein [Escherichia coli MS 45-1]
 gi|305852419|gb|EFM52870.1| DNA-binding transcriptional activator SdiA [Escherichia coli NC101]
 gi|307553930|gb|ADN46705.1| DNA-binding transcriptional activator [Escherichia coli ABU 83972]
 gi|307626607|gb|ADN70911.1| DNA-binding transcriptional activator SdiA [Escherichia coli UM146]
 gi|312946508|gb|ADR27335.1| DNA-binding transcriptional activator SdiA [Escherichia coli O83:H1
           str. NRG 857C]
 gi|315286610|gb|EFU46043.1| autoinducer binding domain protein [Escherichia coli MS 110-3]
 gi|315290297|gb|EFU49675.1| autoinducer binding domain protein [Escherichia coli MS 153-1]
 gi|315296532|gb|EFU55829.1| autoinducer binding domain protein [Escherichia coli MS 16-3]
 gi|320194372|gb|EFW69003.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           WV_060327]
 gi|323186796|gb|EFZ72116.1| regulatory protein sdiA [Escherichia coli RN587/1]
 gi|323952411|gb|EGB48284.1| autoinducer binding domain-containing protein [Escherichia coli
           H252]
 gi|323956313|gb|EGB52056.1| autoinducer binding domain-containing protein [Escherichia coli
           H263]
 gi|324007279|gb|EGB76498.1| autoinducer binding domain protein [Escherichia coli MS 57-2]
 gi|324013560|gb|EGB82779.1| autoinducer binding domain protein [Escherichia coli MS 60-1]
 gi|330911724|gb|EGH40234.1| N-3-oxohexanoyl-L-homoserine lactone quorum-sensing transcriptional
           activator [Escherichia coli AA86]
 gi|331043233|gb|EGI15371.1| regulatory protein SdiA [Escherichia coli M605]
          Length = 240

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|323702109|ref|ZP_08113777.1| two component transcriptional regulator, LuxR family
           [Desulfotomaculum nigrificans DSM 574]
 gi|323532991|gb|EGB22862.1| two component transcriptional regulator, LuxR family
           [Desulfotomaculum nigrificans DSM 574]
          Length = 218

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 42/72 (58%)

Query: 175 SYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRS 234
           S D H  K   LT RE+E L  +++G+++ +IA  L IS  TV N++ +I +K     R+
Sbjct: 145 SVDHHDKKHSTLTERELEVLKQVAKGQSNKDIAKTLFISEKTVKNHLTNIFQKIGVADRT 204

Query: 235 GAIAYAVRNNIV 246
            A  YA++  +V
Sbjct: 205 QAALYAIKEKLV 216


>gi|293405402|ref|ZP_06649394.1| regulatory protein sdiA [Escherichia coli FVEC1412]
 gi|298381046|ref|ZP_06990645.1| regulatory protein sdiA [Escherichia coli FVEC1302]
 gi|291427610|gb|EFF00637.1| regulatory protein sdiA [Escherichia coli FVEC1412]
 gi|298278488|gb|EFI20002.1| regulatory protein sdiA [Escherichia coli FVEC1302]
          Length = 244

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 181 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 240

Query: 243 NNIV 246
             ++
Sbjct: 241 TGLI 244


>gi|260557627|ref|ZP_05829841.1| transcriptional activator protein phzR [Acinetobacter baumannii
           ATCC 19606]
 gi|260408800|gb|EEX02104.1| transcriptional activator protein phzR [Acinetobacter baumannii
           ATCC 19606]
          Length = 238

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 177 DVHWGK-DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSG 235
           DV + K +  LT RE E L W +EGKTS EIA ILG++  TVN ++++ M+K     +  
Sbjct: 168 DVEFAKFNLYLTNREKEALRWTAEGKTSAEIAQILGVTERTVNFHLSNSMQKLNVNNKIS 227

Query: 236 AIAYAV 241
           A   AV
Sbjct: 228 AAIRAV 233


>gi|196041819|ref|ZP_03109108.1| transcriptional regulatory protein DegU [Bacillus cereus
           NVH0597-99]
 gi|229028432|ref|ZP_04184554.1| DNA-binding response regulator [Bacillus cereus AH1271]
 gi|196027313|gb|EDX65931.1| transcriptional regulatory protein DegU [Bacillus cereus
           NVH0597-99]
 gi|228732881|gb|EEL83741.1| DNA-binding response regulator [Bacillus cereus AH1271]
          Length = 213

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN 
Sbjct: 149 ELTEREKEILFELVKGLSNKEIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQ 208

Query: 245 IV 246
           +V
Sbjct: 209 LV 210


>gi|170683439|ref|YP_001743327.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           SMS-3-5]
 gi|256017886|ref|ZP_05431751.1| DNA-binding transcriptional activator SdiA [Shigella sp. D9]
 gi|307314177|ref|ZP_07593787.1| transcriptional regulator, LuxR family [Escherichia coli W]
 gi|309795974|ref|ZP_07690387.1| autoinducer binding domain protein [Escherichia coli MS 145-7]
 gi|170521157|gb|ACB19335.1| regulatory protein SdiA [Escherichia coli SMS-3-5]
 gi|306906146|gb|EFN36664.1| transcriptional regulator, LuxR family [Escherichia coli W]
 gi|308120424|gb|EFO57686.1| autoinducer binding domain protein [Escherichia coli MS 145-7]
 gi|315061216|gb|ADT75543.1| DNA-binding transcriptional activator [Escherichia coli W]
 gi|323378207|gb|ADX50475.1| transcriptional regulator, LuxR family [Escherichia coli KO11]
 gi|323968333|gb|EGB63740.1| autoinducer binding domain-containing protein [Escherichia coli
           M863]
 gi|327253047|gb|EGE64701.1| regulatory protein sdiA [Escherichia coli STEC_7v]
          Length = 240

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|146454419|gb|ABQ41883.1| LuxR [Acidovorax citrulli]
          Length = 242

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE ECLTW++ GK+S EI  I+ IS +TVN ++ + M K  T +R  A   A    
Sbjct: 178 KLTSREAECLTWVAYGKSSREIGRIMRISEHTVNFHLKNAMAKFDTASRVTAAVRAANLG 237

Query: 245 IV 246
           ++
Sbjct: 238 LI 239


>gi|228907986|ref|ZP_04071836.1| DNA-binding response regulator [Bacillus thuringiensis IBL 200]
 gi|228851652|gb|EEM96456.1| DNA-binding response regulator [Bacillus thuringiensis IBL 200]
          Length = 213

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN 
Sbjct: 149 ELTEREKEILFELVKGLSNKEIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQ 208

Query: 245 IV 246
           +V
Sbjct: 209 LV 210


>gi|193066393|ref|ZP_03047441.1| regulatory protein SdiA [Escherichia coli E22]
 gi|192925978|gb|EDV80624.1| regulatory protein SdiA [Escherichia coli E22]
          Length = 240

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|320198610|gb|EFW73210.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           EC4100B]
          Length = 240

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|256022426|ref|ZP_05436291.1| DNA-binding transcriptional activator SdiA [Escherichia sp.
           4_1_40B]
          Length = 240

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|229156108|ref|ZP_04284207.1| DNA-binding response regulator [Bacillus cereus ATCC 4342]
 gi|228627429|gb|EEK84157.1| DNA-binding response regulator [Bacillus cereus ATCC 4342]
          Length = 213

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN 
Sbjct: 149 ELTEREKEILFELVKGLSNKEIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQ 208

Query: 245 IV 246
           +V
Sbjct: 209 LV 210


>gi|215487121|ref|YP_002329552.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O127:H6 str. E2348/69]
 gi|215265193|emb|CAS09582.1| DNA-binding transcriptional activator [Escherichia coli O127:H6
           str. E2348/69]
          Length = 240

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|27376173|ref|NP_767702.1| transcriptional regulator [Bradyrhizobium japonicum USDA 110]
 gi|27349312|dbj|BAC46327.1| transcriptional regulatory protein [Bradyrhizobium japonicum USDA
           110]
          Length = 242

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E ++W S+GK++ EI  IL I++ T   ++A+  RK     R+ A+A A+R+ I
Sbjct: 180 LTPREREVISWASQGKSAWEIGEILHITQRTAEEHLATAARKLGAVNRTHAVALAIRHKI 239

Query: 246 V 246
           +
Sbjct: 240 I 240


>gi|191168286|ref|ZP_03030079.1| regulatory protein SdiA [Escherichia coli B7A]
 gi|194429919|ref|ZP_03062429.1| regulatory protein SdiA [Escherichia coli B171]
 gi|218554500|ref|YP_002387413.1| DNA-binding transcriptional activator SdiA [Escherichia coli IAI1]
 gi|260844320|ref|YP_003222098.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O103:H2 str. 12009]
 gi|260868508|ref|YP_003234910.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O111:H- str. 11128]
 gi|293410275|ref|ZP_06653851.1| conserved hypothetical protein [Escherichia coli B354]
 gi|300818660|ref|ZP_07098868.1| autoinducer binding domain protein [Escherichia coli MS 107-1]
 gi|300925008|ref|ZP_07140932.1| autoinducer binding domain protein [Escherichia coli MS 182-1]
 gi|301327706|ref|ZP_07220912.1| autoinducer binding domain protein [Escherichia coli MS 78-1]
 gi|331668610|ref|ZP_08369458.1| regulatory protein SdiA [Escherichia coli TA271]
 gi|331677801|ref|ZP_08378476.1| regulatory protein SdiA [Escherichia coli H591]
 gi|190901658|gb|EDV61414.1| regulatory protein SdiA [Escherichia coli B7A]
 gi|194412008|gb|EDX28320.1| regulatory protein SdiA [Escherichia coli B171]
 gi|218361268|emb|CAQ98852.1| DNA-binding transcriptional activator [Escherichia coli IAI1]
 gi|257759467|dbj|BAI30964.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O103:H2 str. 12009]
 gi|257764864|dbj|BAI36359.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O111:H- str. 11128]
 gi|284921829|emb|CBG34902.1| regulatory protein [Escherichia coli 042]
 gi|291470743|gb|EFF13227.1| conserved hypothetical protein [Escherichia coli B354]
 gi|300418843|gb|EFK02154.1| autoinducer binding domain protein [Escherichia coli MS 182-1]
 gi|300528832|gb|EFK49894.1| autoinducer binding domain protein [Escherichia coli MS 107-1]
 gi|300845750|gb|EFK73510.1| autoinducer binding domain protein [Escherichia coli MS 78-1]
 gi|323158600|gb|EFZ44614.1| regulatory protein sdiA [Escherichia coli E128010]
 gi|323180833|gb|EFZ66373.1| regulatory protein sdiA [Escherichia coli 1180]
 gi|331063804|gb|EGI35715.1| regulatory protein SdiA [Escherichia coli TA271]
 gi|331074261|gb|EGI45581.1| regulatory protein SdiA [Escherichia coli H591]
          Length = 240

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|331663414|ref|ZP_08364324.1| regulatory protein SdiA [Escherichia coli TA143]
 gi|323977903|gb|EGB72989.1| autoinducer binding domain-containing protein [Escherichia coli
           TW10509]
 gi|331059213|gb|EGI31190.1| regulatory protein SdiA [Escherichia coli TA143]
          Length = 240

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|187928756|ref|YP_001899243.1| two component LuxR family transcriptional regulator [Ralstonia
           pickettii 12J]
 gi|187930011|ref|YP_001900498.1| two component LuxR family transcriptional regulator [Ralstonia
           pickettii 12J]
 gi|187725646|gb|ACD26811.1| two component transcriptional regulator, LuxR family [Ralstonia
           pickettii 12J]
 gi|187726901|gb|ACD28066.1| two component transcriptional regulator, LuxR family [Ralstonia
           pickettii 12J]
          Length = 201

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 45/84 (53%), Gaps = 1/84 (1%)

Query: 164 LLAAYQANMFKSYDVHWGKD-FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIA 222
           L++  Q  + +    H      +L+ REVE L W + GKTS EIA ILG+S+ TV+ ++ 
Sbjct: 116 LMSIVQTRLARRPRTHTAHPPVQLSEREVEVLAWSARGKTSGEIATILGLSKRTVDFHMD 175

Query: 223 SIMRKTATKTRSGAIAYAVRNNIV 246
           +   K    TR  A+  A  + I+
Sbjct: 176 NAREKLGVATRIEAVVRASSSGII 199


>gi|47568085|ref|ZP_00238790.1| DNA-binding response regulator [Bacillus cereus G9241]
 gi|229042495|ref|ZP_04190240.1| DNA-binding response regulator [Bacillus cereus AH676]
 gi|229108243|ref|ZP_04237865.1| DNA-binding response regulator [Bacillus cereus Rock1-15]
 gi|229194950|ref|ZP_04321731.1| DNA-binding response regulator [Bacillus cereus m1293]
 gi|47555239|gb|EAL13585.1| DNA-binding response regulator [Bacillus cereus G9241]
 gi|228588518|gb|EEK46555.1| DNA-binding response regulator [Bacillus cereus m1293]
 gi|228675259|gb|EEL30481.1| DNA-binding response regulator [Bacillus cereus Rock1-15]
 gi|228726848|gb|EEL78060.1| DNA-binding response regulator [Bacillus cereus AH676]
          Length = 213

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN 
Sbjct: 149 ELTEREKEILFELVKGLSNKEIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQ 208

Query: 245 IV 246
           +V
Sbjct: 209 LV 210


>gi|288922222|ref|ZP_06416420.1| two component transcriptional regulator, LuxR family [Frankia sp.
           EUN1f]
 gi|288346413|gb|EFC80744.1| two component transcriptional regulator, LuxR family [Frankia sp.
           EUN1f]
          Length = 239

 Score = 52.0 bits (123), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++EG+ + EIA  L IS NTV N++ +I+ K    +R  A+ YAVR  +
Sbjct: 176 LTARELEVLKLVAEGRANREIARKLFISENTVKNHVRNILDKLQLHSRMEAVMYAVRQGL 235


>gi|228950550|ref|ZP_04112691.1| DNA-binding response regulator [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228809127|gb|EEM55607.1| DNA-binding response regulator [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
          Length = 213

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN 
Sbjct: 149 ELTEREKEILFELVKGLSNKEIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQ 208

Query: 245 IV 246
           +V
Sbjct: 209 LV 210


>gi|328542134|ref|YP_004302243.1| LuxR family transcriptional regulator [polymorphum gilvum
           SL003B-26A1]
 gi|326411884|gb|ADZ68947.1| LuxR family transcriptional regulator [Polymorphum gilvum
           SL003B-26A1]
          Length = 217

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE ECL W++ GKT  EI++ILGIS  TV  +  +I  K  T +R   I  AVR  +
Sbjct: 155 LSPRERECLIWLANGKTRWEISLILGISEETVKYHFKNIRAKFGTYSRHEIIIQAVRLGL 214

Query: 246 V 246
           +
Sbjct: 215 I 215


>gi|296126426|ref|YP_003633678.1| LuxR family transcriptional regulator [Brachyspira murdochii DSM
           12563]
 gi|296018242|gb|ADG71479.1| transcriptional regulator, LuxR family [Brachyspira murdochii DSM
           12563]
          Length = 320

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 36/49 (73%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
            LT RE E L+++ +GKT+ E+++IL IS NTVNN++A+I  K+  K R
Sbjct: 263 NLTRREREILSYLLDGKTNKEVSLILDISLNTVNNHVANIYEKSGVKNR 311


>gi|291441190|ref|ZP_06580580.1| predicted protein [Streptomyces ghanaensis ATCC 14672]
 gi|291344085|gb|EFE71041.1| predicted protein [Streptomyces ghanaensis ATCC 14672]
          Length = 133

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%)

Query: 180 WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
            G    LT R+   L+ ++EG  + +IA++LG S +TV N I  IM +   + R+ A+A+
Sbjct: 67  GGGRPALTARQASVLSLMAEGYGNADIALLLGCSEHTVKNVIYEIMARLQARNRAHAVAH 126

Query: 240 AVRNNIV 246
           AVR+ +V
Sbjct: 127 AVRHGLV 133


>gi|238926042|ref|YP_002939560.1| two-component response regulator (extracellular proteinase response
           regulator) [Eubacterium rectale ATCC 33656]
 gi|238877719|gb|ACR77426.1| two-component response regulator (extracellular proteinase response
           regulator) [Eubacterium rectale ATCC 33656]
 gi|291526556|emb|CBK92143.1| Response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Eubacterium rectale DSM 17629]
 gi|291529198|emb|CBK94784.1| Response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Eubacterium rectale M104/1]
          Length = 214

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 47/84 (55%), Gaps = 1/84 (1%)

Query: 163 GLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIA 222
            L+ A  + M +  +     D  LT RE+E L  ++ GK + +IA  + IS  TV N+I+
Sbjct: 129 SLIPALNSKMIQKNEDELKIDA-LTKREMEVLKEMAVGKFNRDIAKEMKISERTVKNHIS 187

Query: 223 SIMRKTATKTRSGAIAYAVRNNIV 246
           SI +K     R+ A  +A+RNNI+
Sbjct: 188 SIFKKLEVTDRTQAAVFAIRNNII 211


>gi|330958109|gb|EGH58369.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 254

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 156 RDRLWEIGLLA-AYQANMFKSYD--VHWGKDFELTGREVECLTWISEGKTSDEIAVILGI 212
           R  L E GLLA A+Q   +  +D  +      +LT RE ECL+W +EG T+ EIA  L  
Sbjct: 159 RQSLAEFGLLAHAFQEVAYPLFDEKMRSCTAIKLTRRERECLSWSAEGLTAREIADQLNR 218

Query: 213 SRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           S  TV  ++ S M+K   K R  A+  AV 
Sbjct: 219 SVATVTLHLNSAMQKLGAKNRVQAVVRAVH 248


>gi|312973873|ref|ZP_07788045.1| regulatory protein sdiA [Escherichia coli 1827-70]
 gi|310332468|gb|EFP99703.1| regulatory protein sdiA [Escherichia coli 1827-70]
          Length = 221

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 158 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 217

Query: 243 NNIV 246
             ++
Sbjct: 218 TGLI 221


>gi|196047172|ref|ZP_03114389.1| transcriptional regulatory protein DegU [Bacillus cereus 03BB108]
 gi|229182965|ref|ZP_04310198.1| DNA-binding response regulator [Bacillus cereus BGSC 6E1]
 gi|196022042|gb|EDX60732.1| transcriptional regulatory protein DegU [Bacillus cereus 03BB108]
 gi|228600589|gb|EEK58176.1| DNA-binding response regulator [Bacillus cereus BGSC 6E1]
          Length = 213

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN 
Sbjct: 149 ELTEREKEILFELVKGLSNKEIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQ 208

Query: 245 IV 246
           +V
Sbjct: 209 LV 210


>gi|158317264|ref|YP_001509772.1| two component LuxR family transcriptional regulator [Frankia sp.
           EAN1pec]
 gi|158112669|gb|ABW14866.1| two component transcriptional regulator, LuxR family [Frankia sp.
           EAN1pec]
          Length = 250

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++EG+ + EIA  L IS NTV N++ +I+ K    +R  A+ YAVR  +
Sbjct: 187 LTARELEVLKLVAEGRANREIARKLFISENTVKNHVRNILDKLQLHSRMEAVMYAVRQGL 246


>gi|239932840|ref|ZP_04689793.1| LuxR family transcriptional regulator [Streptomyces ghanaensis ATCC
           14672]
          Length = 144

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%)

Query: 180 WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
            G    LT R+   L+ ++EG  + +IA++LG S +TV N I  IM +   + R+ A+A+
Sbjct: 78  GGGRPALTARQASVLSLMAEGYGNADIALLLGCSEHTVKNVIYEIMARLQARNRAHAVAH 137

Query: 240 AVRNNIV 246
           AVR+ +V
Sbjct: 138 AVRHGLV 144


>gi|228918143|ref|ZP_04081650.1| DNA-binding response regulator [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228841505|gb|EEM86641.1| DNA-binding response regulator [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 213

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN 
Sbjct: 149 ELTEREKEILFELVKGLSNKEIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQ 208

Query: 245 IV 246
           +V
Sbjct: 209 LV 210


>gi|209526062|ref|ZP_03274594.1| two component transcriptional regulator, LuxR family [Arthrospira
           maxima CS-328]
 gi|209493450|gb|EDZ93773.1| two component transcriptional regulator, LuxR family [Arthrospira
           maxima CS-328]
          Length = 222

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 99/210 (47%), Gaps = 19/210 (9%)

Query: 51  ALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKY---YNVLQRPTE 107
           ++++Y+  S ++++     QE     +V    P  +V  +A+ E D +     V  +P  
Sbjct: 17  SISDYLEMSGYMVISATNGQEAL--ELVEKHQPHLIVTDIAMPEMDGFELVKRVRSQPGF 74

Query: 108 LFCPVF----HTLPENITP--PAGMDNRYCSLTFDVARIRIGLMLLFPKGRIIL---RDR 158
              PV     HT  E        G DN Y    F++  + + +  L  + ++I    R R
Sbjct: 75  RLLPVIFLTAHTSTEERIRGYQLGCDN-YLPKPFELDELGVVIRALLERSQLIEAEWRSR 133

Query: 159 LWEIGLLAAYQANMFKSYDVHW--GKDFELTGREVECLTWISEGKTSDEIAVILGISRNT 216
           + E   L+ + +  +K +  H     +  LT RE + L  ++EG ++ +I   L +S  T
Sbjct: 134 INEP--LSNHTSPRYKRHHFHSLSTTNIHLTEREQQVLNLLTEGLSNVKIGNSLHLSSRT 191

Query: 217 VNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           V  Y++S++RKT +  R+  + +A+ N+++
Sbjct: 192 VEKYVSSLLRKTDSSNRAALVRFALENDLI 221


>gi|206972973|ref|ZP_03233895.1| transcriptional regulatory protein DegU [Bacillus cereus AH1134]
 gi|228924979|ref|ZP_04088109.1| DNA-binding response regulator [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|229182326|ref|ZP_04309600.1| DNA-binding response regulator [Bacillus cereus 172560W]
 gi|229194039|ref|ZP_04320933.1| DNA-binding response regulator [Bacillus cereus ATCC 10876]
 gi|206731857|gb|EDZ49057.1| transcriptional regulatory protein DegU [Bacillus cereus AH1134]
 gi|228589439|gb|EEK47364.1| DNA-binding response regulator [Bacillus cereus ATCC 10876]
 gi|228601135|gb|EEK58682.1| DNA-binding response regulator [Bacillus cereus 172560W]
 gi|228834642|gb|EEM80151.1| DNA-binding response regulator [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 213

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN 
Sbjct: 149 ELTEREKEILFELVKGLSNKEIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQ 208

Query: 245 IV 246
           +V
Sbjct: 209 LV 210


>gi|167840217|ref|ZP_02466901.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           thailandensis MSMB43]
          Length = 230

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 62/137 (45%), Gaps = 26/137 (18%)

Query: 124 AGMDNRYCSLTFDVARIRIGLMLLFPKGRIIL-----------RDRLWEIGLLAAYQANM 172
           AG+DN             I + L  P GR++L            D  W    L   Q N+
Sbjct: 104 AGLDNG------------ISIPLHQPLGRVLLVSLSGTAPTHDADAKWRNAYLLGMQFNL 151

Query: 173 -FKSYDV--HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTA 229
            F+S            LT RE  CLTW++ GK+S  IA +L IS+ TV+ +I + M K  
Sbjct: 152 QFQSMRTCSPIPPSVHLTDREQMCLTWVARGKSSWVIANMLDISKYTVDFHIENAMEKLN 211

Query: 230 TKTRSGAIAYAVRNNIV 246
           T++R+ A   A R  ++
Sbjct: 212 TRSRTFAAVKATRQGLI 228


>gi|241203502|ref|YP_002974598.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857392|gb|ACS55059.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 65

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 25/61 (40%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           +T RE E + W++ GKT+ EI  ILGIS  TVN +IA+   +      +  +A A+RN I
Sbjct: 4   VTPRETEVIRWMAAGKTAAEIGTILGISHITVNTHIANAKARLGVFKDTALVAAALRNGI 63

Query: 246 V 246
           +
Sbjct: 64  I 64


>gi|332875591|ref|ZP_08443403.1| putative autoinducer-binding transcriptional regulator BmaR5
           [Acinetobacter baumannii 6014059]
 gi|332736164|gb|EGJ67179.1| putative autoinducer-binding transcriptional regulator BmaR5
           [Acinetobacter baumannii 6014059]
          Length = 238

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 177 DVHWGK-DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSG 235
           DV + K +  LT RE E L W +EGKTS EIA ILG++  TVN ++++ M+K     +  
Sbjct: 168 DVEFAKFNLYLTNREKEALRWTAEGKTSAEIAQILGVTERTVNFHLSNSMQKLNVNNKIS 227

Query: 236 AIAYAV 241
           A   AV
Sbjct: 228 AAIRAV 233


>gi|297538563|ref|YP_003674332.1| two component LuxR family transcriptional regulator [Methylotenera
           sp. 301]
 gi|297257910|gb|ADI29755.1| two component transcriptional regulator, LuxR family [Methylotenera
           sp. 301]
          Length = 315

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 35/57 (61%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           F+LT RE E L W ++GKTS +I  ILG S  TVN ++  +  K   +TR+ A A A
Sbjct: 251 FKLTSRESEVLYWATKGKTSRDIGDILGSSPRTVNKHLEHVFVKLGVETRTAAAALA 307


>gi|220920519|ref|YP_002495820.1| LuxR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219945125|gb|ACL55517.1| transcriptional regulator, LuxR family [Methylobacterium nodulans
           ORS 2060]
          Length = 123

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 40/67 (59%)

Query: 180 WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
            G D  LT RE+E L+ ++EG ++  IA  LGIS +T   ++ S++ K     R+ A+A+
Sbjct: 55  AGPDVGLTPREIEVLSLLAEGASNKAIARRLGISVHTAKFHVGSLLDKLDATGRTDAVAH 114

Query: 240 AVRNNIV 246
           A R  ++
Sbjct: 115 AARRGVI 121


>gi|241518604|ref|YP_002979232.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240863017|gb|ACS60681.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 864

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 39/55 (70%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           LT RE++ L W+  GK++ EIA +L +S  TV+++++SI+ K   KTR+ A ++A
Sbjct: 803 LTTREMDVLRWVDLGKSNGEIAALLFVSAKTVDHHVSSILAKLNAKTRTAAASHA 857


>gi|330879513|gb|EGH13662.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 254

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 156 RDRLWEIGLLA-AYQANMFKSYD--VHWGKDFELTGREVECLTWISEGKTSDEIAVILGI 212
           R  L E GLLA A+Q   +  +D  +      +LT RE ECL+W +EG T+ EIA  L  
Sbjct: 159 RQSLAEFGLLAHAFQEVAYPLFDQKMRSCNAIKLTRRERECLSWSAEGLTAREIADQLNR 218

Query: 213 SRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           S  T+  ++ S M+K   K R  A+  AV 
Sbjct: 219 SVATITLHLNSAMQKLGAKNRVQAVVRAVH 248


>gi|159900552|ref|YP_001546799.1| two component LuxR family transcriptional regulator [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|159893591|gb|ABX06671.1| two component transcriptional regulator, LuxR family [Herpetosiphon
           aurantiacus ATCC 23779]
          Length = 250

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 39/57 (68%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           ++ RE+E L  ++ G+T+ EIA  L IS  TV N+I+SI+RK A   R+ A+ +A++
Sbjct: 178 MSPREIEVLELVAAGQTNKEIAARLEISNQTVKNHISSILRKLAVNDRTQAVVFALQ 234


>gi|289811480|ref|ZP_06542109.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. AG3]
          Length = 115

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           D+    +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++  
Sbjct: 46  DMVMAPEMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQI 105

Query: 237 IAYAVRNNIV 246
             YA    ++
Sbjct: 106 ACYAAATGLI 115


>gi|300693076|ref|YP_003749049.1| two component heavy metal response transcriptional regulator
           [Ralstonia solanacearum PSI07]
 gi|299075113|emb|CBJ34395.1| Two component heavy metal response transcriptional regulator
           [Ralstonia solanacearum PSI07]
          Length = 201

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ REVE L W + GKTS EIA ILG+S+ TV+ +I +  +K    TR  A+  A    I
Sbjct: 139 LSEREVEVLAWSARGKTSGEIATILGLSKRTVDFHIDNARQKLGVATRIEAVVKASSAGI 198

Query: 246 V 246
           +
Sbjct: 199 I 199


>gi|297618086|ref|YP_003703245.1| LuxR family transcriptional regulator [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297145923|gb|ADI02680.1| two component transcriptional regulator, LuxR family
           [Syntrophothermus lipocalidus DSM 12680]
          Length = 213

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 40/64 (62%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + +LT RE + L  + +G ++ E+A  L IS  TV N++ SI RK   K R+ A+ YA++
Sbjct: 147 EMKLTKRERDVLELLVKGYSNKEVAAALFISEKTVKNHLTSIFRKLEVKDRTQAVIYALK 206

Query: 243 NNIV 246
           N +V
Sbjct: 207 NKVV 210


>gi|16129863|ref|NP_416426.1| quorum-sensing transcriptional activator [Escherichia coli str.
           K-12 substr. MG1655]
 gi|89108751|ref|AP_002531.1| DNA-binding transcriptional activator [Escherichia coli str. K-12
           substr. W3110]
 gi|170081564|ref|YP_001730884.1| DNA-binding transcriptional activator [Escherichia coli str. K-12
           substr. DH10B]
 gi|238901125|ref|YP_002926921.1| DNA-binding transcriptional activator [Escherichia coli BW2952]
 gi|253773131|ref|YP_003035962.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|2506570|sp|P07026|SDIA_ECOLI RecName: Full=Regulatory protein SdiA
 gi|1736575|dbj|BAA15736.1| DNA-binding transcriptional activator [Escherichia coli str. K12
           substr. W3110]
 gi|1788224|gb|AAC74983.1| quorum-sensing transcriptional activator [Escherichia coli str.
           K-12 substr. MG1655]
 gi|169889399|gb|ACB03106.1| DNA-binding transcriptional activator [Escherichia coli str. K-12
           substr. DH10B]
 gi|238860878|gb|ACR62876.1| DNA-binding transcriptional activator [Escherichia coli BW2952]
 gi|253324175|gb|ACT28777.1| transcriptional regulator, LuxR family [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|260448967|gb|ACX39389.1| transcriptional regulator, LuxR family [Escherichia coli DH1]
 gi|315136553|dbj|BAJ43712.1| DNA-binding transcriptional activator SdiA [Escherichia coli DH1]
          Length = 240

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|207722648|ref|YP_002253084.1| nitrate/nitrite response regulator protein [Ralstonia solanacearum
           MolK2]
 gi|206587830|emb|CAQ18412.1| nitrate/nitrite response regulator protein [Ralstonia solanacearum
           MolK2]
          Length = 201

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ REVE L W + GKTS EIA ILG+S+ TV+ +I +  +K    TR  A+  A    I
Sbjct: 139 LSEREVEVLAWSARGKTSGEIATILGLSKRTVDFHIDNARQKLGVATRIEAVVKASSAGI 198

Query: 246 V 246
           +
Sbjct: 199 I 199


>gi|115265509|dbj|BAF32771.1| transcriptional regulator of LuxR family [Pseudomonas syringae pv.
           actinidiae]
 gi|330965240|gb|EGH65500.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 254

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 156 RDRLWEIGLLA-AYQANMFKSYD--VHWGKDFELTGREVECLTWISEGKTSDEIAVILGI 212
           R  L E GLLA A+Q   +  +D  +      +LT RE ECL+W +EG T+ EIA  L  
Sbjct: 159 RQSLAEFGLLAHAFQEVAYPLFDQKMRSCNAIKLTRRERECLSWSAEGLTAREIADQLNR 218

Query: 213 SRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           S  T+  ++ S M+K   K R  A+  AV 
Sbjct: 219 SVATITLHLNSAMQKLGAKNRVQAVVRAVH 248


>gi|260598411|ref|YP_003210982.1| DNA-binding transcriptional activator SdiA [Cronobacter turicensis
           z3032]
 gi|260217588|emb|CBA31841.1| Regulatory protein sdiA [Cronobacter turicensis z3032]
          Length = 241

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           + +L+ RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA 
Sbjct: 178 EMKLSKREKEILQWTAEGKTSAEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAA 236


>gi|86739750|ref|YP_480150.1| two component LuxR family transcriptional regulator [Frankia sp.
           CcI3]
 gi|86566612|gb|ABD10421.1| two component transcriptional regulator, LuxR family [Frankia sp.
           CcI3]
          Length = 238

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++EG+ + EIA  L IS NTV N++ +I+ K    +R  A+ YAVR  +
Sbjct: 175 LTARELEVLKLVAEGRANREIARKLFISENTVKNHVRNILDKLQLHSRMEAVMYAVRQGL 234


>gi|193890916|gb|ACF28617.1| quorum sensing regulator [Mesorhizobium tianshanense]
          Length = 275

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+ECL W SEGKT  E  VILG+S +TV  Y+ S   K    + + A + A ++ +
Sbjct: 211 LSPRELECLRWTSEGKTVWECGVILGLSPHTVRCYLESARHKLGASSNTHAASLATKSGL 270

Query: 246 V 246
           +
Sbjct: 271 L 271


>gi|209551411|ref|YP_002283328.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537167|gb|ACI57102.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 251

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 39/64 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  LT RE+E L +++EG TS EI  +L IS +TV+ Y+  +  K   K R  A+A A R
Sbjct: 187 DTPLTRREMEILHYLAEGMTSMEIGKVLKISNHTVDWYMNGLQNKLKAKNRQQAVALAFR 246

Query: 243 NNIV 246
           + ++
Sbjct: 247 HRLI 250


>gi|110834848|ref|YP_693707.1| LuxR family DNA-binding response regulator [Alcanivorax borkumensis
           SK2]
 gi|110647959|emb|CAL17435.1| DNA-binding response regulator, LuxR family [Alcanivorax
           borkumensis SK2]
          Length = 301

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 35/59 (59%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
             +T RE + L WI+ GKT+ EIA IL +S  TVN ++  I RK   + R+ A A  ++
Sbjct: 237 LHVTHRESQVLVWIAHGKTNREIAQILELSPRTVNKHLEQIFRKLGVENRTAAAAMVIQ 295


>gi|53716260|ref|YP_106160.1| LuxR family transcriptional regulator [Burkholderia mallei ATCC
           23344]
 gi|53722590|ref|YP_111575.1| N-acylhomoserine lactone-dependent regulatory protein [Burkholderia
           pseudomallei K96243]
 gi|67640560|ref|ZP_00439362.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei GB8 horse 4]
 gi|76818021|ref|YP_335776.1| LuxR family transcriptional regulator [Burkholderia pseudomallei
           1710b]
 gi|124383134|ref|YP_001025820.1| ATP-dependent transcription regulator LuxR [Burkholderia mallei
           NCTC 10229]
 gi|126442943|ref|YP_001063209.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 668]
 gi|126446904|ref|YP_001077903.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei NCTC 10247]
 gi|126457976|ref|YP_001076161.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 1106a]
 gi|134281979|ref|ZP_01768685.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 305]
 gi|167002385|ref|ZP_02268175.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei PRL-20]
 gi|167724282|ref|ZP_02407518.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei DM98]
 gi|167743255|ref|ZP_02416029.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 14]
 gi|167820433|ref|ZP_02452113.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 91]
 gi|167828803|ref|ZP_02460274.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 9]
 gi|167850259|ref|ZP_02475767.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei B7210]
 gi|167898862|ref|ZP_02486263.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 7894]
 gi|167907182|ref|ZP_02494387.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei NCTC 13177]
 gi|167915548|ref|ZP_02502639.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 112]
 gi|167923392|ref|ZP_02510483.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei BCC215]
 gi|217425142|ref|ZP_03456637.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 576]
 gi|226195987|ref|ZP_03791573.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei Pakistan 9]
 gi|237510506|ref|ZP_04523221.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei MSHR346]
 gi|242313819|ref|ZP_04812836.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 1106b]
 gi|254176584|ref|ZP_04883242.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei ATCC 10399]
 gi|254185131|ref|ZP_04891720.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 1655]
 gi|254186897|ref|ZP_04893413.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254194457|ref|ZP_04900889.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei S13]
 gi|254201028|ref|ZP_04907393.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei FMH]
 gi|254204993|ref|ZP_04911346.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei JHU]
 gi|254264301|ref|ZP_04955166.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 1710a]
 gi|254301416|ref|ZP_04968860.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 406e]
 gi|254359112|ref|ZP_04975384.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei 2002721280]
 gi|52213004|emb|CAH39042.1| putative N-acylhomoserine lactone-dependent regulatory protein
           [Burkholderia pseudomallei K96243]
 gi|52422230|gb|AAU45800.1| transcriptional regulator, LuxR family [Burkholderia mallei ATCC
           23344]
 gi|76582494|gb|ABA51968.1| transcriptional regulator, LuxR family [Burkholderia pseudomallei
           1710b]
 gi|126222434|gb|ABN85939.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 668]
 gi|126231744|gb|ABN95157.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 1106a]
 gi|126239758|gb|ABO02870.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei NCTC 10247]
 gi|134246508|gb|EBA46596.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 305]
 gi|147748640|gb|EDK55715.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei FMH]
 gi|147754579|gb|EDK61643.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei JHU]
 gi|148028299|gb|EDK86259.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei 2002721280]
 gi|156105360|gb|ABU49179.1| BpsR3 [Burkholderia pseudomallei]
 gi|157810944|gb|EDO88114.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 406e]
 gi|157934581|gb|EDO90251.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160697626|gb|EDP87596.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei ATCC 10399]
 gi|169651208|gb|EDS83901.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei S13]
 gi|184215723|gb|EDU12704.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 1655]
 gi|217391747|gb|EEC31774.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 576]
 gi|225931880|gb|EEH27881.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei Pakistan 9]
 gi|235002711|gb|EEP52135.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei MSHR346]
 gi|238521303|gb|EEP84756.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei GB8 horse 4]
 gi|242137058|gb|EES23461.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 1106b]
 gi|243061949|gb|EES44135.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           mallei PRL-20]
 gi|254215303|gb|EET04688.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           pseudomallei 1710a]
 gi|261827149|gb|ABM99449.2| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei NCTC 10229]
          Length = 230

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 62/137 (45%), Gaps = 26/137 (18%)

Query: 124 AGMDNRYCSLTFDVARIRIGLMLLFPKGRIIL-----------RDRLWEIGLLAAYQANM 172
           AG+DN             I + L  P GR++L            D  W    L   Q N+
Sbjct: 104 AGLDNG------------ISIPLHQPLGRVLLVSLSGTAPTHDADAKWRNAYLLGMQFNL 151

Query: 173 -FKSYDV--HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTA 229
            F+S            LT RE  CLTW++ GK+S  IA +L IS+ TV+ +I + M K  
Sbjct: 152 QFQSMRTCRPIPPSVHLTDREQMCLTWVARGKSSWVIANMLDISKYTVDFHIENAMEKLN 211

Query: 230 TKTRSGAIAYAVRNNIV 246
           T++R+ A   A R  ++
Sbjct: 212 TRSRTFAAVKATRQGLI 228


>gi|300716150|ref|YP_003740953.1| regulatory protein [Erwinia billingiae Eb661]
 gi|299061986|emb|CAX59102.1| Regulatory protein [Erwinia billingiae Eb661]
          Length = 240

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 37/59 (62%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           + EL+ RE+E L W +EGKTS EI++IL IS NTVN +   + ++     ++   +YA 
Sbjct: 177 NMELSQRELEILKWTAEGKTSAEISLILSISENTVNFHQKKMQKRFNAPNKTQVASYAA 235


>gi|83749508|ref|ZP_00946497.1| Transcriptional regulator [Ralstonia solanacearum UW551]
 gi|207738514|ref|YP_002256907.1| two-component response regulator protein [Ralstonia solanacearum
           IPO1609]
 gi|83723820|gb|EAP71009.1| Transcriptional regulator [Ralstonia solanacearum UW551]
 gi|206591882|emb|CAQ58788.1| two-component response regulator protein [Ralstonia solanacearum
           IPO1609]
          Length = 201

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ REVE L W + GKTS EIA ILG+S+ TV+ +I +  +K    TR  A+  A    I
Sbjct: 139 LSEREVEVLAWSARGKTSGEIATILGLSKRTVDFHIDNARQKLGVATRIEAVVKASSAGI 198

Query: 246 V 246
           +
Sbjct: 199 I 199


>gi|320191891|gb|EFW66538.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. EC1212]
          Length = 240

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|188491931|ref|ZP_02999201.1| regulatory protein SdiA [Escherichia coli 53638]
 gi|260855896|ref|YP_003229787.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O26:H11 str. 11368]
 gi|331653323|ref|ZP_08354328.1| regulatory protein SdiA [Escherichia coli M718]
 gi|188487130|gb|EDU62233.1| regulatory protein SdiA [Escherichia coli 53638]
 gi|257754545|dbj|BAI26047.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O26:H11 str. 11368]
 gi|315617861|gb|EFU98459.1| regulatory protein sdiA [Escherichia coli 3431]
 gi|323152751|gb|EFZ39023.1| regulatory protein sdiA [Escherichia coli EPECa14]
 gi|331049421|gb|EGI21493.1| regulatory protein SdiA [Escherichia coli M718]
          Length = 240

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|293415226|ref|ZP_06657869.1| regulatory protein sdiA [Escherichia coli B185]
 gi|291432874|gb|EFF05853.1| regulatory protein sdiA [Escherichia coli B185]
          Length = 244

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 181 EMNFSKREKEILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 240

Query: 243 NNIV 246
             ++
Sbjct: 241 TGLI 244


>gi|194434963|ref|ZP_03067206.1| regulatory protein SdiA [Shigella dysenteriae 1012]
 gi|194416798|gb|EDX32924.1| regulatory protein SdiA [Shigella dysenteriae 1012]
 gi|320178182|gb|EFW53159.1| DNA-binding transcriptional activator SdiA [Shigella boydii ATCC
           9905]
 gi|332095461|gb|EGJ00482.1| regulatory protein sdiA [Shigella dysenteriae 155-74]
          Length = 240

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|156933489|ref|YP_001437405.1| DNA-binding transcriptional activator SdiA [Cronobacter sakazakii
           ATCC BAA-894]
 gi|156531743|gb|ABU76569.1| hypothetical protein ESA_01307 [Cronobacter sakazakii ATCC BAA-894]
          Length = 241

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           + +L+ RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA 
Sbjct: 178 EMKLSKREKEILQWTAEGKTSAEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAA 236


>gi|320652407|gb|EFX20705.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H- str. H 2687]
          Length = 240

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|218514308|ref|ZP_03511148.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli 8C-3]
          Length = 254

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (66%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           LT RE++CL W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A
Sbjct: 184 LTDREIDCLNWTAAGKTSAEIAEILVLSEHTVNHYLNRATKKLDTVNRTQA 234


>gi|15802351|ref|NP_288377.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 EDL933]
 gi|15831908|ref|NP_310681.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. Sakai]
 gi|168751842|ref|ZP_02776864.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4113]
 gi|168758227|ref|ZP_02783234.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4401]
 gi|168771520|ref|ZP_02796527.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4486]
 gi|168777340|ref|ZP_02802347.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4196]
 gi|168790328|ref|ZP_02815335.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC869]
 gi|168802260|ref|ZP_02827267.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC508]
 gi|195939220|ref|ZP_03084602.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. EC4024]
 gi|208810274|ref|ZP_03252150.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4206]
 gi|208816575|ref|ZP_03257695.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4045]
 gi|208820421|ref|ZP_03260741.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4042]
 gi|209399275|ref|YP_002271030.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4115]
 gi|217329032|ref|ZP_03445113.1| regulatory protein SdiA [Escherichia coli O157:H7 str. TW14588]
 gi|254793566|ref|YP_003078403.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. TW14359]
 gi|261227589|ref|ZP_05941870.1| DNA-binding transcriptional activator [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261255819|ref|ZP_05948352.1| DNA-binding transcriptional activator [Escherichia coli O157:H7
           str. FRIK966]
 gi|291283093|ref|YP_003499911.1| DNA-binding transcriptional activator [Escherichia coli O55:H7 str.
           CB9615]
 gi|12516014|gb|AAG56931.1|AE005414_8 transcriptional regulator of ftsQAZ gene cluster [Escherichia coli
           O157:H7 str. EDL933]
 gi|13362122|dbj|BAB36077.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli
           O157:H7 str. Sakai]
 gi|187767387|gb|EDU31231.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4196]
 gi|188014167|gb|EDU52289.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4113]
 gi|189354905|gb|EDU73324.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4401]
 gi|189359736|gb|EDU78155.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4486]
 gi|189370214|gb|EDU88630.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC869]
 gi|189375707|gb|EDU94123.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC508]
 gi|208724790|gb|EDZ74497.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4206]
 gi|208730918|gb|EDZ79607.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4045]
 gi|208740544|gb|EDZ88226.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4042]
 gi|209160675|gb|ACI38108.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4115]
 gi|209767028|gb|ACI81826.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli]
 gi|209767030|gb|ACI81827.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli]
 gi|209767032|gb|ACI81828.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli]
 gi|209767034|gb|ACI81829.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli]
 gi|209767036|gb|ACI81830.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli]
 gi|217318379|gb|EEC26806.1| regulatory protein SdiA [Escherichia coli O157:H7 str. TW14588]
 gi|254592966|gb|ACT72327.1| DNA-binding transcriptional activator [Escherichia coli O157:H7
           str. TW14359]
 gi|290762966|gb|ADD56927.1| DNA-binding transcriptional activator [Escherichia coli O55:H7 str.
           CB9615]
 gi|320647124|gb|EFX15957.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H- str. 493-89]
 gi|320658009|gb|EFX25771.1| DNA-binding transcriptional activator SdiA [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|320658581|gb|EFX26275.1| DNA-binding transcriptional activator SdiA [Escherichia coli O55:H7
           str. USDA 5905]
 gi|320668479|gb|EFX35306.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. LSU-61]
 gi|326342324|gb|EGD66105.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. 1044]
 gi|326344831|gb|EGD68578.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. 1125]
          Length = 240

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|156742230|ref|YP_001432359.1| two component LuxR family transcriptional regulator [Roseiflexus
           castenholzii DSM 13941]
 gi|156233558|gb|ABU58341.1| two component transcriptional regulator, LuxR family [Roseiflexus
           castenholzii DSM 13941]
          Length = 254

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 38/57 (66%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE+E L  I+ G ++ EIA  L IS  TV N+I+SI+RK +   R+ A+ YA+R
Sbjct: 173 LSDREIEVLERIAAGGSNREIAEALHISTQTVKNHISSILRKLSLNDRTQAVLYALR 229


>gi|146312149|ref|YP_001177223.1| DNA-binding transcriptional activator SdiA [Enterobacter sp. 638]
 gi|145319025|gb|ABP61172.1| transcriptional activator SdiA [Enterobacter sp. 638]
          Length = 240

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + + + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMKFSKREKEILKWTAEGKTSAEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAA 236

Query: 243 NNIV 246
              +
Sbjct: 237 TGFI 240


>gi|170727337|ref|YP_001761363.1| LuxR family transcriptional regulator [Shewanella woodyi ATCC
           51908]
 gi|169812684|gb|ACA87268.1| transcriptional regulator, LuxR family [Shewanella woodyi ATCC
           51908]
          Length = 250

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 86/194 (44%), Gaps = 32/194 (16%)

Query: 64  VRWD-LFQEQK---LDSIVSSDWPF-------DLVRCMALSEKDKYYNVLQRPTELFCPV 112
           V WD ++Q++K   +D +VS    F        +   + LSE    +N L+R  E+    
Sbjct: 78  VEWDNIYQKKKFQYIDPVVSCSASFRRSFNWASVPSMITLSEVQ--FNFLERAQEM---- 131

Query: 113 FHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANM 172
                       G+       +F   +I   L +    G  +  ++L  + L+ A  A  
Sbjct: 132 ------------GLKEGASIGSFSTRQIYKELTITSVCGCSLNPEQLASLELINAVSAQA 179

Query: 173 FKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKT 232
            K   +   K   LTGRE E L W SEGK+S EI +I  I+  TV  ++ +I +K   + 
Sbjct: 180 MKRLILPAEK---LTGRESEILAWSSEGKSSWEIGMICSITERTVKFHLKNIYKKLNVQN 236

Query: 233 RSGAIAYAVRNNIV 246
           R+ AI  A+R  ++
Sbjct: 237 RAQAIVCAIRLGLI 250


>gi|320641764|gb|EFX11152.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. G5101]
          Length = 240

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMNFSKREKEILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|304317230|ref|YP_003852375.1| LuxR family transcriptional regulator [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778732|gb|ADL69291.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 210

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE++ L+ I+EG ++ EIA  L +S  TV N++ +I RK   K R+ A  Y ++NN
Sbjct: 144 ELTDREMQILSLIAEGYSNKEIADKLFLSEKTVKNHVYNIFRKLDVKDRTQAAIYLLKNN 203


>gi|84498193|ref|ZP_00996990.1| putative two-component system response regulator [Janibacter sp.
           HTCC2649]
 gi|84381693|gb|EAP97576.1| putative two-component system response regulator [Janibacter sp.
           HTCC2649]
          Length = 202

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++ GK + EIA  L IS NTV N++ +I+ K    +R  A  YA+R N+
Sbjct: 138 LTERELEVLGLVARGKANKEIATQLFISENTVKNHVRNILEKLQLHSRVEAALYAMRRNL 197

Query: 246 V 246
           +
Sbjct: 198 I 198


>gi|288960338|ref|YP_003450678.1| transcriptional regulator [Azospirillum sp. B510]
 gi|288912646|dbj|BAI74134.1| transcriptional regulator [Azospirillum sp. B510]
          Length = 287

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 37/62 (59%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +L+ RE E L W S GKTS E  ++LG+S  TVN Y+ +  +K    T+  A A AVR  
Sbjct: 226 KLSPREREVLDWASRGKTSWETGMVLGLSEKTVNFYLRNACQKMNAATKVQAAAQAVREG 285

Query: 245 IV 246
           ++
Sbjct: 286 LI 287


>gi|148658406|ref|YP_001278611.1| two component LuxR family transcriptional regulator [Roseiflexus
           sp. RS-1]
 gi|148570516|gb|ABQ92661.1| two component transcriptional regulator, LuxR family [Roseiflexus
           sp. RS-1]
          Length = 246

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 37/57 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE++ L  ++ G T+  IA  L IS  TV N+I+SI+RK A   R+ A+ YA+R
Sbjct: 176 LSPRELQVLELVAAGHTNKAIAQSLDISNQTVKNHISSILRKLAVNDRTQAVVYAMR 232


>gi|197344631|gb|ACH69663.1| LuxR family transcriptional regulator [uncultured bacterium]
          Length = 238

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+ECL W+++GK++  IA IL IS +TV  Y+   +RK    TR  A+A  V   +
Sbjct: 177 LSPRELECLRWVAQGKSNTVIADILKISDDTVAFYLRGALRKLGVSTRMQAVALCVTFGL 236

Query: 246 V 246
           +
Sbjct: 237 I 237


>gi|20808107|ref|NP_623278.1| response regulator [Thermoanaerobacter tengcongensis MB4]
 gi|254479031|ref|ZP_05092387.1| response regulator receiver domain protein [Carboxydibrachium
           pacificum DSM 12653]
 gi|20516692|gb|AAM24882.1| Response regulators consisting of a CheY-like receiver domain and a
           HTH DNA-binding domain [Thermoanaerobacter tengcongensis
           MB4]
 gi|214035027|gb|EEB75745.1| response regulator receiver domain protein [Carboxydibrachium
           pacificum DSM 12653]
          Length = 208

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE+E L  +S+G ++ EIA  L +S  TV N++ +I RK   K R+ A  Y ++N 
Sbjct: 144 ELTPREIEILKLLSQGYSNKEIAQKLFLSEKTVKNHVYNIFRKLGVKDRTQAAIYMLKNQ 203

Query: 245 IV 246
            +
Sbjct: 204 TI 205


>gi|329944887|ref|ZP_08292914.1| response regulator receiver domain protein [Actinomyces sp. oral
           taxon 170 str. F0386]
 gi|328529698|gb|EGF56594.1| response regulator receiver domain protein [Actinomyces sp. oral
           taxon 170 str. F0386]
          Length = 234

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 62/126 (49%), Gaps = 6/126 (4%)

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRD--RLWEIGLLAAYQANMFKSYDVHWGK-- 182
           ++   SL   + +   G ++L P    I+ D  RLW  G     ++   ++         
Sbjct: 109 EDGASSLAGAIRQAVAGNLVLSPTSSAIISDQARLWANGSAQPSESTSKQTQTQQSASPL 168

Query: 183 --DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
                L+ RE E LT + + KT+ +IA  L +S  TV  ++++I+ K   + R GA+ YA
Sbjct: 169 PHGIPLSEREREVLTLVVDAKTNKQIATRLRLSEATVKTHVSAIIAKLGVQDRVGAVVYA 228

Query: 241 VRNNIV 246
           +++N+V
Sbjct: 229 LQHNLV 234


>gi|43288|emb|CAA27327.1| unnamed protein product [Escherichia coli]
          Length = 241

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 178 EMNFSKREKEILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 237

Query: 243 NNIV 246
             ++
Sbjct: 238 TGLI 241


>gi|254504710|ref|ZP_05116861.1| Sigma-70, region 4 family [Labrenzia alexandrii DFL-11]
 gi|222440781|gb|EEE47460.1| Sigma-70, region 4 family [Labrenzia alexandrii DFL-11]
          Length = 248

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 6/95 (6%)

Query: 147 LFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEI 206
           L+P GR+   + L+ +   A  +    ++  V    +F+LT RE E L WI++GK++ +I
Sbjct: 154 LYPLGRVGPDENLFRV--TAEDEEGQVRALQV----EFQLTQREAEVLIWIAKGKSNKDI 207

Query: 207 AVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
             IL +S  TVN ++  I  K   + R+ A   A 
Sbjct: 208 GEILNLSPRTVNKHLEQIFVKLGVENRASAAVRAA 242


>gi|209548400|ref|YP_002280317.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534156|gb|ACI54091.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 240

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 39/65 (60%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           K  E T  E++CL   + G+   EIA +L ++ N VNN+I S ++K    TR+ A+  A+
Sbjct: 174 KPIEFTRNELDCLRLTAGGRKGAEIAKLLDLTENAVNNHIGSAIKKLGCTTRTQAVVSAL 233

Query: 242 RNNIV 246
           R NI+
Sbjct: 234 RLNIL 238


>gi|157145292|ref|YP_001452611.1| DNA-binding transcriptional activator SdiA [Citrobacter koseri ATCC
           BAA-895]
 gi|157082497|gb|ABV12175.1| hypothetical protein CKO_01029 [Citrobacter koseri ATCC BAA-895]
          Length = 240

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 177 EMRFSKREKEILKWTAEGKTSSEIAMILSISENTVNFHQKNMQKKFNAPNKTQIACYAAA 236

Query: 243 NNIV 246
             ++
Sbjct: 237 TGLI 240


>gi|148655770|ref|YP_001275975.1| two component LuxR family transcriptional regulator [Roseiflexus
           sp. RS-1]
 gi|148567880|gb|ABQ90025.1| two component transcriptional regulator, LuxR family [Roseiflexus
           sp. RS-1]
          Length = 254

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 38/57 (66%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE+E L  I+ G ++ EIA  L IS  TV N+I+SI+RK +   R+ A+ YA+R
Sbjct: 173 LSDREIEVLERIAAGGSNREIAEALHISTQTVKNHISSILRKLSLNDRTQAVLYALR 229


>gi|325971781|ref|YP_004247972.1| LuxR family transcriptional regulator [Spirochaeta sp. Buddy]
 gi|324027019|gb|ADY13778.1| transcriptional regulator, LuxR family [Spirochaeta sp. Buddy]
          Length = 295

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 44/67 (65%), Gaps = 2/67 (2%)

Query: 169 QANMFKSYDVHWG--KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMR 226
           +A + KS ++  G  +++ +T RE   +  IS+G T+ EIA  LGIS NTVNN++A+I  
Sbjct: 218 RAEVVKSKELVLGDLEEYHITEREFAVIQLISKGLTNKEIASQLGISANTVNNHVANIYG 277

Query: 227 KTATKTR 233
           KT  ++R
Sbjct: 278 KTQVRSR 284


>gi|323488502|ref|ZP_08093746.1| DNA-binding response regulator [Planococcus donghaensis MPA1U2]
 gi|323397719|gb|EGA90521.1| DNA-binding response regulator [Planococcus donghaensis MPA1U2]
          Length = 211

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +D  LT RE+E L  + EG ++ +IA  L IS  TV  ++++I +K   K+RS AI +AV
Sbjct: 144 EDKTLTPREMEVLLVLVEGLSNKDIATRLYISDKTVKIHVSNIFKKFDVKSRSQAIIFAV 203

Query: 242 RNNIV 246
           +NN+V
Sbjct: 204 QNNLV 208


>gi|258592172|emb|CBE68481.1| protein of unknown function [NC10 bacterium 'Dutch sediment']
          Length = 367

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 33/52 (63%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           +LT RE E L W++ GKT+ E+A ILG+S  TV  ++  I +K   +TR  A
Sbjct: 304 DLTRREAEVLLWVAHGKTNVEVAEILGLSSRTVQKHLEHIFKKLGVETRVAA 355


>gi|320184745|gb|EFW59537.1| DNA-binding transcriptional activator SdiA [Shigella flexneri CDC
           796-83]
          Length = 159

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 96  EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 155

Query: 243 NNIV 246
             ++
Sbjct: 156 TGLI 159


>gi|213857580|ref|ZP_03384551.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
          Length = 99

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           D+    +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++  
Sbjct: 30  DMVMAPEMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQI 89

Query: 237 IAYAVRNNIV 246
             YA    ++
Sbjct: 90  ACYAAATGLI 99


>gi|332981237|ref|YP_004462678.1| LuxR family two component transcriptional regulator [Mahella
           australiensis 50-1 BON]
 gi|332698915|gb|AEE95856.1| two component transcriptional regulator, LuxR family [Mahella
           australiensis 50-1 BON]
          Length = 217

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (57%)

Query: 164 LLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           +L   QA+    ++V    D +LT RE E L  +++G ++ EIA  L IS  TV N+++S
Sbjct: 135 VLKEDQASPLYGFNVGIRYDDDLTQREREVLALVAKGLSNGEIAKKLFISEKTVKNHLSS 194

Query: 224 IMRKTATKTRSGAIAYAVRN 243
           I RK     R+ A  YA+++
Sbjct: 195 IFRKLNVSDRTQAAVYAIKH 214


>gi|228985616|ref|ZP_04145769.1| DNA-binding response regulator [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228774011|gb|EEM22424.1| DNA-binding response regulator [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 73

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 29/62 (46%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN 
Sbjct: 9   ELTEREKEILFELVKGLSNKEIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQ 68

Query: 245 IV 246
           +V
Sbjct: 69  LV 70


>gi|222106725|ref|YP_002547516.1| DNA-binding HTH domain-containing protein [Agrobacterium vitis S4]
 gi|221737904|gb|ACM38800.1| DNA-binding HTH domain-containing protein [Agrobacterium vitis S4]
          Length = 307

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           L+ RE E + W+S+GK+S EIA ILGIS  +V  Y+ S+ RK     R+ A+  A+
Sbjct: 226 LSAREKETVIWVSKGKSSWEIAKILGISEKSVEFYMESVKRKLEAVNRTQAVVKAI 281


>gi|161502928|ref|YP_001570040.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160864275|gb|ABX20898.1| hypothetical protein SARI_00987 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 251

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 188 EMRFSKREKEILKWTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAA 247

Query: 243 NNIV 246
             ++
Sbjct: 248 TGLI 251


>gi|329851246|ref|ZP_08266003.1| bacterial regulatory protein, luxR family protein [Asticcacaulis
           biprosthecum C19]
 gi|328840092|gb|EGF89664.1| bacterial regulatory protein, luxR family protein [Asticcacaulis
           biprosthecum C19]
          Length = 247

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 38/67 (56%)

Query: 180 WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           + +   LT  E  CL   S G TS+EI   + ++  TVN+Y+  I RK   + RS AIA 
Sbjct: 180 FNQQIGLTAGETTCLELASRGMTSEEIGAQMDLTTETVNSYMKLITRKLGARNRSQAIAD 239

Query: 240 AVRNNIV 246
           A+R N++
Sbjct: 240 ALRLNLI 246


>gi|121608696|ref|YP_996503.1| response regulator receiver protein [Verminephrobacter eiseniae
           EF01-2]
 gi|121553336|gb|ABM57485.1| two component transcriptional regulator, LuxR family
           [Verminephrobacter eiseniae EF01-2]
          Length = 361

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G  F+LT RE E L W+ +GK + +I  ILG S  TV  ++  +  K   +TR+ A A A
Sbjct: 289 GLAFKLTAREAEVLYWVVQGKINRDIGAILGASPATVKKHLERVFAKLGVETRTAAAAMA 348

Query: 241 V 241
           +
Sbjct: 349 L 349


>gi|38230165|gb|AAR14179.1| AHL receptor-like protein [uncultured bacterium]
          Length = 73

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 29/45 (64%)

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           CL W SEGKTS EIA ILGI+  TVN ++  + R T +  R  AI
Sbjct: 29  CLFWASEGKTSGEIACILGITERTVNYHLNQVTRXTGSMNRYQAI 73


>gi|269962779|ref|ZP_06177120.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269832469|gb|EEZ86587.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 218

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 45/79 (56%)

Query: 165 LAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASI 224
           L  Y      +Y +   ++ ELT REV+ L  + +G ++ EIA  L IS +T+ +++ +I
Sbjct: 139 LLTYYKGKESTYSIEPAEEVELTRREVQVLQMLKDGGSNMEIADSLFISEHTIKSHLYNI 198

Query: 225 MRKTATKTRSGAIAYAVRN 243
            RK   K R+ A ++A RN
Sbjct: 199 FRKIEVKNRTQATSWAKRN 217


>gi|240145753|ref|ZP_04744354.1| nitrate/nitrite response regulator protein NarL [Roseburia
           intestinalis L1-82]
 gi|257202169|gb|EEV00454.1| nitrate/nitrite response regulator protein NarL [Roseburia
           intestinalis L1-82]
 gi|291536999|emb|CBL10111.1| Response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Roseburia intestinalis M50/1]
          Length = 213

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  +S G  + EIA  L IS  TV N++++I +K     R+ A  +A+RNN+
Sbjct: 151 LTRRELEVLKMLSYGTYNKEIAEHLNISERTVKNHVSNIFKKIGVTDRTQAAVFAIRNNL 210

Query: 246 V 246
           +
Sbjct: 211 I 211


>gi|182412626|ref|YP_001817692.1| two component LuxR family transcriptional regulator [Opitutus
           terrae PB90-1]
 gi|177839840|gb|ACB74092.1| two component transcriptional regulator, LuxR family [Opitutus
           terrae PB90-1]
          Length = 204

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 35/56 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT RE E L W+++GKT+ EIA ILGI   TV  ++ ++  K   + R+ A A A+
Sbjct: 145 LTPREAEILFWVAQGKTNPEIATILGIGLTTVKKHLEAVFVKLGVENRTSAAALAL 200


>gi|241206852|ref|YP_002977948.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860742|gb|ACS58409.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 251

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 40/64 (62%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  LT RE+E L +++EG TS EI+ +L IS +TV+ Y+  +  K   K R  A+A A R
Sbjct: 187 DTPLTRREMEILHYLAEGMTSMEISKMLKISNHTVDWYMNGLQDKLKAKNRQHAVALAFR 246

Query: 243 NNIV 246
           + ++
Sbjct: 247 HGLI 250


>gi|326793450|ref|YP_004311270.1| LuxR family transcriptional regulator [Marinomonas mediterranea
           MMB-1]
 gi|326544214|gb|ADZ89434.1| two component transcriptional regulator, LuxR family [Marinomonas
           mediterranea MMB-1]
          Length = 306

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +  LT RE E L WI+ GKT+ EIA IL +S  TVN ++  I  K   + R+ A   A+R
Sbjct: 242 ELNLTDRESEVLRWIANGKTNREIAEILEMSPRTVNKHLEQIFPKLGVENRTAAAGVALR 301


>gi|291570906|dbj|BAI93178.1| two-component response regulator [Arthrospira platensis NIES-39]
          Length = 222

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 102/213 (47%), Gaps = 25/213 (11%)

Query: 51  ALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFC 110
           ++++Y+  S ++++     QE     +V    P  +V  +A+ E D +  V +  ++   
Sbjct: 17  SISDYLEMSGYMVISATNGQEAL--ELVEKHQPHLIVTDIAMPEMDGFELVKRVRSQ--- 71

Query: 111 PVFHTLP-----------ENITP-PAGMDNRYCSLTFDVARIRIGLMLLFPKGRIIL--- 155
           P+F  LP           E I     G DN Y    F++  + + +  L  + ++I    
Sbjct: 72  PIFRLLPVIFLTAHTSTEERIRGYQLGCDN-YLPKPFELEELGVVIRSLLERSQLIEAEW 130

Query: 156 RDRLWEIGLLAAYQANMFKSYDVHW--GKDFELTGREVECLTWISEGKTSDEIAVILGIS 213
           R R+ E   L+ + ++  K +  H     +  LT RE + L  ++EG ++ +I   L +S
Sbjct: 131 RSRINEP--LSNHTSSSHKRHHFHSFSTTNIHLTEREQQVLNLLTEGLSNIKIGDSLHLS 188

Query: 214 RNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
             TV  Y++S++RKT +  R+  + +A+ N+++
Sbjct: 189 SRTVEKYVSSLLRKTDSSNRAELVRFALENDLI 221


>gi|119717534|ref|YP_924499.1| regulatory protein, LuxR [Nocardioides sp. JS614]
 gi|119538195|gb|ABL82812.1| regulatory protein, LuxR [Nocardioides sp. JS614]
          Length = 512

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REVE L  I+ G  ++E+A  LG+SR T   +I  I  KT   +RS A  +A+RN +
Sbjct: 447 LTQREVEVLVLIARGVATNEVAARLGVSRKTAATHIERIYAKTGACSRSTATLFALRNGL 506

Query: 246 V 246
           +
Sbjct: 507 L 507


>gi|114799307|ref|YP_759854.1| LuxR family transcriptional regulator [Hyphomonas neptunium ATCC
           15444]
 gi|114739481|gb|ABI77606.1| transcriptional regulator, LuxR family [Hyphomonas neptunium ATCC
           15444]
          Length = 254

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 40/77 (51%), Gaps = 3/77 (3%)

Query: 164 LLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
            L+AY+  +  S D       E T RE++CL W + GKT  EIA I+G+S  T+  ++ +
Sbjct: 169 FLSAYKDAVLPSADPEM---VEFTRREIQCLKWAAAGKTDSEIATIMGVSAPTIRFHMTN 225

Query: 224 IMRKTATKTRSGAIAYA 240
             RK     RS  I  A
Sbjct: 226 ASRKLGVSGRSQTIRLA 242


>gi|15964581|ref|NP_384934.1| putative transcription regulator protein [Sinorhizobium meliloti
           1021]
 gi|307309327|ref|ZP_07588990.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
 gi|307320063|ref|ZP_07599484.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|15073759|emb|CAC45400.1| Putative transcriptional regulator [Sinorhizobium meliloti 1021]
 gi|306894278|gb|EFN25043.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306900196|gb|EFN30814.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
          Length = 246

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+ECL W + GKT+ E+A I+ +S  TVN+Y+    RK  +  R   +A A+R  +
Sbjct: 185 LSRREIECLRWAAAGKTTVEMARIMALSEYTVNHYLNRATRKLDSVNRVQTVAKAIRAGL 244

Query: 246 V 246
           +
Sbjct: 245 I 245


>gi|134291173|ref|YP_001114942.1| response regulator receiver protein [Burkholderia vietnamiensis G4]
 gi|134134362|gb|ABO58687.1| transcriptional regulator, LuxR family [Burkholderia vietnamiensis
           G4]
          Length = 260

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 38/62 (61%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H  +  +L+ R+ +CL+W+++GKTS +I +IL ISR+TV  +I   MR     +R  A  
Sbjct: 192 HPNEFIQLSPRQRQCLSWVAQGKTSSDICMILKISRHTVEYHITEAMRVLNVNSRIAAAV 251

Query: 239 YA 240
            A
Sbjct: 252 IA 253


>gi|332096683|gb|EGJ01674.1| regulatory protein sdiA [Shigella boydii 3594-74]
          Length = 147

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 84  EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 143

Query: 243 NNIV 246
             ++
Sbjct: 144 TGLI 147


>gi|83716740|ref|YP_439002.1| LuxR family transcriptional regulator [Burkholderia thailandensis
           E264]
 gi|167577397|ref|ZP_02370271.1| transcriptional regulator, LuxR family protein [Burkholderia
           thailandensis TXDOH]
 gi|167615548|ref|ZP_02384183.1| transcriptional regulator, LuxR family protein [Burkholderia
           thailandensis Bt4]
 gi|257142109|ref|ZP_05590371.1| LuxR family transcriptional regulator [Burkholderia thailandensis
           E264]
 gi|83650565|gb|ABC34629.1| transcriptional regulator, LuxR family [Burkholderia thailandensis
           E264]
          Length = 230

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            LT RE  CLTW++ GK+S  IA +L IS+ TV+ +I + M K  T++R+ A   A R  
Sbjct: 167 HLTDREQMCLTWVARGKSSWVIANMLDISKYTVDFHIENAMEKLNTRSRTFAAVKATRQG 226

Query: 245 IV 246
           ++
Sbjct: 227 LI 228


>gi|311032412|ref|ZP_07710502.1| two-component response regulator-like protein [Bacillus sp. m3-13]
          Length = 210

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 4/73 (5%)

Query: 173 FKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKT 232
           F S ++H     ELT RE+E L  I++GK++ EIA  L I+  TV  ++++I+ K     
Sbjct: 141 FGSTNLHE----ELTKRELEVLAEIAKGKSNKEIASSLFITEKTVKTHVSNILAKLEVAD 196

Query: 233 RSGAIAYAVRNNI 245
           R+ A  YAV++ I
Sbjct: 197 RTQAALYAVKHGI 209


>gi|297153818|gb|ADI03530.1| two-component system response regulator [Streptomyces
           bingchenggensis BCW-1]
          Length = 219

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 45/83 (54%), Gaps = 2/83 (2%)

Query: 164 LLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           L+  Y A +  + D    +D  LT RE+E L  I++G ++ EIA  L IS  TV  +++ 
Sbjct: 138 LVGTYVARIRPAEDTS--RDIPLTPRELEVLRLIADGFSNSEIAAALQISPETVKTFVSR 195

Query: 224 IMRKTATKTRSGAIAYAVRNNIV 246
           I+ K   + R  A+ YA R  +V
Sbjct: 196 ILTKLDLRDRVQAVVYAYRQGLV 218


>gi|239908483|ref|YP_002955225.1| LuxR family transcriptional regulator [Desulfovibrio magneticus
           RS-1]
 gi|239798350|dbj|BAH77339.1| LuxR family transcriptional regulator [Desulfovibrio magneticus
           RS-1]
          Length = 257

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+GRE E L+W+  GK+S +I+ IL IS  TVN +I +I++K   + R  A+A A    I
Sbjct: 194 LSGREREVLSWLKHGKSSWDISTILQISECTVNYHIYNIIKKLDVQNRPQAVAVATHLGI 253

Query: 246 V 246
           +
Sbjct: 254 L 254


>gi|82701372|ref|YP_410938.1| LuxR family transcriptional regulator [Nitrosospira multiformis
           ATCC 25196]
 gi|82409437|gb|ABB73546.1| transcriptional regulator, LuxR family [Nitrosospira multiformis
           ATCC 25196]
          Length = 267

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (58%), Gaps = 5/63 (7%)

Query: 176 YDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSG 235
           YD+H      L+ REVE +TW+ +GKT+ EI  IL IS  TV N++  I RK     R  
Sbjct: 201 YDLHG-----LSEREVEIMTWVRKGKTNAEIGSILRISSYTVKNHLHQIFRKLDVYNRVQ 255

Query: 236 AIA 238
           AI+
Sbjct: 256 AIS 258


>gi|222350143|emb|CAX32456.1| LuxR-type regulator [Rhizobium leguminosarum]
          Length = 251

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 40/64 (62%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  LT RE+E L +++EG TS EI+ +L IS +TV+ Y+  +  K   K R  A+A A R
Sbjct: 187 DTPLTRREMEILHYLAEGMTSMEISKMLKISNHTVDWYMNGLQDKLKAKNRQQAVALAFR 246

Query: 243 NNIV 246
           + ++
Sbjct: 247 HGLI 250


>gi|302878668|ref|YP_003847232.1| transcriptional regulator, LuxR family [Gallionella
           capsiferriformans ES-2]
 gi|302581457|gb|ADL55468.1| transcriptional regulator, LuxR family [Gallionella
           capsiferriformans ES-2]
          Length = 243

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +T RE+ECL W + GK+S EI  IL  +  TVN + ++I RK +T +R  AI  A+
Sbjct: 180 VTHRELECLKWSASGKSSWEIGHILNCTEATVNFHFSNIRRKFSTTSRQQAIVKAI 235


>gi|217978159|ref|YP_002362306.1| two component transcriptional regulator, LuxR family [Methylocella
           silvestris BL2]
 gi|217503535|gb|ACK50944.1| two component transcriptional regulator, LuxR family [Methylocella
           silvestris BL2]
          Length = 306

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           LT RE E L W++ GK++ +I+ IL IS  TVN ++  I RK   + R+ A   AV+ 
Sbjct: 244 LTSREAEVLVWLAAGKSNRDISAILSISPRTVNKHLEQIFRKLGVENRAAAAVMAVQT 301


>gi|329114860|ref|ZP_08243616.1| Transcriptional regulatory protein YvrH [Acetobacter pomorum DM001]
 gi|326695757|gb|EGE47442.1| Transcriptional regulatory protein YvrH [Acetobacter pomorum DM001]
          Length = 299

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 35/61 (57%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           K   LT RE E L WIS+GKT+ +IA IL IS  TVN ++     K   + R+ A A  +
Sbjct: 235 KRLNLTAREAEVLFWISKGKTNRDIAEILSISHRTVNKHLEQAYVKIGVENRASATARVL 294

Query: 242 R 242
           +
Sbjct: 295 Q 295


>gi|319943176|ref|ZP_08017459.1| autoinducer-binding transcriptional regulator [Lautropia mirabilis
           ATCC 51599]
 gi|319743718|gb|EFV96122.1| autoinducer-binding transcriptional regulator [Lautropia mirabilis
           ATCC 51599]
          Length = 237

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 38/57 (66%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
            LT RE+E L W ++GK+S +IA IL +S+NTV+ +I + ++K     ++ A+  AV
Sbjct: 175 HLTSREIEVLKWTADGKSSQDIADILTLSKNTVDFHIKNTVQKLNVPNKTAAVVQAV 231


>gi|229163761|ref|ZP_04291706.1| DNA-binding response regulator [Bacillus cereus R309803]
 gi|228619728|gb|EEK76609.1| DNA-binding response regulator [Bacillus cereus R309803]
          Length = 186

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA  L IS  TV  +I  I RK   K+RS A+ YAVRN 
Sbjct: 122 ELTEREKEILFELVKGLSNKEIAEALYISDKTVKIHINKIFRKLNVKSRSQAVIYAVRNQ 181

Query: 245 IV 246
           +V
Sbjct: 182 LV 183


>gi|315182540|gb|ADT89453.1| Transcriptional activator protein vanR [Vibrio furnissii NCTC
           11218]
          Length = 240

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 35/57 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           ELT RE +CLTW +EGK++ EIA I+  S  TV  +IA+  +K     R  AI  A+
Sbjct: 175 ELTARENQCLTWAAEGKSAWEIAKIIDTSERTVKFHIANACKKLGATNRYQAITKAI 231


>gi|283785661|ref|YP_003365526.1| regulatory protein [Citrobacter rodentium ICC168]
 gi|282949115|emb|CBG88722.1| regulatory protein [Citrobacter rodentium ICC168]
          Length = 240

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (54%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
             +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA
Sbjct: 175 APEMRFSKREKEILKWTAEGKTSYEIAMILSISENTVNFHQKNMQKKFNAPNKTQVACYA 234

Query: 241 VRNNIV 246
               ++
Sbjct: 235 AATGLI 240


>gi|311067149|ref|YP_003972072.1| DNA-binding response regulator, luxR family protein [Bacillus
           atrophaeus 1942]
 gi|310867666|gb|ADP31141.1| DNA-binding response regulator, luxR family protein [Bacillus
           atrophaeus 1942]
          Length = 200

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT +E+E LT I+E KT+ EI+  L IS+ TV  YI+SI++K    +R GA+   ++  +
Sbjct: 138 LTHKELEVLTLIAEDKTNMEISTELMISKRTVERYISSIIQKMKANSRVGAVVNGIKQGL 197

Query: 246 V 246
           +
Sbjct: 198 L 198


>gi|94314242|ref|YP_587451.1| transcriptional regulator two component heavy metal regulatory
           response ZniR [Cupriavidus metallidurans CH34]
 gi|93358094|gb|ABF12182.1| transcriptional regulator two component heavy metal regulatory
           response ZniR [Cupriavidus metallidurans CH34]
          Length = 206

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (56%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           ++  L+ RE+E L+W + GKTS EIA ILG+S+ TV+ +I     K    TR  A+  A 
Sbjct: 140 QNVTLSEREIEALSWSARGKTSGEIATILGLSKRTVDFHIDRAREKLGVATRVEAVVRAA 199

Query: 242 RNNIV 246
               +
Sbjct: 200 TEGFI 204


>gi|260770016|ref|ZP_05878949.1| transcriptional activator protein vanR [Vibrio furnissii CIP
           102972]
 gi|260615354|gb|EEX40540.1| transcriptional activator protein vanR [Vibrio furnissii CIP
           102972]
          Length = 240

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 35/57 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           ELT RE +CLTW +EGK++ EIA I+  S  TV  +IA+  +K     R  AI  A+
Sbjct: 175 ELTARENQCLTWAAEGKSAWEIAKIIDTSERTVKFHIANACKKLGATNRYQAITKAI 231


>gi|95108205|emb|CAD17929.2| probable transcriptional activator of quorum sensing autoinducer
           synthesis transcription regulator protein [Ralstonia
           solanacearum GMI1000]
          Length = 238

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 40/65 (61%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           DV    D  LT REVE + W ++GK++ +IA IL IS+NTV+ ++ + ++K     ++ A
Sbjct: 168 DVAGYSDDNLTNREVEVMKWTADGKSAQDIADILAISKNTVDFHVKNAVKKLHAVNKTAA 227

Query: 237 IAYAV 241
           +  A 
Sbjct: 228 VVRAA 232


>gi|134287657|ref|YP_001109823.1| two component LuxR family transcriptional regulator [Burkholderia
           vietnamiensis G4]
 gi|134132307|gb|ABO60042.1| two component transcriptional regulator, LuxR family [Burkholderia
           vietnamiensis G4]
          Length = 312

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           F LT RE E L W+S GKT+ +I  ILGI+  TVN ++  + RK   +TR
Sbjct: 249 FGLTMREAEVLLWVSHGKTNRDIGDILGIAARTVNKHLEHLFRKLHVETR 298


>gi|163848961|ref|YP_001637005.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222526915|ref|YP_002571386.1| LuxR family two component transcriptional regulator [Chloroflexus
           sp. Y-400-fl]
 gi|163670250|gb|ABY36616.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222450794|gb|ACM55060.1| two component transcriptional regulator, LuxR family [Chloroflexus
           sp. Y-400-fl]
          Length = 209

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  ++EG T+ EIA  L +S  TV  ++ASI+RK     R+ A  YA+R+ +
Sbjct: 148 LTEREREVLKLVAEGLTNAEIASRLTVSEETVKTHVASILRKLGLAHRTQAAIYALRHGL 207

Query: 246 V 246
           V
Sbjct: 208 V 208


>gi|110680752|ref|YP_683759.1| two-component response regulator, putative [Roseobacter
           denitrificans OCh 114]
 gi|109456868|gb|ABG33073.1| two-component response regulator, putative [Roseobacter
           denitrificans OCh 114]
          Length = 304

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 61/136 (44%), Gaps = 17/136 (12%)

Query: 108 LFCPVFHT-LPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLA 166
           L  PVF + L   I  P     R+    F +  +  G     P G ++L+          
Sbjct: 180 LGGPVFKSWLDSCIQLPTSQTRRFSCEDFTLDFLGGG-----PSGELLLQ---------I 225

Query: 167 AYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMR 226
           A  +NM  S   +    F+LT RE E L W+S GKT+ +IA IL +S  T+N ++  + +
Sbjct: 226 ARTSNMRPS--TYLETAFDLTPREAEVLYWLSMGKTNRDIAQILSLSSRTINKHLEQVFQ 283

Query: 227 KTATKTRSGAIAYAVR 242
           K     R+ A   A R
Sbjct: 284 KMGVDNRTAAAVAADR 299


>gi|148273853|ref|YP_001223414.1| putative two-component system response regulator [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
 gi|147831783|emb|CAN02752.1| putative two-component system response regulator [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
          Length = 222

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 39/61 (63%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           GK   +T RE E L  I++GK++ E+A +  +S NTV +YI SI RK   ++R+ A+ + 
Sbjct: 144 GKREGITDRESEILALITQGKSNQEVAALTYLSPNTVKSYIRSIYRKIQVQSRTQAVIWG 203

Query: 241 V 241
           V
Sbjct: 204 V 204


>gi|150395665|ref|YP_001326132.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
 gi|150027180|gb|ABR59297.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
          Length = 246

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+ECL W + GKT+ E+A I+ +S  TVN+Y+    RK  +  R   +A A+R  +
Sbjct: 185 LSRREIECLRWAAAGKTTVEMARIMALSEYTVNHYLNRATRKLDSVNRVQTVAKAIRAGL 244

Query: 246 V 246
           +
Sbjct: 245 I 245


>gi|107026084|ref|YP_623595.1| two component LuxR family transcriptional regulator [Burkholderia
           cenocepacia AU 1054]
 gi|116692732|ref|YP_838265.1| two component LuxR family transcriptional regulator [Burkholderia
           cenocepacia HI2424]
 gi|105895458|gb|ABF78622.1| two component transcriptional regulator, LuxR family [Burkholderia
           cenocepacia AU 1054]
 gi|116650732|gb|ABK11372.1| two component transcriptional regulator, LuxR family [Burkholderia
           cenocepacia HI2424]
          Length = 312

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           F LT RE E L W+S GKT+ +I  ILGI+  TVN ++  + RK   +TR
Sbjct: 249 FGLTMREAEVLLWVSHGKTNRDIGDILGIAARTVNKHLEHLFRKLHVETR 298


>gi|17548999|ref|NP_522339.1| transcriptional activator of quorum sensing autoinducer synthesis
           transcription regulator protein [Ralstonia solanacearum
           GMI1000]
          Length = 248

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 40/65 (61%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           DV    D  LT REVE + W ++GK++ +IA IL IS+NTV+ ++ + ++K     ++ A
Sbjct: 178 DVAGYSDDNLTNREVEVMKWTADGKSAQDIADILAISKNTVDFHVKNAVKKLHAVNKTAA 237

Query: 237 IAYAV 241
           +  A 
Sbjct: 238 VVRAA 242


>gi|229087315|ref|ZP_04219457.1| DNA-binding response regulator [Bacillus cereus Rock3-44]
 gi|228696017|gb|EEL48860.1| DNA-binding response regulator [Bacillus cereus Rock3-44]
          Length = 186

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA  L IS  TV  +I  I RK   K+RS A+ YAVRN 
Sbjct: 122 ELTEREKEILFELVKGLSNKEIAEALYISDKTVKIHINKIFRKLNVKSRSQAVIYAVRNQ 181

Query: 245 IV 246
           +V
Sbjct: 182 LV 183


>gi|221369733|ref|YP_002520829.1| Response regulator receiver protein [Rhodobacter sphaeroides KD131]
 gi|221162785|gb|ACM03756.1| Response regulator receiver protein [Rhodobacter sphaeroides KD131]
          Length = 212

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 38/54 (70%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           +L+ R++E L WI+ GK++ EIA+ILG+SR  V  +++ I++K    +R+ A+ 
Sbjct: 154 QLSPRQIEILDWIAHGKSNSEIALILGLSRRNVTYHVSEILKKLDVTSRTQAVG 207


>gi|297159285|gb|ADI08997.1| two component LuxR family transcriptional regulator [Streptomyces
           bingchenggensis BCW-1]
          Length = 228

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E LT ++ GK++ EIA  L I + TV  Y++ I+ K    +R+ A  YAV++ 
Sbjct: 146 QLTEREAEVLTMLARGKSNKEIARDLRIGQQTVKTYVSHILTKLGVHSRTQAAVYAVQSG 205

Query: 245 IV 246
           +V
Sbjct: 206 LV 207


>gi|166362770|ref|YP_001655043.1| two component transcriptional regulator [Microcystis aeruginosa
           NIES-843]
 gi|159027464|emb|CAO89429.1| ycf29 [Microcystis aeruginosa PCC 7806]
 gi|166085143|dbj|BAF99850.1| two component transcriptional regulator [Microcystis aeruginosa
           NIES-843]
          Length = 218

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 40/64 (62%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           DF+LT RE E L  ++ G ++ EI   L +S  T+  Y++S++RKT T  R+  + +++ 
Sbjct: 154 DFKLTNREREVLEHLARGLSNSEIGQKLHLSSRTIEKYVSSLLRKTTTNNRAELVRFSLE 213

Query: 243 NNIV 246
           + ++
Sbjct: 214 HRLI 217


>gi|167753032|ref|ZP_02425159.1| hypothetical protein ALIPUT_01296 [Alistipes putredinis DSM 17216]
 gi|167659346|gb|EDS03476.1| hypothetical protein ALIPUT_01296 [Alistipes putredinis DSM 17216]
          Length = 216

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 47/83 (56%)

Query: 164 LLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           +L +  + M  +   + G D  L+ RE+E L  +  G ++ EIA  L IS+ TV+ + A+
Sbjct: 131 VLRSLASRMQTAVSGYEGSDERLSTREIEILVCVCRGLSNQEIADELFISKRTVDKHRAN 190

Query: 224 IMRKTATKTRSGAIAYAVRNNIV 246
           I+ KT  K  +  + YAVR+ +V
Sbjct: 191 ILEKTGCKNTASLVVYAVRHGLV 213


>gi|325124101|gb|ADY83624.1| probable transcriptional activator of quorum sensing autoinducer
           synthesis transcription regulator protein [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 238

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT RE E L W +EGKTS EIA ILG++  TVN ++ + M+K     +  A   AV
Sbjct: 178 LTNREKEALRWTAEGKTSAEIAQILGVTERTVNFHLGNSMQKLNVNNKISAAIRAV 233


>gi|229020635|ref|ZP_04177369.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH1273]
 gi|229026848|ref|ZP_04183176.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH1272]
 gi|228734456|gb|EEL85122.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH1272]
 gi|228740659|gb|EEL90923.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH1273]
          Length = 215

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIAAVLVITEKTVKAHVSSILSKLHLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|171320496|ref|ZP_02909525.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MEX-5]
 gi|171094259|gb|EDT39337.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MEX-5]
          Length = 234

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 41/63 (65%), Gaps = 2/63 (3%)

Query: 181 GKDFE--LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           G +F+  LT RE + L W ++GKT+ EI++IL IS +TVN ++ +I+ K  T  +  A+A
Sbjct: 167 GDEFDPTLTQRETDVLKWTADGKTAYEISLILSISESTVNFHVKNIVAKLGTANKVHAVA 226

Query: 239 YAV 241
            A 
Sbjct: 227 KAA 229


>gi|170738018|ref|YP_001779278.1| two component LuxR family transcriptional regulator [Burkholderia
           cenocepacia MC0-3]
 gi|169820206|gb|ACA94788.1| two component transcriptional regulator, LuxR family [Burkholderia
           cenocepacia MC0-3]
          Length = 312

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           F LT RE E L W+S GKT+ +I  ILGI+  TVN ++  + RK   +TR
Sbjct: 249 FGLTMREAEVLLWVSHGKTNRDIGDILGIAARTVNKHLEHLFRKLHVETR 298


>gi|321314657|ref|YP_004206944.1| two-component response regulator YhcY [Bacillus subtilis BSn5]
 gi|320020931|gb|ADV95917.1| two-component response regulator (YhcY) [Bacillus subtilis BSn5]
          Length = 215

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 44/75 (58%)

Query: 171 NMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTAT 230
           +M   +D    K ++LT RE + LT I+ GK++ EIA  L IS  TV  ++++++ K   
Sbjct: 135 HMKNQHDPEKEKYYQLTRREKDVLTEIANGKSNKEIAAALFISEKTVKTHVSNLLAKLEV 194

Query: 231 KTRSGAIAYAVRNNI 245
             R+ A  +AV+ N+
Sbjct: 195 ADRTQAALFAVKYNL 209


>gi|307130193|ref|YP_003882209.1| transcriptional regulator ahyR/asaR family [Dickeya dadantii 3937]
 gi|306527722|gb|ADM97652.1| Transcriptional regulator ahyR/asaR family [Dickeya dadantii 3937]
          Length = 326

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 46/86 (53%), Gaps = 3/86 (3%)

Query: 159 LWEIGLLA-AYQANMFKSYDVHW--GKDFELTGREVECLTWISEGKTSDEIAVILGISRN 215
           L  IGLLA  +Q ++F  +D  W   +   L+ RE ECL W +EG T+ EIA  L  S  
Sbjct: 236 LARIGLLAHTFQEHVFPLFDEAWYHCRHVHLSPREQECLAWSAEGLTAKEIARKLHRSLA 295

Query: 216 TVNNYIASIMRKTATKTRSGAIAYAV 241
           TVN ++ +  RK     R  A+  A+
Sbjct: 296 TVNLHLNNAARKLGASNRVQAVVRAM 321


>gi|297584895|ref|YP_003700675.1| LuxR family two component transcriptional regulator [Bacillus
           selenitireducens MLS10]
 gi|297143352|gb|ADI00110.1| two component transcriptional regulator, LuxR family [Bacillus
           selenitireducens MLS10]
          Length = 219

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EL+ RE E L +I+ G T  EI+  L IS  TV+ Y   +M K  +K +S  + YA+++N
Sbjct: 154 ELSQREQEVLKYIALGYTQKEISTELFISIKTVDTYKKRVMEKIGSKKKSALVRYALKHN 213

Query: 245 IV 246
           I+
Sbjct: 214 II 215


>gi|187922148|ref|YP_001893790.1| LuxR family transcriptional regulator [Burkholderia phytofirmans
           PsJN]
 gi|187713342|gb|ACD14566.1| transcriptional regulator, LuxR family [Burkholderia phytofirmans
           PsJN]
          Length = 206

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT  ++ CLTW++ GKTS EIA ILG S  TV+ +I   M+     +R+ A  YA    I
Sbjct: 144 LTPCQIVCLTWVARGKTSAEIAKILGRSHYTVDYHIGKAMQALNMCSRTAAAVYASVQGI 203

Query: 246 V 246
           +
Sbjct: 204 I 204


>gi|83956361|ref|ZP_00964786.1| autoinducer-binding transcriptional regulator LuxR [Sulfitobacter
           sp. NAS-14.1]
 gi|83839409|gb|EAP78592.1| autoinducer-binding transcriptional regulator LuxR [Sulfitobacter
           sp. NAS-14.1]
          Length = 269

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE + L W + GKT+ E  +ILG++  TV+ Y+ +   K    T++ A+A+AV+  
Sbjct: 206 QLTKREAQVLRWAARGKTAWETGIILGLTEKTVSFYLGNACAKLKVATKTQAVAFAVKER 265

Query: 245 IV 246
           ++
Sbjct: 266 LI 267


>gi|229089048|ref|ZP_04220402.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock3-44]
 gi|228694270|gb|EEL47892.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock3-44]
          Length = 215

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLQLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|212640627|ref|YP_002317147.1| NarL family DNA-binding response regulator [Anoxybacillus
           flavithermus WK1]
 gi|212562107|gb|ACJ35162.1| DNA-binding response regulator, NarL family (REC-HTH domains)
           [Anoxybacillus flavithermus WK1]
          Length = 206

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 47/81 (58%)

Query: 166 AAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIM 225
            AY+   F   DV   ++  LT  E+  L  I++ KT++ I+  L ISR TV +++++I+
Sbjct: 124 GAYEGFAFFPNDVDEEENISLTKMELVILKLIAQDKTNENISHSLNISRRTVEHHVSTII 183

Query: 226 RKTATKTRSGAIAYAVRNNIV 246
           +K    +R GA+  A++  I+
Sbjct: 184 KKLRVDSRVGAVVKAIKEGII 204


>gi|188585286|ref|YP_001916831.1| two component transcriptional regulator, LuxR family
           [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179349973|gb|ACB84243.1| two component transcriptional regulator, LuxR family
           [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 215

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 39/65 (60%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           K+++L+ RE E L  I+ G T+ EIA  L IS  TV  +IA I  K     RS  + YA+
Sbjct: 148 KNYDLSDREKEVLQLIALGYTNKEIAEKLYISIKTVETHIARIKEKLGLNRRSELVRYAM 207

Query: 242 RNNIV 246
           RNNI+
Sbjct: 208 RNNII 212


>gi|293611186|ref|ZP_06693484.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826437|gb|EFF84804.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 238

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT RE E L W +EGKTS EIA ILG++  TVN ++ + M+K     +  A   AV
Sbjct: 178 LTNREKEALRWTAEGKTSAEIAQILGVTERTVNFHLGNSMQKLNVNNKISAAIRAV 233


>gi|70732607|ref|YP_262370.1| ATP-dependent transcription regulator LuxR [Pseudomonas fluorescens
           Pf-5]
 gi|68346906|gb|AAY94512.1| autoinducer-binding transcriptional regulator, LuxR family
           [Pseudomonas fluorescens Pf-5]
          Length = 252

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 36/62 (58%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE ECL W +EG TS EIA  L  S+ T+N ++ S M K   + R  A+  AV   
Sbjct: 189 DLTRRERECLKWAAEGMTSGEIAERLQRSQATINLHLTSAMHKLGARNRVQAVVRAVHYR 248

Query: 245 IV 246
           ++
Sbjct: 249 LL 250


>gi|153831751|ref|ZP_01984418.1| DNA-binding HTH domain-containing protein [Vibrio harveyi HY01]
 gi|148872261|gb|EDL71078.1| DNA-binding HTH domain-containing protein [Vibrio harveyi HY01]
          Length = 214

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 45/77 (58%), Gaps = 4/77 (5%)

Query: 171 NMFKSYDVHW----GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMR 226
           N +K  +VH       + ELT REV+ L  + EG ++ EIA  L IS +T+ +++ +I R
Sbjct: 137 NYYKGKEVHHVVEPAIEVELTRREVQVLQMLKEGGSNMEIADSLFISEHTIKSHLYNIFR 196

Query: 227 KTATKTRSGAIAYAVRN 243
           K   K R+ A ++A RN
Sbjct: 197 KIEVKNRTQATSWAKRN 213


>gi|120612451|ref|YP_972129.1| LuxR family transcriptional regulator [Acidovorax citrulli AAC00-1]
 gi|120590915|gb|ABM34355.1| transcriptional regulator, LuxR family [Acidovorax citrulli
           AAC00-1]
 gi|227167429|gb|ACP19743.1| LuxR-like protein [Acidovorax citrulli]
          Length = 242

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE ECLTW++ GK+S EI  I+ IS +TVN ++ + M K  T +R  A   A    
Sbjct: 178 KLTSREAECLTWVAYGKSSWEIGRIMRISEHTVNFHLKNAMAKFDTASRVTAAVRAANLG 237

Query: 245 IV 246
           ++
Sbjct: 238 LI 239


>gi|126458323|ref|YP_001075604.1| ATP-dependent transcriptional regulator LuxR [Burkholderia
           pseudomallei 1106a]
 gi|134283391|ref|ZP_01770091.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 305]
 gi|167723653|ref|ZP_02406889.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei DM98]
 gi|167819785|ref|ZP_02451465.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 91]
 gi|167849631|ref|ZP_02475139.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei B7210]
 gi|167898230|ref|ZP_02485632.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 7894]
 gi|167906588|ref|ZP_02493793.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei NCTC 13177]
 gi|237510070|ref|ZP_04522785.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei MSHR346]
 gi|242312988|ref|ZP_04812005.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106b]
 gi|254190270|ref|ZP_04896779.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pasteur 52237]
 gi|254193498|ref|ZP_04899932.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei S13]
 gi|254262913|ref|ZP_04953778.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1710a]
 gi|254300529|ref|ZP_04967975.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 406e]
 gi|126232091|gb|ABN95504.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106a]
 gi|134245140|gb|EBA45234.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 305]
 gi|156105358|gb|ABU49178.1| BpsR2 [Burkholderia pseudomallei]
 gi|157810414|gb|EDO87584.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 406e]
 gi|157937947|gb|EDO93617.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pasteur 52237]
 gi|169650251|gb|EDS82944.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei S13]
 gi|235002275|gb|EEP51699.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei MSHR346]
 gi|242136227|gb|EES22630.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106b]
 gi|254213915|gb|EET03300.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1710a]
          Length = 236

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           D +LT RE + L W ++GKT+ EIA+IL IS +TVN ++ +I+ K  +  +  A+A A 
Sbjct: 173 DPDLTRRETDVLKWTADGKTAYEIALILSISESTVNFHVKNIVSKLGSTNKIQAVAKAA 231


>gi|217419193|ref|ZP_03450700.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 576]
 gi|226200253|ref|ZP_03795798.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pakistan 9]
 gi|217398497|gb|EEC38512.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 576]
 gi|225927761|gb|EEH23803.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pakistan 9]
          Length = 236

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           D +LT RE + L W ++GKT+ EIA+IL IS +TVN ++ +I+ K  +  +  A+A A 
Sbjct: 173 DPDLTRRETDVLKWTADGKTAYEIALILSISESTVNFHVKNIVSKLGSTNKIQAVAKAA 231


>gi|254248175|ref|ZP_04941495.1| Response regulator [Burkholderia cenocepacia PC184]
 gi|124874676|gb|EAY64666.1| Response regulator [Burkholderia cenocepacia PC184]
          Length = 347

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           F LT RE E L W+S GKT+ +I  ILGI+  TVN ++  + RK   +TR
Sbjct: 284 FGLTMREAEVLLWVSHGKTNRDIGDILGIAARTVNKHLEHLFRKLHVETR 333


>gi|167577870|ref|ZP_02370744.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis TXDOH]
          Length = 236

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           D +LT RE + L W ++GKT+ EIA+IL IS +TVN ++ +I+ K  +  +  A+A A 
Sbjct: 173 DPDLTRRETDVLKWTADGKTAYEIALILSISESTVNFHVKNIVSKLGSTNKIQAVAKAA 231


>gi|170782950|ref|YP_001711284.1| putative two component response regulator [Clavibacter
           michiganensis subsp. sepedonicus]
 gi|169157520|emb|CAQ02714.1| putative two component response regulator [Clavibacter
           michiganensis subsp. sepedonicus]
          Length = 234

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 39/61 (63%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           GK   +T RE E L  I++GK++ E+A +  +S NTV +YI SI RK   ++R+ A+ + 
Sbjct: 156 GKREGITDRESEILALITQGKSNQEVAALTYLSPNTVKSYIRSIYRKIQVQSRTQAVIWG 215

Query: 241 V 241
           V
Sbjct: 216 V 216


>gi|16077998|ref|NP_388814.1| two-component response regulator YhcY [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221308771|ref|ZP_03590618.1| hypothetical protein Bsubs1_05153 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313094|ref|ZP_03594899.1| hypothetical protein BsubsN3_05089 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318020|ref|ZP_03599314.1| hypothetical protein BsubsJ_05033 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221322294|ref|ZP_03603588.1| hypothetical protein BsubsS_05134 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|81814998|sp|O07528|YHCZ_BACSU RecName: Full=Uncharacterized transcriptional regulatory protein
           yhcZ
 gi|2226141|emb|CAA74433.1| hypothetical protein [Bacillus subtilis subsp. subtilis str. 168]
 gi|2633256|emb|CAB12761.1| two-component response regulator [YhcY] [Bacillus subtilis subsp.
           subtilis str. 168]
          Length = 214

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 44/75 (58%)

Query: 171 NMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTAT 230
           +M   +D    K ++LT RE + LT I+ GK++ EIA  L IS  TV  ++++++ K   
Sbjct: 134 HMKNQHDPEKEKYYQLTRREKDVLTEIANGKSNKEIAAALFISEKTVKTHVSNLLAKLEV 193

Query: 231 KTRSGAIAYAVRNNI 245
             R+ A  +AV+ N+
Sbjct: 194 ADRTQAALFAVKYNL 208


>gi|126464154|ref|YP_001045267.1| response regulator receiver protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|126105965|gb|ABN78495.1| response regulator receiver protein [Rhodobacter sphaeroides ATCC
           17029]
          Length = 238

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 38/54 (70%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           +L+ R++E L WI+ GK++ EIA+ILG+SR  V  +++ I++K    +R+ A+ 
Sbjct: 180 KLSPRQIEILDWIAHGKSNSEIALILGLSRRNVTYHVSEILKKLDVTSRTQAVG 233


>gi|83716885|ref|YP_439427.1| ATP-dependent transcription regulator LuxR [Burkholderia
           thailandensis E264]
 gi|257142551|ref|ZP_05590813.1| ATP-dependent transcription regulator LuxR [Burkholderia
           thailandensis E264]
 gi|83650710|gb|ABC34774.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia thailandensis E264]
          Length = 234

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           D +LT RE + L W ++GKT+ EIA+IL IS +TVN ++ +I+ K  +  +  A+A A 
Sbjct: 171 DPDLTRRETDVLKWTADGKTAYEIALILSISESTVNFHVKNIVSKLGSTNKIQAVAKAA 229


>gi|77465673|ref|YP_355176.1| LuxR family transcriptional regulator [Rhodobacter sphaeroides
           2.4.1]
 gi|77390091|gb|ABA81275.1| transcriptional regulator, LuxR family [Rhodobacter sphaeroides
           2.4.1]
          Length = 238

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 38/54 (70%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           +L+ R++E L WI+ GK++ EIA+ILG+SR  V  +++ I++K    +R+ A+ 
Sbjct: 180 KLSPRQIEILDWIAHGKSNSEIALILGLSRRNVTYHVSEILKKLDVTSRTQAVG 233


>gi|15889561|ref|NP_355242.1| LuxR family transcriptional regulator [Agrobacterium tumefaciens
           str. C58]
 gi|15157444|gb|AAK88027.1| transcriptional regulator, LuxR family [Agrobacterium tumefaciens
           str. C58]
          Length = 238

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 37/57 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           LT RE++ + W ++GKTS EIA +L IS +TVN Y+ + MRK     R+  +A  +R
Sbjct: 177 LTKRELDVVRWTAQGKTSVEIAELLSISEHTVNTYMNNAMRKLDCVNRTQLVAKTIR 233


>gi|53722204|ref|YP_111189.1| N-acyl-homoserine lactone dependent regulatory protein
           [Burkholderia pseudomallei K96243]
 gi|76817623|ref|YP_335301.1| N-acyl-homoserine lactone dependent regulatory protein
           [Burkholderia pseudomallei 1710b]
 gi|126444655|ref|YP_001062648.1| ATP-dependent transcriptional regulator LuxR [Burkholderia
           pseudomallei 668]
 gi|52212618|emb|CAH38644.1| N-acyl-homoserine lactone dependent regulatory protein
           [Burkholderia pseudomallei K96243]
 gi|76582096|gb|ABA51570.1| N-acyl-homoserine lactone dependent regulatory protein
           [Burkholderia pseudomallei 1710b]
 gi|126224146|gb|ABN87651.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 668]
          Length = 234

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           D +LT RE + L W ++GKT+ EIA+IL IS +TVN ++ +I+ K  +  +  A+A A 
Sbjct: 171 DPDLTRRETDVLKWTADGKTAYEIALILSISESTVNFHVKNIVSKLGSTNKIQAVAKAA 229


>gi|227821018|ref|YP_002824988.1| putative LuxR/GerE family transcriptional regulator [Sinorhizobium
           fredii NGR234]
 gi|227340017|gb|ACP24235.1| putative LuxR/GerE family transcriptional regulator [Sinorhizobium
           fredii NGR234]
          Length = 246

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+ECL W + GKT+ E+A I+ +S  TVN+Y+    RK  +  R   +A A+R  +
Sbjct: 185 LSRREIECLRWAAAGKTTVEMARIMALSEYTVNHYLNRATRKLDSVNRVQTVAKAMRAGL 244

Query: 246 V 246
           +
Sbjct: 245 I 245


>gi|291483400|dbj|BAI84475.1| hypothetical protein BSNT_01607 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 215

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 44/75 (58%)

Query: 171 NMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTAT 230
           +M   +D    K ++LT RE + LT I+ GK++ EIA  L IS  TV  ++++++ K   
Sbjct: 135 HMKNQHDPEKEKYYQLTRREKDVLTEIANGKSNKEIAAALFISEKTVKTHVSNLLAKLEV 194

Query: 231 KTRSGAIAYAVRNNI 245
             R+ A  +AV+ N+
Sbjct: 195 ADRTQAALFAVKYNL 209


>gi|167566223|ref|ZP_02359139.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           oklahomensis EO147]
 gi|167573334|ref|ZP_02366208.1| autoinducer-binding transcriptional regulator BmpR [Burkholderia
           oklahomensis C6786]
          Length = 230

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            LT RE  CLTW++ GK+S  IA +L IS+ TV+ +I + M K  T++R+ A   A R  
Sbjct: 167 HLTDREQICLTWVARGKSSWVIANMLDISKYTVDFHIENAMEKLNTRSRTFAAVKATRQG 226

Query: 245 IV 246
           ++
Sbjct: 227 LI 228


>gi|27382417|ref|NP_773946.1| two-component response regulator [Bradyrhizobium japonicum USDA
           110]
 gi|27355588|dbj|BAC52571.1| two-component response regulator [Bradyrhizobium japonicum USDA
           110]
          Length = 211

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 73/175 (41%), Gaps = 10/175 (5%)

Query: 72  QKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYC 131
           + +  IV  D+   L+  + +S + K  ++    TE+     H   E ++       R  
Sbjct: 45  ETMSDIVIVDYSMPLMNGLEVSRRLKALDL---RTEVLILTMHEDEELLSEAVLAGVRGF 101

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREV 191
               D  +  I  +     GR      L E  LL  YQ N       H   D  LT RE 
Sbjct: 102 LFKSDAKKHLISAIEALLDGRPYFTSALVE-KLLHDYQLNK------HGRSDMLLTSREQ 154

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
             +  I+EG T+  ++VIL +S  TV  + AS MRK    + +  + YA+R  +V
Sbjct: 155 SVVQLIAEGHTNRSMSVILKLSVKTVETHRASAMRKLGMSSTAELVRYAIRKKLV 209


>gi|299069138|emb|CBJ40391.1| transcriptional activator of quorum sensing autoinducer synthesis
           transcription regulator protein (LuxR family) [Ralstonia
           solanacearum CMR15]
          Length = 238

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           D  LT REVE + W ++GK++ +IA IL IS+NTV+ ++ + ++K     ++ A+  A 
Sbjct: 174 DDSLTNREVEVMKWTADGKSAQDIADILAISKNTVDFHVKNAVKKLQAVNKTAAVVRAA 232


>gi|302130812|ref|ZP_07256802.1| DNA-binding response regulator, LuxR family protein [Pseudomonas
           syringae pv. tomato NCPPB 1108]
          Length = 222

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (65%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           F+LT REV+ L W++ GKT+ +IA IL +S  TVN ++  I  K   +TR+ A + A+
Sbjct: 159 FQLTEREVDVLRWVACGKTNKDIADILQLSPRTVNKHLEHIYVKLGVETRTAATSVAL 216


>gi|297538453|ref|YP_003674222.1| MalT-like ATP-dependent transcriptional regulator [Methylotenera
           sp. 301]
 gi|297257800|gb|ADI29645.1| ATP-dependent transcriptional regulator, MalT-like, LuxR family
           [Methylotenera sp. 301]
          Length = 258

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           L+ RE+E + WI  GKT+ EIA IL IS+NTV +++  + +K     R+ A+A
Sbjct: 199 LSVRELEIIHWIKSGKTNQEIATILDISQNTVKSHLKRVFQKMNVTRRAQAVA 251


>gi|229015963|ref|ZP_04172924.1| DNA-binding response regulator [Bacillus cereus AH1273]
 gi|229022180|ref|ZP_04178730.1| DNA-binding response regulator [Bacillus cereus AH1272]
 gi|228739111|gb|EEL89557.1| DNA-binding response regulator [Bacillus cereus AH1272]
 gi|228745323|gb|EEL95364.1| DNA-binding response regulator [Bacillus cereus AH1273]
          Length = 213

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA  L IS  TV  +I  I +K   K+RS A+ YAVRN 
Sbjct: 149 ELTEREKEILFELVKGLSNKEIAEALYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQ 208

Query: 245 IV 246
           +V
Sbjct: 209 LV 210


>gi|220921013|ref|YP_002496314.1| LuxR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219945619|gb|ACL56011.1| transcriptional regulator, LuxR family [Methylobacterium nodulans
           ORS 2060]
          Length = 245

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%)

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + RE+EC+ W + GKT  EI+ IL +S+ TV  Y+ +  RK     R   IA A+R+ ++
Sbjct: 185 SAREIECMRWAAAGKTGWEISEILSLSQRTVEAYLNNAARKLGVANRVHLIAEAIRHGLI 244


>gi|170751882|ref|YP_001758142.1| two component LuxR family transcriptional regulator
           [Methylobacterium radiotolerans JCM 2831]
 gi|170658404|gb|ACB27459.1| two component transcriptional regulator, LuxR family
           [Methylobacterium radiotolerans JCM 2831]
          Length = 305

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             +TGRE E L W+S GK+S +I  ILG+S  TV  ++  I  K   + R+ A   A R+
Sbjct: 243 LPVTGREAEVLLWLSRGKSSRDIGEILGLSHRTVTKHLEGIYAKLGVENRTAASIIAARH 302


>gi|120403052|ref|YP_952881.1| metal dependent phosphohydrolase [Mycobacterium vanbaalenii PYR-1]
 gi|119955870|gb|ABM12875.1| metal dependent phosphohydrolase [Mycobacterium vanbaalenii PYR-1]
          Length = 521

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 45/89 (50%), Gaps = 1/89 (1%)

Query: 158 RLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTV 217
           RL E+ + A  QA   ++   H  +   LT RE+E L  ++ G ++ EIA  LGIS  T 
Sbjct: 431 RLDEVAVEAVLQAAGHRARG-HSPRPGGLTPREIEVLCLVARGASNKEIAATLGISGKTA 489

Query: 218 NNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            N++     K     R GA  +A+ + +V
Sbjct: 490 RNHVERTYAKIGATNRIGASMFALNHGLV 518


>gi|229187725|ref|ZP_04314860.1| DNA-binding response regulator [Bacillus cereus BGSC 6E1]
 gi|228595717|gb|EEK53402.1| DNA-binding response regulator [Bacillus cereus BGSC 6E1]
          Length = 213

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA  L IS  TV  +I  I +K   K+RS A+ YAVRN 
Sbjct: 149 ELTEREKEILFELVKGLSNKEIAEALYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQ 208

Query: 245 IV 246
           +V
Sbjct: 209 LV 210


>gi|328542032|ref|YP_004302141.1| two component transcriptional regulator, LuxR family protein
           [polymorphum gilvum SL003B-26A1]
 gi|326411782|gb|ADZ68845.1| two component transcriptional regulator, LuxR family protein
           [Polymorphum gilvum SL003B-26A1]
          Length = 305

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           + F LT RE E L WI++GK + +I  ILG+S  TVN ++  I  K   + R+ A   A 
Sbjct: 240 RHFGLTAREAEVLLWIAKGKANRDIGDILGLSPRTVNKHLEQIYAKLGVENRASAAVRAA 299

Query: 242 R 242
           +
Sbjct: 300 Q 300


>gi|307328232|ref|ZP_07607410.1| two component transcriptional regulator, LuxR family [Streptomyces
           violaceusniger Tu 4113]
 gi|306886066|gb|EFN17074.1| two component transcriptional regulator, LuxR family [Streptomyces
           violaceusniger Tu 4113]
          Length = 219

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +D  LT RE+E L  I+ G ++ EIA  L IS+ TV  +++ I+ K   + R  A+ YA 
Sbjct: 154 RDIPLTPRELEVLRLIANGLSNSEIAATLVISQETVKTFVSRILAKLGLRDRVQAVVYAY 213

Query: 242 RNNIV 246
           R  +V
Sbjct: 214 RQGLV 218


>gi|284045352|ref|YP_003395692.1| LuxR family transcriptional regulator [Conexibacter woesei DSM
           14684]
 gi|283949573|gb|ADB52317.1| transcriptional regulator, LuxR family [Conexibacter woesei DSM
           14684]
          Length = 592

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 12/100 (12%)

Query: 159 LWE---IGLLAAYQANMFKSYDVHWGKD---------FELTGREVECLTWISEGKTSDEI 206
           LWE   +GLL  +   +       WG++         F LT RE+  LT ++ G ++ EI
Sbjct: 58  LWESPRLGLLQVWIEPVRVPSGDEWGRELTAAPARNEFGLTRRELHVLTLLAGGSSNGEI 117

Query: 207 AVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           A  LG +  T+  ++A ++ K    +RSGA A AV   ++
Sbjct: 118 AAQLGTAPRTIGAHVARLLEKLDQSSRSGAAAVAVERGLL 157


>gi|148553102|ref|YP_001260684.1| LuxR family transcriptional regulator [Sphingomonas wittichii RW1]
 gi|148498292|gb|ABQ66546.1| transcriptional regulator, LuxR family [Sphingomonas wittichii RW1]
          Length = 254

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT R+++CL  I+ GKT  E+  ILG+S +T++ Y+ +  R+   KTRS  +  A R+  
Sbjct: 188 LTPRQIDCLRLIAAGKTEWEMGKILGLSPSTIHEYVEAARRRYGVKTRSQLVLAAARDGY 247

Query: 246 V 246
           V
Sbjct: 248 V 248


>gi|119946605|ref|YP_944285.1| two component transcriptional regulator, LuxR family protein
           [Psychromonas ingrahamii 37]
 gi|119865209|gb|ABM04686.1| two component transcriptional regulator, LuxR family protein
           [Psychromonas ingrahamii 37]
          Length = 295

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
             +T RE E L W+S GKTS EI++IL +S  TVN ++  I +K     R+ A A ++R
Sbjct: 233 LPITKRESEVLYWVSYGKTSWEISLILEMSPRTVNKHLEQIYKKLGVDNRTSAAAISIR 291


>gi|309779188|ref|ZP_07673951.1| DNA-binding response regulator, LuxR family [Ralstonia sp.
           5_7_47FAA]
 gi|308921992|gb|EFP67626.1| DNA-binding response regulator, LuxR family [Ralstonia sp.
           5_7_47FAA]
          Length = 201

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 1/84 (1%)

Query: 164 LLAAYQANMFKSYDVHWGKD-FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIA 222
           L++  Q  + +    H      +L+ RE E L W + GKTS EIA ILG+S+ TV+ ++ 
Sbjct: 116 LISIVQTRLARRPRTHTAHPPVQLSEREAEVLAWSARGKTSGEIATILGLSKRTVDFHMD 175

Query: 223 SIMRKTATKTRSGAIAYAVRNNIV 246
           +   K    TR  A+  A  + I+
Sbjct: 176 NAREKLGVATRIEAVVRASSSGII 199


>gi|213969640|ref|ZP_03397776.1| DNA-binding response regulator, LuxR family [Pseudomonas syringae
           pv. tomato T1]
 gi|301384782|ref|ZP_07233200.1| DNA-binding response regulator, LuxR family protein [Pseudomonas
           syringae pv. tomato Max13]
 gi|302060724|ref|ZP_07252265.1| DNA-binding response regulator, LuxR family protein [Pseudomonas
           syringae pv. tomato K40]
 gi|213925736|gb|EEB59295.1| DNA-binding response regulator, LuxR family [Pseudomonas syringae
           pv. tomato T1]
          Length = 222

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (65%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           F+LT REV+ L W++ GKT+ +IA IL +S  TVN ++  I  K   +TR+ A + A+
Sbjct: 159 FQLTEREVDVLRWVACGKTNKDIADILQLSPRTVNKHLEHIYVKLGVETRTAATSVAL 216


>gi|167839810|ref|ZP_02466494.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis MSMB43]
          Length = 236

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           D +LT RE + L W ++GKT+ EIA+IL IS +TVN ++ +I+ K  +  +  A+A A 
Sbjct: 173 DPDLTRRETDVLKWTADGKTAYEIALILSISESTVNFHVKNIVSKLGSTNKIQAVAKAA 231


>gi|167615994|ref|ZP_02384629.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis Bt4]
          Length = 194

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           D +LT RE + L W ++GKT+ EIA+IL IS +TVN ++ +I+ K  +  +  A+A A 
Sbjct: 131 DPDLTRRETDVLKWTADGKTAYEIALILSISESTVNFHVKNIVSKLGSTNKIQAVAKAA 189


>gi|88797814|ref|ZP_01113402.1| LuxR, transcriptional regulator [Reinekea sp. MED297]
 gi|88779491|gb|EAR10678.1| LuxR, transcriptional regulator [Reinekea sp. MED297]
          Length = 240

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE+ECLTW +EGK+S EI+ ILG S  T   ++++   K     R  AI+ A+   
Sbjct: 175 KLTKREIECLTWATEGKSSWEISQILGCSERTAIFHLSNAANKLGATNRYQAISKALLCG 234

Query: 245 IV 246
           I+
Sbjct: 235 II 236


>gi|134293938|ref|YP_001117674.1| LuxR family transcriptional regulator [Burkholderia vietnamiensis
           G4]
 gi|134137095|gb|ABO58209.1| transcriptional regulator, LuxR family [Burkholderia vietnamiensis
           G4]
          Length = 239

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K A   +  A+  A+   +
Sbjct: 176 LTAREREVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLAATNKVQAVVKAIAAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|159897476|ref|YP_001543723.1| LuxR family transcriptional regulator [Herpetosiphon aurantiacus
           ATCC 23779]
 gi|159890515|gb|ABX03595.1| transcriptional regulator, LuxR family [Herpetosiphon aurantiacus
           ATCC 23779]
          Length = 799

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 29/57 (50%), Positives = 38/57 (66%), Gaps = 1/57 (1%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           LT RE E LT I++GK++ EIA+ L +S  TVNN++ +I RK    TRS A AY  R
Sbjct: 732 LTKREHELLTLIAQGKSNSEIALELVLSPFTVNNHLRAIYRKLGVSTRSAA-AYIAR 787


>gi|205372705|ref|ZP_03225516.1| two-component response regulator [Bacillus coahuilensis m4-4]
          Length = 212

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 41/62 (66%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE+E L  ++EGKT+ EI   L I+  TV  ++++I+ K   + R+ A+ YA +++
Sbjct: 146 ELTNREMEILLLMAEGKTNSEIGEDLFIAHKTVKTHVSNILSKLGVQDRTQAVIYAFQHS 205

Query: 245 IV 246
           +V
Sbjct: 206 LV 207


>gi|331696989|ref|YP_004333228.1| two component LuxR family transcriptional regulator [Pseudonocardia
           dioxanivorans CB1190]
 gi|326951678|gb|AEA25375.1| two component transcriptional regulator, LuxR family
           [Pseudonocardia dioxanivorans CB1190]
          Length = 237

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 45/83 (54%)

Query: 164 LLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           LL A      +   V   +   LT RE E LT ++EG ++ EIA  L +S  TV +++  
Sbjct: 142 LLEALAGGRPEPVPVAPQRPAGLTAREAEVLTLVAEGLSNAEIARRLVVSEGTVKSHMNH 201

Query: 224 IMRKTATKTRSGAIAYAVRNNIV 246
           ++ K   + R+ A+A+A RN +V
Sbjct: 202 LLAKIDARDRAQAVAFAYRNGLV 224


>gi|298248902|ref|ZP_06972706.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
 gi|297546906|gb|EFH80773.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
          Length = 225

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + +LT RE E L  I+ G+ S EI   LGI+R TV +Y+ SI  K    +R+ A+A A+ 
Sbjct: 155 NVQLTEREQEVLAGIAAGERSKEIGARLGITRRTVESYLNSIYTKLNVDSRAAAVAVAIE 214

Query: 243 NNIV 246
             ++
Sbjct: 215 RGLL 218


>gi|229010064|ref|ZP_04167278.1| DNA-binding response regulator [Bacillus mycoides DSM 2048]
 gi|229136711|ref|ZP_04265367.1| DNA-binding response regulator [Bacillus cereus BDRD-ST196]
 gi|228646748|gb|EEL02927.1| DNA-binding response regulator [Bacillus cereus BDRD-ST196]
 gi|228751197|gb|EEM01009.1| DNA-binding response regulator [Bacillus mycoides DSM 2048]
          Length = 213

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA  L IS  TV  +I  I +K   K+RS A+ YAVRN 
Sbjct: 149 ELTEREKEILFELVKGLSNKEIAEALYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQ 208

Query: 245 IV 246
           +V
Sbjct: 209 LV 210


>gi|110633760|ref|YP_673968.1| LuxR family transcriptional regulator [Mesorhizobium sp. BNC1]
 gi|110284744|gb|ABG62803.1| transcriptional regulator, LuxR family [Chelativorans sp. BNC1]
          Length = 241

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L  RE ECL W + GK S +IA IL +S  TV +Y+ +  +K   +T S A+A A R  I
Sbjct: 179 LAPRERECLLWTARGKDSKDIAGILDLSEYTVRSYLRTARQKLQCRTLSQAVATATRQRI 238

Query: 246 V 246
           +
Sbjct: 239 I 239


>gi|330879674|gb|EGH13823.1| DNA-binding response regulator, LuxR family protein [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
          Length = 222

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (65%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           F+LT REV+ L W++ GKT+ +IA IL +S  TVN ++  I  K   +TR+ A + A+
Sbjct: 159 FQLTEREVDVLRWVACGKTNKDIADILQLSPRTVNKHLEHIYVKLGVETRTAATSVAL 216


>gi|225862611|ref|YP_002747989.1| transcriptional regulatory protein DegU [Bacillus cereus 03BB102]
 gi|225789899|gb|ACO30116.1| transcriptional regulatory protein DegU [Bacillus cereus 03BB102]
          Length = 213

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA  L IS  TV  +I  I +K   K+RS A+ YAVRN 
Sbjct: 149 ELTEREKEILFELVKGLSNKEIAEALYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQ 208

Query: 245 IV 246
           +V
Sbjct: 209 LV 210


>gi|148654624|ref|YP_001274829.1| two component LuxR family transcriptional regulator [Roseiflexus
           sp. RS-1]
 gi|148566734|gb|ABQ88879.1| two component transcriptional regulator, LuxR family [Roseiflexus
           sp. RS-1]
          Length = 208

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 40/76 (52%), Gaps = 7/76 (9%)

Query: 169 QANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKT 228
           QA   +S D        LT RE E L  ++EG T+ EIA  L +   TV  ++ASI+RK 
Sbjct: 138 QAQTMRSSDA-------LTEREGEVLKLLAEGLTNAEIAARLSVGEETVKTHVASILRKL 190

Query: 229 ATKTRSGAIAYAVRNN 244
               R+ A  YA+R+ 
Sbjct: 191 GLAHRTQAAIYALRHG 206


>gi|229074417|ref|ZP_04207449.1| DNA-binding response regulator [Bacillus cereus Rock4-18]
 gi|229095286|ref|ZP_04226278.1| DNA-binding response regulator [Bacillus cereus Rock3-29]
 gi|229101393|ref|ZP_04232137.1| DNA-binding response regulator [Bacillus cereus Rock3-28]
 gi|228682098|gb|EEL36231.1| DNA-binding response regulator [Bacillus cereus Rock3-28]
 gi|228688145|gb|EEL42031.1| DNA-binding response regulator [Bacillus cereus Rock3-29]
 gi|228708701|gb|EEL60842.1| DNA-binding response regulator [Bacillus cereus Rock4-18]
          Length = 213

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA  L IS  TV  +I  I +K   K+RS A+ YAVRN 
Sbjct: 149 ELTEREKEILFELVKGLSNKEIAEALYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQ 208

Query: 245 IV 246
           +V
Sbjct: 209 LV 210


>gi|229114235|ref|ZP_04243656.1| DNA-binding response regulator [Bacillus cereus Rock1-3]
 gi|228669255|gb|EEL24676.1| DNA-binding response regulator [Bacillus cereus Rock1-3]
          Length = 213

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA  L IS  TV  +I  I +K   K+RS A+ YAVRN 
Sbjct: 149 ELTEREKEILFELVKGLSNKEIAEALYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQ 208

Query: 245 IV 246
           +V
Sbjct: 209 LV 210


>gi|118476319|ref|YP_893470.1| DNA-binding response regulator [Bacillus thuringiensis str. Al
           Hakam]
 gi|118415544|gb|ABK83963.1| DNA-binding response regulator [Bacillus thuringiensis str. Al
           Hakam]
          Length = 216

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA  L IS  TV  +I  I +K   K+RS A+ YAVRN 
Sbjct: 152 ELTEREKEILFELVKGLSNKEIAEALYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQ 211

Query: 245 IV 246
           +V
Sbjct: 212 LV 213


>gi|152967753|ref|YP_001363537.1| two component transcriptional regulator, LuxR family [Kineococcus
           radiotolerans SRS30216]
 gi|151362270|gb|ABS05273.1| two component transcriptional regulator, LuxR family [Kineococcus
           radiotolerans SRS30216]
          Length = 236

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE++ L  ++ G  + EIA  LGIS NTV N++ +I+ K    +R  A+ YAVR  I
Sbjct: 173 LSPRELDVLRLLARGMANREIAGSLGISENTVKNHVRNILEKLQLHSRMEAVVYAVREKI 232

Query: 246 V 246
           V
Sbjct: 233 V 233


>gi|330465133|ref|YP_004402876.1| LuxR family transcriptional regulator [Verrucosispora maris
           AB-18-032]
 gi|328808104|gb|AEB42276.1| LuxR family transcriptional regulator [Verrucosispora maris
           AB-18-032]
          Length = 386

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 40/61 (65%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELTGREVE L  +  G ++ ++A  LGIS  TV  ++++++RKT   +R+ A  +AVR  
Sbjct: 308 ELTGREVEVLDCLVAGMSNKQVARALGISVRTVTVHVSNLLRKTGAASRTEAALWAVRQR 367

Query: 245 I 245
           +
Sbjct: 368 L 368


>gi|149375695|ref|ZP_01893464.1| response regulator receiver domain protein (CheY-like)
           [Marinobacter algicola DG893]
 gi|149360097|gb|EDM48552.1| response regulator receiver domain protein (CheY-like)
           [Marinobacter algicola DG893]
          Length = 301

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (62%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           F LTGRE + L WI+ GKT+ EI  IL +S  TVN ++  + RK   + R+ A A A++
Sbjct: 238 FSLTGRESDVLLWIANGKTNREIGQILEMSPRTVNKHLEQVFRKLGVENRTSAAAAAIK 296


>gi|238027315|ref|YP_002911546.1| Autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia glumae BGR1]
 gi|237876509|gb|ACR28842.1| Autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia glumae BGR1]
          Length = 234

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT RE + L W ++GKT+ EI+ IL IS +TVN ++ +IM K  T  +  A+A A 
Sbjct: 174 LTSRETDVLKWTADGKTAYEISRILSISESTVNFHVKNIMSKLGTSNKIQAVAKAA 229


>gi|299140322|ref|ZP_07033486.1| two component transcriptional regulator, LuxR family
           [Acidobacterium sp. MP5ACTX8]
 gi|298597710|gb|EFI53884.1| two component transcriptional regulator, LuxR family
           [Acidobacterium sp. MP5ACTX8]
          Length = 200

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 42/67 (62%), Gaps = 1/67 (1%)

Query: 178 VHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           +H G +  LT RE+E L  I +G  + ++A ILGI+  TVN +I+++++K     R+ A+
Sbjct: 131 MHLGGE-HLTVRELEVLALIRDGHANKQVADILGIAETTVNFHISNLVKKLKANDRTHAM 189

Query: 238 AYAVRNN 244
           A AVR  
Sbjct: 190 AIAVRRG 196


>gi|317129803|ref|YP_004096085.1| LuxR family transcriptional regulator [Bacillus cellulosilyticus
           DSM 2522]
 gi|315474751|gb|ADU31354.1| two component transcriptional regulator, LuxR family [Bacillus
           cellulosilyticus DSM 2522]
          Length = 210

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 45/77 (58%), Gaps = 2/77 (2%)

Query: 170 ANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTA 229
           + M K  + H     +LT RE+E L  ++EGK + EIA  L I+  TV  ++++I+ K  
Sbjct: 135 SQMRKKQEAHLHD--QLTEREMEVLKLMTEGKANQEIADELYIALKTVKVHVSNILNKLE 192

Query: 230 TKTRSGAIAYAVRNNIV 246
              R+ A+ YA +NN++
Sbjct: 193 VHDRTQAVIYAFKNNLI 209


>gi|323704464|ref|ZP_08116042.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323535926|gb|EGB25699.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 210

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L  I+EG ++ EIA  L +S  TV N++ +I RK   K R+ A  Y ++NN
Sbjct: 144 DLTDREFEILNLIAEGYSNKEIADKLFLSEKTVKNHVYNIFRKLDVKDRTQAAIYLLKNN 203


>gi|148241069|ref|YP_001220570.1| LuxR family transcriptional regulator [Bradyrhizobium sp. BTAi1]
 gi|146411445|gb|ABQ39898.1| transcriptional regulator, LuxR family [Bradyrhizobium sp. BTAi1]
          Length = 243

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE +CL WIS+GKT  +IA +LG+S   V  ++ +  R  A  T   A+A A R  +
Sbjct: 182 LTQRERQCLAWISDGKTMQDIAELLGVSPRGVKFHLDNARRNLAALTLPHAVALAFRQGL 241

Query: 246 V 246
           +
Sbjct: 242 L 242


>gi|218661626|ref|ZP_03517556.1| autoinducer transcriptional regulator protein [Rhizobium etli
           IE4771]
          Length = 243

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 2/73 (2%)

Query: 176 YDVHWGKDF--ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           Y++H   D    L+ RE+ECL W + GK   +I+VILGIS +T  +Y+ +   K    T 
Sbjct: 169 YELHGENDPVPALSPREIECLHWTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATI 228

Query: 234 SGAIAYAVRNNIV 246
           S A + AV+  I+
Sbjct: 229 SAAASRAVQLRII 241


>gi|229169497|ref|ZP_04297202.1| DNA-binding response regulator [Bacillus cereus AH621]
 gi|228613996|gb|EEK71116.1| DNA-binding response regulator [Bacillus cereus AH621]
          Length = 184

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  + +G ++ EIA  L IS  TV  ++  I RK   K+RS A+ YAVRN 
Sbjct: 120 ELTEREKEILFELVKGLSNKEIAEALYISDKTVKIHVNKIFRKLNVKSRSQAVIYAVRNQ 179

Query: 245 IV 246
           +V
Sbjct: 180 LV 181


>gi|295695702|ref|YP_003588940.1| GAF modulated transcriptional regulator, LuxR family [Bacillus
           tusciae DSM 2912]
 gi|295411304|gb|ADG05796.1| GAF modulated transcriptional regulator, LuxR family [Bacillus
           tusciae DSM 2912]
          Length = 511

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE + L +I++G  + EI+  L +S  TV+ Y+ +I+R+     RS A+A A+R NI
Sbjct: 450 LTPREQQILQFIADGLDTKEISQHLHLSEYTVSEYVRAILRRLQVPNRSAAVAKAMRQNI 509

Query: 246 V 246
           +
Sbjct: 510 I 510


>gi|171057768|ref|YP_001790117.1| two component LuxR family transcriptional regulator [Leptothrix
           cholodnii SP-6]
 gi|170775213|gb|ACB33352.1| two component transcriptional regulator, LuxR family [Leptothrix
           cholodnii SP-6]
          Length = 316

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           F LT RE E L W+++GKT+ +I  ILG S  TV  ++  +  K   +TR+ A A A+
Sbjct: 251 FRLTPREAEVLYWLAKGKTNRDIGEILGSSAATVKKHLEHVYEKLGVETRNAAAAVAI 308


>gi|295696562|ref|YP_003589800.1| two component transcriptional regulator, LuxR family [Bacillus
           tusciae DSM 2912]
 gi|295412164|gb|ADG06656.1| two component transcriptional regulator, LuxR family [Bacillus
           tusciae DSM 2912]
          Length = 220

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L ++S G ++ EIA  L IS +TV N+I +I+ K     R  A AYA+R  I
Sbjct: 151 LTSRELEVLGYLSTGASNREIAKQLFISEHTVRNHIQNILGKLHLTNRVQAAAYAIRQGI 210


>gi|241205631|ref|YP_002976727.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859521|gb|ACS57188.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 241

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 2/73 (2%)

Query: 176 YDVHWGKDF--ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           Y++H   D    L+ RE+ECL W + GK   +I+VILGIS +T  +Y+ +   K    T 
Sbjct: 167 YELHGENDPVPSLSPREIECLHWTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATI 226

Query: 234 SGAIAYAVRNNIV 246
           S A + AV+  I+
Sbjct: 227 SAAASRAVQLRII 239


>gi|116253119|ref|YP_768957.1| AHL-dependent transcriptional regulator [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115257767|emb|CAK08865.1| putative AHL-dependent transcriptional regulator [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 241

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 2/73 (2%)

Query: 176 YDVHWGKDF--ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           Y++H   D    L+ RE+ECL W + GK   +I+VILGIS +T  +Y+ +   K    T 
Sbjct: 167 YELHGENDPVPSLSPREIECLHWTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATI 226

Query: 234 SGAIAYAVRNNIV 246
           S A + AV+  I+
Sbjct: 227 SAAASRAVQLRII 239


>gi|291003373|ref|ZP_06561346.1| two component transcriptional regulator, LuxR family protein
           [Saccharopolyspora erythraea NRRL 2338]
          Length = 221

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EL+GREVE L  +++G+++ EI   L +S  TV ++++ I RK  T  R+  +A A+R  
Sbjct: 159 ELSGREVEVLQLVADGRSNKEIGEALNLSALTVKSHLSRIGRKLGTGDRAQMVALAMRAG 218

Query: 245 IV 246
           ++
Sbjct: 219 VI 220


>gi|145594985|ref|YP_001159282.1| response regulator receiver [Salinispora tropica CNB-440]
 gi|145304322|gb|ABP54904.1| response regulator receiver [Salinispora tropica CNB-440]
          Length = 220

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 39/64 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  LT RE+E L  I++G ++ EIA  L IS+ TV  Y++ I+ K   + R  A+ YA R
Sbjct: 155 DIPLTPRELEVLRLIADGLSNSEIAATLVISQETVKTYVSRILTKLDLRDRVQAVVYAYR 214

Query: 243 NNIV 246
           + +V
Sbjct: 215 SGLV 218


>gi|86359580|ref|YP_471472.1| LuxR family transcriptional regulator [Rhizobium etli CFN 42]
 gi|86283682|gb|ABC92745.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CFN 42]
          Length = 251

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L +++EG TS EI+ +L IS +TV+ Y+  +  K   K R  A+A A R+ +
Sbjct: 190 LTRREMEILHYLAEGMTSMEISKMLKISNHTVDWYMNGLQNKLKAKNRQQAVALAFRHGL 249

Query: 246 V 246
           +
Sbjct: 250 I 250


>gi|298250464|ref|ZP_06974268.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
 gi|297548468|gb|EFH82335.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
          Length = 225

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + +LT RE E L  I+ G+ S EI   LGI+R TV +Y+ SI  K    +R+ A+A A+ 
Sbjct: 155 NVQLTEREQEVLAGIATGERSKEIGARLGITRRTVESYLNSIYTKLDVDSRAAAVAVAIE 214

Query: 243 NNIV 246
             ++
Sbjct: 215 RGLL 218


>gi|212638021|ref|YP_002314541.1| NarL family DNA-binding response regulator [Anoxybacillus
           flavithermus WK1]
 gi|212559501|gb|ACJ32556.1| DNA-binding response regulator, NarL family (REC-HTH domains)
           [Anoxybacillus flavithermus WK1]
          Length = 208

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE+E L  I++GKT+ EIA  L IS  TV  ++++I+ K   + R+ A+ YA ++ 
Sbjct: 146 QLTSREMEVLLLIAQGKTNQEIAEELFISLKTVKVHVSNILAKLDVQDRTQAVIYAFKHG 205

Query: 245 IV 246
           +V
Sbjct: 206 LV 207


>gi|167828172|ref|ZP_02459643.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 9]
          Length = 210

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           D +LT RE + L W ++GKT+ EIA+IL IS +TVN ++ +I+ K  +  +  A+A A 
Sbjct: 147 DPDLTRRETDVLKWTADGKTAYEIALILSISESTVNFHVKNIVSKLGSTNKIQAVAKAA 205


>gi|78183869|ref|YP_376303.1| LuxR family transcriptional regulator [Synechococcus sp. CC9902]
 gi|78168163|gb|ABB25260.1| transcriptional regulator, LuxR family [Synechococcus sp. CC9902]
          Length = 92

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 42/71 (59%)

Query: 173 FKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKT 232
             S D     D  L+ RE+E +  ++EG T+ EIA  L IS+ TV+N+++++  KT +K 
Sbjct: 1   MSSVDTTDPLDISLSAREIEIIQLVAEGLTNQEIADRLTISKRTVDNHVSNVFTKTGSKN 60

Query: 233 RSGAIAYAVRN 243
           R   + +A+ N
Sbjct: 61  RVALLNWAMDN 71


>gi|109896689|ref|YP_659944.1| LuxR family transcriptional regulator [Pseudoalteromonas atlantica
           T6c]
 gi|109698970|gb|ABG38890.1| transcriptional regulator, LuxR family [Pseudoalteromonas atlantica
           T6c]
          Length = 248

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (59%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE+ECL W  EGKT+ EI+ I+ +S  TV  ++ +   K     R  A+A A++  
Sbjct: 183 ELTKRELECLFWACEGKTAWEISQIINVSERTVLFHLGNSNTKLGAINRQHAVALAIKKG 242

Query: 245 IV 246
           I+
Sbjct: 243 II 244


>gi|332560426|ref|ZP_08414744.1| Response regulator receiver protein [Rhodobacter sphaeroides WS8N]
 gi|332274224|gb|EGJ19540.1| Response regulator receiver protein [Rhodobacter sphaeroides WS8N]
          Length = 105

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 38/54 (70%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           +L+ R++E L WI+ GK++ EIA+ILG+SR  V  +++ I++K    +R+ A+ 
Sbjct: 47  KLSPRQIEILDWIAHGKSNSEIALILGLSRRNVTYHVSEILKKLDVTSRTQAVG 100


>gi|309789968|ref|ZP_07684544.1| response regulator receiver [Oscillochloris trichoides DG6]
 gi|308227988|gb|EFO81640.1| response regulator receiver [Oscillochloris trichoides DG6]
          Length = 253

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 38/57 (66%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE+E L  I+ G ++ EIA  L IS  TV N+I+SI+RK +   R+ A+ +A+R
Sbjct: 173 LSEREIEVLERIAAGGSNKEIADSLSISTQTVKNHISSILRKLSLNDRTQAVLFALR 229


>gi|258652794|ref|YP_003201950.1| LuxR family transcriptional regulator [Nakamurella multipartita DSM
           44233]
 gi|258556019|gb|ACV78961.1| transcriptional regulator, LuxR family [Nakamurella multipartita
           DSM 44233]
          Length = 562

 Score = 50.1 bits (118), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  ++ G T+ ++A  L IS  TV  ++A++ RK    TR+ A+A+A RN +
Sbjct: 495 LTARETEILALVARGDTNRQVAQALVISEKTVARHLANVHRKLGVSTRTAAVAWARRNGL 554


>gi|302522670|ref|ZP_07275012.1| LuxR family transcriptional regulator [Streptomyces sp. SPB78]
 gi|318057801|ref|ZP_07976524.1| response regulator [Streptomyces sp. SA3_actG]
 gi|302431565|gb|EFL03381.1| LuxR family transcriptional regulator [Streptomyces sp. SPB78]
          Length = 290

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REVE L  ++EG T+  +A  LG+   TV  Y+ + MRK   +TR  A+A A R  +
Sbjct: 229 LTPREVEVLVIVAEGATNAAVASRLGLRPETVKAYLRAAMRKLGARTRGEAVAVARRAGV 288

Query: 246 V 246
           V
Sbjct: 289 V 289


>gi|116250894|ref|YP_766732.1| GerE/LuxR family transcriptional regulator [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115255542|emb|CAK06619.1| putative GerE/LuxR family transcriptional regulator [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 159

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           +T RE E + W++ GKT+ EI  ILGIS  TVN +IA+   +      +  +A A+RN I
Sbjct: 98  VTPRETEVIRWMAAGKTAAEIGTILGISHITVNTHIANAKARLGVFKDTALVAAALRNGI 157

Query: 246 V 246
           +
Sbjct: 158 I 158


>gi|121606516|ref|YP_983845.1| two component LuxR family transcriptional regulator [Polaromonas
           naphthalenivorans CJ2]
 gi|120595485|gb|ABM38924.1| two component transcriptional regulator, LuxR family [Polaromonas
           naphthalenivorans CJ2]
          Length = 292

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 45/77 (58%), Gaps = 1/77 (1%)

Query: 169 QANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKT 228
           QAN+ +   V+ GKD +L+ RE + L  ++ G +S EI   L IS  T N +I +I RK 
Sbjct: 216 QANV-EPLPVNQGKDNKLSEREQQVLKLVASGHSSTEIGARLVISWQTANTHIKNIYRKL 274

Query: 229 ATKTRSGAIAYAVRNNI 245
             + R+ A+++A  + +
Sbjct: 275 NVRNRAQAVSFAANHGL 291


>gi|222106283|ref|YP_002547074.1| two component response regulator [Agrobacterium vitis S4]
 gi|221737462|gb|ACM38358.1| two component response regulator [Agrobacterium vitis S4]
          Length = 220

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ R+++ L  ++EG+T+ EIA+ILGIS  TV  ++++I R     TR+GA+   +   +
Sbjct: 146 LSQRQLDVLHLLAEGRTNKEIAIILGISPFTVRIHVSAIFRALGVATRAGAVTKGIAMGL 205

Query: 246 V 246
           V
Sbjct: 206 V 206


>gi|196231497|ref|ZP_03130355.1| two component transcriptional regulator, LuxR family
           [Chthoniobacter flavus Ellin428]
 gi|196224350|gb|EDY18862.1| two component transcriptional regulator, LuxR family
           [Chthoniobacter flavus Ellin428]
          Length = 216

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 49/85 (57%), Gaps = 1/85 (1%)

Query: 163 GLLAAYQANMFKSYDVHWG-KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYI 221
           G +A    +MF  +    G  D+ LT RE + L  + +G+T  EIA  L +S +TV+ ++
Sbjct: 132 GRIARRVLDMFARFAPTRGDGDYGLTTRETQILEAMVKGRTKKEIAAQLDLSFHTVDTHL 191

Query: 222 ASIMRKTATKTRSGAIAYAVRNNIV 246
            +I +K    TR+GA+A A++  +V
Sbjct: 192 RNIYQKLEVNTRTGAVAKALKEKLV 216


>gi|86358681|ref|YP_470573.1| LuxR family transcriptional regulator [Rhizobium etli CFN 42]
 gi|86282783|gb|ABC91846.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CFN 42]
          Length = 241

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 67/153 (43%), Gaps = 13/153 (8%)

Query: 96  DKYYNVLQRPTELFCPVF-HTLPENIT-PPAGMDNRYCSLTFDVARIRIGLMLLFPKGRI 153
           D   N    P EL   +  H +P  +  P   +D R     F   R  +G   +     +
Sbjct: 99  DDTVNGQAFPAELRALMLRHAIPAGVAMPTIAVDGRRLVFWFCGERAALGQSEVNELAIV 158

Query: 154 ILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGIS 213
           IL         L AY A      + H      L+ RE+E + W ++GKTS EI  IL +S
Sbjct: 159 ILHT-------LDAYNAVRRNEENAHSA----LSARELEVVRWTAQGKTSIEIGQILTLS 207

Query: 214 RNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            +TVN Y+ + ++K     R+  +A A+R  ++
Sbjct: 208 DHTVNAYMTNAIKKLDCVNRTQLVAKAIRLKLI 240


>gi|333023628|ref|ZP_08451692.1| putative LuxR family transcriptional regulator [Streptomyces sp.
           Tu6071]
 gi|332743480|gb|EGJ73921.1| putative LuxR family transcriptional regulator [Streptomyces sp.
           Tu6071]
          Length = 290

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REVE L  ++EG T+  +A  LG+   TV  Y+ + MRK   +TR  A+A A R  +
Sbjct: 229 LTPREVEVLVIVAEGATNAAVASRLGLRPETVKAYLRAAMRKLGARTRGEAVAVARRAGV 288

Query: 246 V 246
           V
Sbjct: 289 V 289


>gi|331657961|ref|ZP_08358923.1| regulatory protein SdiA [Escherichia coli TA206]
 gi|331056209|gb|EGI28218.1| regulatory protein SdiA [Escherichia coli TA206]
          Length = 87

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA  
Sbjct: 24  EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAA 83

Query: 243 NNIV 246
             ++
Sbjct: 84  TGLI 87


>gi|316935504|ref|YP_004110486.1| LuxR family two component transcriptional regulator
           [Rhodopseudomonas palustris DX-1]
 gi|315603218|gb|ADU45753.1| two component transcriptional regulator, LuxR family
           [Rhodopseudomonas palustris DX-1]
          Length = 309

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
            +  +F LT RE E L W+S+GKT+ +IA ILG+S  TV+ ++  I  K   + R
Sbjct: 240 QFSAEFGLTSRESEVLAWLSKGKTNRDIAQILGLSPRTVDKHLEQIYAKLGVENR 294


>gi|307328222|ref|ZP_07607400.1| two component transcriptional regulator, LuxR family [Streptomyces
           violaceusniger Tu 4113]
 gi|306886056|gb|EFN17064.1| two component transcriptional regulator, LuxR family [Streptomyces
           violaceusniger Tu 4113]
          Length = 232

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E LT ++ GK + EIA  L I + TV  Y++ I+ K    +R+ A  YAV++ 
Sbjct: 149 QLTERETEVLTMLARGKANKEIAHDLRIGQQTVKTYVSHILTKLGVHSRTQAAVYAVQSG 208

Query: 245 IV 246
           +V
Sbjct: 209 LV 210


>gi|303238745|ref|ZP_07325277.1| two component transcriptional regulator, LuxR family [Acetivibrio
           cellulolyticus CD2]
 gi|302593624|gb|EFL63340.1| two component transcriptional regulator, LuxR family [Acetivibrio
           cellulolyticus CD2]
          Length = 216

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  LT RE+  +  I +GK++ EIA+ + I+  +V N I +I+ K   K R+    +AV+
Sbjct: 153 DINLTDRELSIIKLIVDGKSNKEIALSIFITEGSVKNIITNILEKLNLKDRTQLAVFAVK 212

Query: 243 NNIV 246
           NNIV
Sbjct: 213 NNIV 216


>gi|159185350|ref|NP_355660.2| LuxR family transcriptional regulator [Agrobacterium tumefaciens
           str. C58]
 gi|159140603|gb|AAK88445.2| transcriptional regulator, LuxR family [Agrobacterium tumefaciens
           str. C58]
          Length = 245

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
            ELT RE+E L  +++G TS EI   L IS +TV+ YI  I R+ + K R   +A A R+
Sbjct: 182 LELTRREMEVLALMADGMTSTEIGRQLSISNHTVDWYINGIQRRFSAKNRQHTVALAFRH 241

Query: 244 NIV 246
            ++
Sbjct: 242 GLL 244


>gi|47568528|ref|ZP_00239227.1| DNA-binding response regulator, LuxR family [Bacillus cereus G9241]
 gi|228988639|ref|ZP_04148725.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|47554770|gb|EAL13122.1| DNA-binding response regulator, LuxR family [Bacillus cereus G9241]
 gi|228771090|gb|EEM19570.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
          Length = 215

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLHLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|238782956|ref|ZP_04626984.1| Transcriptional activator protein echR [Yersinia bercovieri ATCC
           43970]
 gi|238716159|gb|EEQ08143.1| Transcriptional activator protein echR [Yersinia bercovieri ATCC
           43970]
          Length = 244

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 64/138 (46%), Gaps = 21/138 (15%)

Query: 112 VFHTLPENITPPAGMDNRYC------SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLL 165
           V H    N+T  + M ++ C       +  D A I++ LML+  K              L
Sbjct: 112 VLHDQYYNLTILSLMTDKDCDEDIEDKIANDKANIQMLLMLIHEK--------------L 157

Query: 166 AAYQANMFKSYDV-HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASI 224
            ++  ++ +S D    G++   T RE E + W S GK+  EIA+ILGI   TV +++  +
Sbjct: 158 TSFYNDLNRSSDFCKMGRNEIFTKRENEIIYWASVGKSYPEIALILGIKPTTVKHHMGKV 217

Query: 225 MRKTATKTRSGAIAYAVR 242
           +RK        AI+ AV 
Sbjct: 218 VRKLGVTNAKHAISLAVE 235


>gi|222086655|ref|YP_002545189.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
 gi|221724103|gb|ACM27259.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
          Length = 243

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+E + W ++GKTS EI  IL +S +TVN Y+ + ++K     R+  +A A+R  +
Sbjct: 182 LSARELEVVRWTAQGKTSVEIGQILSLSDHTVNAYMMNAIKKLDCVNRTQLVAKAIRLKL 241

Query: 246 V 246
           +
Sbjct: 242 I 242


>gi|223936999|ref|ZP_03628907.1| two component transcriptional regulator, LuxR family [bacterium
           Ellin514]
 gi|223894280|gb|EEF60733.1| two component transcriptional regulator, LuxR family [bacterium
           Ellin514]
          Length = 217

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 35/56 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT R  E L W+++GKT+ +IA ILGIS +TV  ++  I  K   +TRS A   A+
Sbjct: 145 LTPRAAETLLWVAQGKTNLDIATILGISESTVKKHLLEIFDKLNIETRSAATLRAL 200


>gi|167742620|ref|ZP_02415394.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 14]
 gi|167914947|ref|ZP_02502038.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 112]
 gi|167922782|ref|ZP_02509873.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei BCC215]
          Length = 210

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           D +LT RE + L W ++GKT+ EIA+IL IS +TVN ++ +I+ K  +  +  A+A A 
Sbjct: 147 DPDLTRRETDVLKWTADGKTAYEIALILSISESTVNFHVKNIVSKLGSTNKIQAVAKAA 205


>gi|324329359|gb|ADY24619.1| DNA-binding response regulator [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 215

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLHLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|311742180|ref|ZP_07715990.1| LuxR-family transcriptional regulator [Aeromicrobium marinum DSM
           15272]
 gi|311314673|gb|EFQ84580.1| LuxR-family transcriptional regulator [Aeromicrobium marinum DSM
           15272]
          Length = 899

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 37/60 (61%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  LT RE E L W+S G ++ +IA  LGIS  TV+ ++++++RK    +R+ A   A R
Sbjct: 836 DPHLTPRESEVLRWVSTGASNRQIARTLGISEGTVSVHVSNLLRKLGVGSRTEAAVRAAR 895


>gi|289165158|ref|YP_003455296.1| transcriptional regulator [Legionella longbeachae NSW150]
 gi|288858331|emb|CBJ12199.1| putative transcriptional regulator [Legionella longbeachae NSW150]
          Length = 282

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EL  RE ECL W   GK++ E + ILG+ R TV NY+  +  K    +   AI  A+++ 
Sbjct: 220 ELKDRERECLFWARYGKSTSETSEILGLKRATVKNYLEGVREKFHVSSVQEAITLALQHQ 279

Query: 245 IV 246
           I+
Sbjct: 280 II 281


>gi|192289851|ref|YP_001990456.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           TIE-1]
 gi|192283600|gb|ACE99980.1| two component transcriptional regulator, LuxR family
           [Rhodopseudomonas palustris TIE-1]
          Length = 308

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
            +  +F LT RE E L W+S+GKT+ +IA ILG+S  TV+ ++  I  K   + R
Sbjct: 240 QFSAEFGLTSRESEVLAWLSKGKTNRDIAQILGLSPRTVDKHLEQIYAKLGVENR 294


>gi|39934323|ref|NP_946599.1| two-component LuxR family transcriptional regulator
           [Rhodopseudomonas palustris CGA009]
 gi|39648171|emb|CAE26691.1| two-component transcriptional regulator, LuxR family
           [Rhodopseudomonas palustris CGA009]
          Length = 308

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
            +  +F LT RE E L W+S+GKT+ +IA ILG+S  TV+ ++  I  K   + R
Sbjct: 240 QFSAEFGLTSRESEVLAWLSKGKTNRDIAQILGLSPRTVDKHLEQIYAKLGVENR 294


>gi|11465809|ref|NP_053953.1| ORF29 [Porphyra purpurea]
 gi|1723332|sp|P51343|YCF29_PORPU RecName: Full=Probable transcriptional regulator ycf29
 gi|1276809|gb|AAC08229.1| hypothetical chloroplast ORF 29 [Porphyra purpurea]
          Length = 209

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE   L  + +G T+ EIAVIL  S   V  Y++ +++KT T+ R+  + Y+++NN+
Sbjct: 146 LTPREKSILNLVIDGLTNKEIAVILDTSIRNVEKYVSRLLQKTNTRNRTLLVKYSIKNNL 205

Query: 246 V 246
           +
Sbjct: 206 L 206


>gi|225175953|ref|ZP_03729945.1| two component transcriptional regulator, LuxR family [Dethiobacter
           alkaliphilus AHT 1]
 gi|225168541|gb|EEG77343.1| two component transcriptional regulator, LuxR family [Dethiobacter
           alkaliphilus AHT 1]
          Length = 225

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LTGREVE LT ++ G  + EIA  L +S+ TV  ++ASI  K    +R+ AI +A++  +
Sbjct: 154 LTGREVEVLTMVANGHRNQEIASRLYVSKRTVEAHLASIFSKLKVGSRTEAILFALKEGM 213

Query: 246 V 246
           +
Sbjct: 214 I 214


>gi|295095488|emb|CBK84578.1| transcriptional activator SdiA [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 173

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + + + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K     +     YA  
Sbjct: 110 EMKFSKREREILKWTAEGKTSAEIAIILSISENTVNFHQKNMQKKFNAPNKIQIACYAAA 169

Query: 243 NNIV 246
             ++
Sbjct: 170 TGLI 173


>gi|302544315|ref|ZP_07296657.1| LuxR family DNA-binding response regulator [Streptomyces
           hygroscopicus ATCC 53653]
 gi|302461933|gb|EFL25026.1| LuxR family DNA-binding response regulator [Streptomyces
           himastatinicus ATCC 53653]
          Length = 229

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E LT ++ GK + EIA  L I + TV  Y++ I+ K    +R+ A  YAV++ 
Sbjct: 146 QLTERETEVLTMLARGKANKEIARDLRIGQQTVKTYVSHILTKLGVHSRTQAAVYAVQSG 205

Query: 245 IV 246
           +V
Sbjct: 206 LV 207


>gi|269839470|ref|YP_003324162.1| LuxR family transcriptional regulator [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269791200|gb|ACZ43340.1| transcriptional regulator, LuxR family [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 188

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 39/65 (60%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           ++  LT REVE L  +++G  +  IA  LGIS +TV  ++ SI+ K    +R+ A+A A 
Sbjct: 122 EEVPLTQREVEVLALMADGLPNKAIAARLGISEHTVKFHVGSILAKLGASSRAEAVAIAA 181

Query: 242 RNNIV 246
           R  ++
Sbjct: 182 RKGLL 186


>gi|32141276|ref|NP_733677.1| response regulator [Streptomyces coelicolor A3(2)]
 gi|256784694|ref|ZP_05523125.1| response regulator [Streptomyces lividans TK24]
 gi|289768580|ref|ZP_06527958.1| response regulator [Streptomyces lividans TK24]
 gi|1542943|emb|CAA69209.1| redZ [Streptomyces coelicolor A3(2)]
 gi|24429546|emb|CAD55237.1| response regulator [Streptomyces coelicolor A3(2)]
 gi|289698779|gb|EFD66208.1| response regulator [Streptomyces lividans TK24]
          Length = 217

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  +++GKT+ E+A  L +S  TV +++  I+RK    TR+ A+A A  + 
Sbjct: 145 ELTPRETEVLLLLTQGKTNTEMAATLSVSPTTVRSHVHRILRKLGAATRAQAVAIAYESG 204

Query: 245 IV 246
           ++
Sbjct: 205 LL 206


>gi|134094678|ref|YP_001099753.1| putative two-component response regulator protein [Herminiimonas
           arsenicoxydans]
 gi|133738581|emb|CAL61626.1| Two-component response regulator, LuxR family [Herminiimonas
           arsenicoxydans]
          Length = 315

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 36/55 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           LT RE E L+W+++GKT+ +I  IL +S  TV+ ++  I  K   +TRS A+A A
Sbjct: 244 LTPRETEVLSWLAKGKTNRDIGDILQLSPRTVSKHLEHIFEKLGVETRSAAVAMA 298


>gi|30265432|ref|NP_847809.1| DNA-binding response regulator [Bacillus anthracis str. Ames]
 gi|47530989|ref|YP_022338.1| DNA-binding response regulator [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49188248|ref|YP_031501.1| DNA-binding response regulator [Bacillus anthracis str. Sterne]
 gi|49481286|ref|YP_039401.1| response regulator [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|52145220|ref|YP_086677.1| response regulator [Bacillus cereus E33L]
 gi|65317392|ref|ZP_00390351.1| COG2197: Response regulator containing a CheY-like receiver domain
           and an HTH DNA-binding domain [Bacillus anthracis str.
           A2012]
 gi|118480442|ref|YP_897593.1| DNA-binding response regulator [Bacillus thuringiensis str. Al
           Hakam]
 gi|165871317|ref|ZP_02215966.1| DNA-binding response regulator [Bacillus anthracis str. A0488]
 gi|167635732|ref|ZP_02394042.1| DNA-binding response regulator [Bacillus anthracis str. A0442]
 gi|167640431|ref|ZP_02398695.1| DNA-binding response regulator [Bacillus anthracis str. A0193]
 gi|170688212|ref|ZP_02879423.1| DNA-binding response regulator [Bacillus anthracis str. A0465]
 gi|170708051|ref|ZP_02898499.1| DNA-binding response regulator [Bacillus anthracis str. A0389]
 gi|177651955|ref|ZP_02934538.1| DNA-binding response regulator [Bacillus anthracis str. A0174]
 gi|190568889|ref|ZP_03021791.1| DNA-binding response regulator [Bacillus anthracis Tsiankovskii-I]
 gi|196036150|ref|ZP_03103550.1| DNA-binding response regulator [Bacillus cereus W]
 gi|196041030|ref|ZP_03108327.1| DNA-binding response regulator [Bacillus cereus NVH0597-99]
 gi|196045422|ref|ZP_03112653.1| DNA-binding response regulator [Bacillus cereus 03BB108]
 gi|218906592|ref|YP_002454426.1| DNA-binding response regulator [Bacillus cereus AH820]
 gi|225867394|ref|YP_002752772.1| DNA-binding response regulator [Bacillus cereus 03BB102]
 gi|227818179|ref|YP_002818188.1| DNA-binding response regulator [Bacillus anthracis str. CDC 684]
 gi|228918025|ref|ZP_04081555.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228930420|ref|ZP_04093421.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228936698|ref|ZP_04099489.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228949137|ref|ZP_04111407.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|229124916|ref|ZP_04254092.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           95/8201]
 gi|229187641|ref|ZP_04314778.1| Two component transcriptional regulator, LuxR [Bacillus cereus BGSC
           6E1]
 gi|229603380|ref|YP_002869624.1| DNA-binding response regulator [Bacillus anthracis str. A0248]
 gi|254687146|ref|ZP_05151004.1| DNA-binding response regulator [Bacillus anthracis str. CNEVA-9066]
 gi|254724071|ref|ZP_05185856.1| DNA-binding response regulator [Bacillus anthracis str. A1055]
 gi|254735533|ref|ZP_05193240.1| DNA-binding response regulator [Bacillus anthracis str. Western
           North America USA6153]
 gi|254742202|ref|ZP_05199889.1| DNA-binding response regulator [Bacillus anthracis str. Kruger B]
 gi|254755887|ref|ZP_05207919.1| DNA-binding response regulator [Bacillus anthracis str. Vollum]
 gi|254761599|ref|ZP_05213619.1| DNA-binding response regulator [Bacillus anthracis str. Australia
           94]
 gi|301056878|ref|YP_003795089.1| DNA-binding response regulator [Bacillus anthracis CI]
 gi|30260110|gb|AAP29295.1| DNA-binding response regulator [Bacillus anthracis str. Ames]
 gi|47506137|gb|AAT34813.1| DNA-binding response regulator [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49182175|gb|AAT57551.1| DNA-binding response regulator [Bacillus anthracis str. Sterne]
 gi|49332842|gb|AAT63488.1| response regulator [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|51978689|gb|AAU20239.1| response regulator [Bacillus cereus E33L]
 gi|118419667|gb|ABK88086.1| DNA-binding response regulator [Bacillus thuringiensis str. Al
           Hakam]
 gi|164712984|gb|EDR18512.1| DNA-binding response regulator [Bacillus anthracis str. A0488]
 gi|167511651|gb|EDR87033.1| DNA-binding response regulator [Bacillus anthracis str. A0193]
 gi|167528841|gb|EDR91598.1| DNA-binding response regulator [Bacillus anthracis str. A0442]
 gi|170127024|gb|EDS95903.1| DNA-binding response regulator [Bacillus anthracis str. A0389]
 gi|170667905|gb|EDT18657.1| DNA-binding response regulator [Bacillus anthracis str. A0465]
 gi|172082659|gb|EDT67723.1| DNA-binding response regulator [Bacillus anthracis str. A0174]
 gi|190559956|gb|EDV13939.1| DNA-binding response regulator [Bacillus anthracis Tsiankovskii-I]
 gi|195991317|gb|EDX55285.1| DNA-binding response regulator [Bacillus cereus W]
 gi|196023629|gb|EDX62305.1| DNA-binding response regulator [Bacillus cereus 03BB108]
 gi|196028198|gb|EDX66808.1| DNA-binding response regulator [Bacillus cereus NVH0597-99]
 gi|218537324|gb|ACK89722.1| DNA-binding response regulator [Bacillus cereus AH820]
 gi|225787376|gb|ACO27593.1| DNA-binding response regulator [Bacillus cereus 03BB102]
 gi|227004175|gb|ACP13918.1| DNA-binding response regulator [Bacillus anthracis str. CDC 684]
 gi|228595795|gb|EEK53478.1| Two component transcriptional regulator, LuxR [Bacillus cereus BGSC
           6E1]
 gi|228658546|gb|EEL14210.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           95/8201]
 gi|228810578|gb|EEM56929.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228822907|gb|EEM68748.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228829267|gb|EEM74903.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228841613|gb|EEM86727.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|229267788|gb|ACQ49425.1| DNA-binding response regulator [Bacillus anthracis str. A0248]
 gi|300379047|gb|ADK07951.1| DNA-binding response regulator [Bacillus cereus biovar anthracis
           str. CI]
          Length = 215

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLHLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|302526791|ref|ZP_07279133.1| predicted protein [Streptomyces sp. AA4]
 gi|302435686|gb|EFL07502.1| predicted protein [Streptomyces sp. AA4]
          Length = 71

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 24/62 (38%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +L  RE+  L  ++EG ++ EIA  LG S +TV N +  +M +   + R+ A AYAVRN 
Sbjct: 10  QLGERELRVLRLVAEGYSNSEIAAELGWSEHTVKNALYDLMARLGVRNRAHAAAYAVRNG 69

Query: 245 IV 246
           ++
Sbjct: 70  LI 71


>gi|121533453|ref|ZP_01665281.1| two component transcriptional regulator, LuxR family [Thermosinus
           carboxydivorans Nor1]
 gi|121308012|gb|EAX48926.1| two component transcriptional regulator, LuxR family [Thermosinus
           carboxydivorans Nor1]
          Length = 225

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  +++G ++ EIA  L +S  TV N++ +I RK     R+ A+ YA+R+ I
Sbjct: 161 LTYRELEVLQLVAQGLSNSEIAQKLYLSEKTVKNHLTNIFRKINVTDRTQALIYAIRHKI 220

Query: 246 V 246
           V
Sbjct: 221 V 221


>gi|9622950|gb|AAF89989.1|AF210630_2 AHL-dependent transcriptional regulator CinR [Rhizobium
           leguminosarum]
          Length = 241

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 2/73 (2%)

Query: 176 YDVHWGKDF--ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           Y++H   D    L+ RE+ECL W + GK   +I+VILGIS +T  +Y+ +   K    T 
Sbjct: 167 YELHGENDPVPALSPREIECLHWTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATI 226

Query: 234 SGAIAYAVRNNIV 246
           S A + AV+  I+
Sbjct: 227 SAAASRAVQLRII 239


>gi|198283772|ref|YP_002220093.1| LuxR family transcriptional regulator [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218665417|ref|YP_002426403.1| autoinducer-binding transcriptional regulator, LuxR family
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|71044540|gb|AAV53702.2| AfeR [Acidithiobacillus ferrooxidans]
 gi|198248293|gb|ACH83886.1| transcriptional regulator, LuxR family [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218517630|gb|ACK78216.1| autoinducer-binding transcriptional regulator, LuxR family
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 237

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 34/57 (59%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +L+ REVE L W  EGKTS EIA IL I+  TVN +I+  M K     ++ A+  A 
Sbjct: 175 QLSCREVEVLRWTGEGKTSGEIANILNITERTVNFHISKAMAKLNAVNKTAAVLQAA 231


>gi|325066389|ref|ZP_08125062.1| two component LuxR family transcriptional regulator [Actinomyces
           oris K20]
          Length = 234

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 61/129 (47%), Gaps = 12/129 (9%)

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRD--RLWEIG-------LLAAYQANMFKSYD 177
           ++   SL   + +   G ++L P    I+ D  RLW  G       +     A    S  
Sbjct: 109 EDGASSLAGAIHQAVAGNLVLSPTSSAIISDQARLWASGSSRPSESIPVPTHAQQPPSPL 168

Query: 178 VHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
            H      L+ RE E LT + + KT+ +IA  L +S  TV  ++++I+ K   + R GA 
Sbjct: 169 PHG---VTLSEREREVLTLVVDAKTNKQIATRLRVSEATVKTHVSAIIAKLGVQDRVGAA 225

Query: 238 AYAVRNNIV 246
            YA+++N+V
Sbjct: 226 VYALQHNLV 234


>gi|284050985|ref|ZP_06381195.1| two component transcriptional regulator, LuxR family protein
           [Arthrospira platensis str. Paraca]
          Length = 222

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 98/210 (46%), Gaps = 19/210 (9%)

Query: 51  ALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKY---YNVLQRPTE 107
           ++++Y+  S + ++     QE     +V    P  +V  +A+ E D +     V  +P  
Sbjct: 17  SISDYLEMSGYFVISATNGQEAL--QLVEKHQPHLIVTDIAMPEMDGFELVKRVRSQPGF 74

Query: 108 LFCPVF----HTLPENITP--PAGMDNRYCSLTFDVARIRIGLMLLFPKGRIIL---RDR 158
              PV     HT  E        G DN Y    F++  + + +  L  + ++I    R R
Sbjct: 75  RLLPVIFLTAHTSTEERIRGYQLGCDN-YLPKPFELEELGVVIRSLLERSQLIEAEWRSR 133

Query: 159 LWEIGLLAAYQANMFKSYDVHW--GKDFELTGREVECLTWISEGKTSDEIAVILGISRNT 216
           + E   L+ + ++  K +  H     +  LT RE + L  ++EG ++ +I   L +S  T
Sbjct: 134 INEP--LSNHTSSSHKRHHFHSLSTTNIHLTEREQQVLNLLTEGLSNIKIGDSLHLSSRT 191

Query: 217 VNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           V  Y++S++RKT +  R+  + +A+ N+++
Sbjct: 192 VEKYVSSLLRKTDSSNRAELVRFALENDLI 221


>gi|229158972|ref|ZP_04287029.1| Two component transcriptional regulator, LuxR [Bacillus cereus ATCC
           4342]
 gi|228624583|gb|EEK81353.1| Two component transcriptional regulator, LuxR [Bacillus cereus ATCC
           4342]
          Length = 215

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLHLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|302562273|ref|ZP_07314615.1| response regulator, two-component system [Streptomyces griseoflavus
           Tu4000]
 gi|302479891|gb|EFL42984.1| response regulator, two-component system [Streptomyces griseoflavus
           Tu4000]
          Length = 220

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 38/64 (59%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +D  LT RE+E L  I++G ++ EIA  L IS+ TV  +++ I+ K   + R  A+ YA 
Sbjct: 155 RDLPLTPRELEVLRLIADGLSNSEIAAALLISQETVKTFVSRILAKLGLRDRVQAVVYAY 214

Query: 242 RNNI 245
           R  +
Sbjct: 215 RRGL 218


>gi|325104166|ref|YP_004273820.1| two component transcriptional regulator, LuxR family [Pedobacter
           saltans DSM 12145]
 gi|324973014|gb|ADY51998.1| two component transcriptional regulator, LuxR family [Pedobacter
           saltans DSM 12145]
          Length = 217

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 40/64 (62%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + EL+ RE+E L  ISEG T+ EIA  L +S+ TV  +  +++ KT  K  +  I YAV+
Sbjct: 154 EIELSDRELEVLGLISEGLTNIEIANKLFLSKRTVEGHRQNLINKTKVKNSAALIKYAVK 213

Query: 243 NNIV 246
           N ++
Sbjct: 214 NGLI 217


>gi|86358518|ref|YP_470410.1| autoinducer transcriptional regulator protein [Rhizobium etli CFN
           42]
 gi|86282620|gb|ABC91683.1| autoinducer transcriptional regulator protein [Rhizobium etli CFN
           42]
          Length = 260

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 2/73 (2%)

Query: 176 YDVHWGKDF--ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           Y++H   D    L+ RE+ECL W + GK   +I+VILGIS +T  +Y+ +   K    T 
Sbjct: 186 YELHGENDPVPTLSPREIECLHWTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATI 245

Query: 234 SGAIAYAVRNNIV 246
           S A + AV+  I+
Sbjct: 246 SAAASRAVQLRII 258


>gi|71492988|gb|AAZ32754.1| MrtR [Mesorhizobium tianshanense]
          Length = 272

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 2/73 (2%)

Query: 176 YDVHWGKDF--ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           Y++H   D    L+ RE+ECL W + GK   +I+VILGIS +T  +Y+ +   K    T 
Sbjct: 198 YELHGENDPVPALSPREIECLHWTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATI 257

Query: 234 SGAIAYAVRNNIV 246
           S A + AV+  I+
Sbjct: 258 SAAASRAVQLRII 270


>gi|228994130|ref|ZP_04154030.1| Two component transcriptional regulator, LuxR [Bacillus
           pseudomycoides DSM 12442]
 gi|228765582|gb|EEM14236.1| Two component transcriptional regulator, LuxR [Bacillus
           pseudomycoides DSM 12442]
          Length = 215

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 3/78 (3%)

Query: 169 QANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKT 228
           QA   +S ++H      LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K 
Sbjct: 141 QAEKQESSNIHVDV---LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILGKL 197

Query: 229 ATKTRSGAIAYAVRNNIV 246
               R+ A  YAV+N +V
Sbjct: 198 NLSDRTQAALYAVKNGVV 215


>gi|218677979|ref|ZP_03525876.1| transcriptional regulator, LuxR family protein [Rhizobium etli CIAT
           894]
          Length = 121

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 2/73 (2%)

Query: 176 YDVHWGKDF--ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           Y++H   D    L+ RE+ECL W + GK   +I+VILGIS +T  +Y+ +   K    T 
Sbjct: 47  YELHGENDPVPALSPREIECLHWTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATI 106

Query: 234 SGAIAYAVRNNIV 246
           S A + AV+  I+
Sbjct: 107 SAAASRAVQLRII 119


>gi|149186879|ref|ZP_01865189.1| transcriptional regulator, LuxR family protein [Erythrobacter sp.
           SD-21]
 gi|148829546|gb|EDL47987.1| transcriptional regulator, LuxR family protein [Erythrobacter sp.
           SD-21]
          Length = 226

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L  REVE L WI++GKT+ EIA ILG++  TV  +IA + +K     R+       R  I
Sbjct: 164 LPRREVEILHWIAKGKTNAEIAAILGVAAPTVATHIARMFQKLDVNDRAALAVKGFRYGI 223

Query: 246 V 246
           +
Sbjct: 224 I 224


>gi|91776759|ref|YP_546515.1| LuxR family transcriptional regulator [Methylobacillus flagellatus
           KT]
 gi|91710746|gb|ABE50674.1| transcriptional regulator, LuxR family [Methylobacillus flagellatus
           KT]
          Length = 272

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           +T RE E L W+  GK++ EIA IL IS  TV N++ +I+RK   + RS A A A R  +
Sbjct: 210 ITPREKEILQWVHTGKSNWEIATILEISPLTVKNHMQNILRKLDVQNRSHAAAKAYRLGL 269

Query: 246 V 246
           +
Sbjct: 270 I 270


>gi|325293769|ref|YP_004279633.1| two-component response regulator protein [Agrobacterium sp. H13-3]
 gi|325061622|gb|ADY65313.1| putative two-component response regulator protein [Agrobacterium
           sp. H13-3]
          Length = 309

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 177 DVHWGKD-FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSG 235
           D H  KD F LT RE E L WI++GK++ +I  ILG+S  TVN ++  I  K   + R+ 
Sbjct: 238 DDHLLKDHFALTTRESEVLLWIAKGKSNRDIGDILGLSARTVNKHLEQIYVKLGVENRAS 297

Query: 236 AIAYAV 241
           A   A 
Sbjct: 298 AAVKAA 303


>gi|229099838|ref|ZP_04230762.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock3-29]
 gi|228683584|gb|EEL37538.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock3-29]
          Length = 215

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|229105997|ref|ZP_04236618.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock3-28]
 gi|228677392|gb|EEL31648.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock3-28]
          Length = 215

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|188534209|ref|YP_001908006.1| Regulatory protein [Erwinia tasmaniensis Et1/99]
 gi|188029251|emb|CAO97128.1| Regulatory protein [Erwinia tasmaniensis Et1/99]
          Length = 240

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 37/58 (63%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
            +L+ RE+E L W +EGKTS EI++IL IS+NTVN +   + ++     ++   +YA 
Sbjct: 178 LDLSERELEVLKWTAEGKTSAEISLILSISQNTVNFHQKKMQKRFNAPNKTQIASYAA 235


>gi|158320230|ref|YP_001512737.1| two component LuxR family transcriptional regulator [Alkaliphilus
           oremlandii OhILAs]
 gi|158140429|gb|ABW18741.1| two component transcriptional regulator, LuxR family [Alkaliphilus
           oremlandii OhILAs]
          Length = 224

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 37/61 (60%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E LT ++EG  + EI   L IS  TV N++++I +K     R+ A  YA ++N
Sbjct: 161 ELTRREYEVLTLLAEGINNKEIGDCLFISEKTVKNHVSNIFKKINVNDRTQAAIYAYKHN 220

Query: 245 I 245
           I
Sbjct: 221 I 221


>gi|253575856|ref|ZP_04853190.1| response regulator [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251844650|gb|EES72664.1| response regulator [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 242

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 64/137 (46%), Gaps = 6/137 (4%)

Query: 112 VFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPK--GRIILRDR----LWEIGLL 165
           VF TL +  T     D    SL   +  +  G   + PK  G++I + R    L E G +
Sbjct: 100 VFETLRKGATGYLLKDMEAESLINAIRTVAEGNAFIHPKVTGKLIQQLRRMEYLSETGAI 159

Query: 166 AAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIM 225
           A   A          G D  LT RE E L  ++EG+++  I   L IS  TV N+++SI+
Sbjct: 160 AEDTAIREAGVKFVAGDDNPLTRREAEVLRLMAEGRSNKMIGEHLFISEKTVKNHVSSIL 219

Query: 226 RKTATKTRSGAIAYAVR 242
           +K     R+ A+  A++
Sbjct: 220 QKMDVDDRTQAVINAIK 236


>gi|229118901|ref|ZP_04248248.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock1-3]
 gi|228664557|gb|EEL20052.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock1-3]
          Length = 215

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|239825761|ref|YP_002948385.1| LuxR family transcriptional regulator [Geobacillus sp. WCH70]
 gi|239806054|gb|ACS23119.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. WCH70]
          Length = 199

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 38/57 (66%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           LT  E+  L  ISE KT+ EI+ +L ISR TV ++++SI+RK    +R GA+  A++
Sbjct: 138 LTKIELNILQLISEDKTNTEISELLNISRRTVEHHVSSILRKLDVDSRVGAVVKAMK 194


>gi|209550247|ref|YP_002282164.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536003|gb|ACI55938.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 241

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 2/73 (2%)

Query: 176 YDVHWGKDF--ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           Y++H   D    L+ RE+ECL W + GK   +I+VILGIS +T  +Y+ +   K    T 
Sbjct: 167 YELHGENDPVPALSPREIECLHWTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATI 226

Query: 234 SGAIAYAVRNNIV 246
           S A + AV+  I+
Sbjct: 227 SAAASRAVQLRII 239


>gi|209548302|ref|YP_002280219.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534058|gb|ACI53993.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 70

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           +T RE E + W++ GKT+ EI  IL IS  TVN +IA+   +      +  +A A+RN I
Sbjct: 9   VTPRETEIIGWMAAGKTAAEIGTILAISHITVNTHIANAKARLGVFKDTALVAAALRNGI 68

Query: 246 V 246
           +
Sbjct: 69  I 69


>gi|85706509|ref|ZP_01037602.1| two-component response regulator [Roseovarius sp. 217]
 gi|85668921|gb|EAQ23789.1| two-component response regulator [Roseovarius sp. 217]
          Length = 232

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           DF LT RE E +T +  G    +IA  L I+R TV  ++A+ ++KT  K+R  A+ +A+ 
Sbjct: 161 DFGLTRREAEIMTMLGGGAPVSDIADALDITRQTVRVHLANAIKKTGLKSREAAVRFAME 220

Query: 243 N 243
           N
Sbjct: 221 N 221


>gi|300117929|ref|ZP_07055696.1| DNA-binding response regulator [Bacillus cereus SJ1]
 gi|298724793|gb|EFI65468.1| DNA-binding response regulator [Bacillus cereus SJ1]
          Length = 215

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLHLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|124266442|ref|YP_001020446.1| response regulator [Methylibium petroleiphilum PM1]
 gi|124259217|gb|ABM94211.1| response regulator [Methylibium petroleiphilum PM1]
          Length = 245

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 66/131 (50%), Gaps = 11/131 (8%)

Query: 127 DNRYCSLTFDVARIRIGLMLLFPK--GRIILRDRLWEIGLLAAYQANMFKSYD------- 177
           ++R+  L  ++ +I  G   L P    R++   RL + G +A   A+    +        
Sbjct: 115 EDRFEVLVEELQKIVRGQPPLSPAIARRLLSHFRLGDSGSMALDSAHAPGDFQPARPAAP 174

Query: 178 -VHWGKDFE-LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSG 235
            V+   D E LT RE E LT++S+G T  EIA ++GI   TVN++I +I RK    +R+ 
Sbjct: 175 AVYAEPDHERLTPRETEVLTYLSKGFTIKEIAGLMGIKWFTVNDHIKAIYRKLNVSSRAE 234

Query: 236 AIAYAVRNNIV 246
           A   A +  +V
Sbjct: 235 AAVLASKQGLV 245


>gi|229199533|ref|ZP_04326194.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           m1293]
 gi|228583938|gb|EEK42095.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           m1293]
          Length = 215

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|221065714|ref|ZP_03541819.1| two component transcriptional regulator, LuxR family [Comamonas
           testosteroni KF-1]
 gi|220710737|gb|EED66105.1| two component transcriptional regulator, LuxR family [Comamonas
           testosteroni KF-1]
          Length = 254

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 1/66 (1%)

Query: 182 KDFE-LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           K++E LT RE E L  I++GK + EI   L IS  TV+ ++ +I RK   +TR+ A+ YA
Sbjct: 189 KNYEPLTEREKEVLRLIAQGKRTHEIGSYLKISTLTVSTHVKNIYRKMQVRTRAQAVRYA 248

Query: 241 VRNNIV 246
           V   I+
Sbjct: 249 VLKGII 254


>gi|91786468|ref|YP_547420.1| two component LuxR family transcriptional regulator [Polaromonas
           sp. JS666]
 gi|91695693|gb|ABE42522.1| two component transcriptional regulator, LuxR family [Polaromonas
           sp. JS666]
          Length = 297

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 32/48 (66%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           LT RE E L+W+++GKT+ +I  ILG+S  TVN ++  I  K   +TR
Sbjct: 238 LTPRETEVLSWLAKGKTNKDIGDILGMSHRTVNKHLEHIFEKLGVETR 285


>gi|229094522|ref|ZP_04225591.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock3-42]
 gi|228688906|gb|EEL42736.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock3-42]
          Length = 215

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLHLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|218232786|ref|YP_002370188.1| DNA-binding response regulator [Bacillus cereus B4264]
 gi|218160743|gb|ACK60735.1| DNA-binding response regulator [Bacillus cereus B4264]
          Length = 215

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|159040348|ref|YP_001539601.1| two component LuxR family transcriptional regulator [Salinispora
           arenicola CNS-205]
 gi|157919183|gb|ABW00611.1| two component transcriptional regulator, LuxR family [Salinispora
           arenicola CNS-205]
          Length = 219

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 46/83 (55%), Gaps = 2/83 (2%)

Query: 164 LLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           L+  Y A +  + D     +  LT RE+E L  I++G ++ EIA  L IS+ TV  Y++ 
Sbjct: 138 LVGRYAARIRPAED--SSSEIPLTPRELEVLRLIADGLSNSEIAATLVISQETVKTYVSR 195

Query: 224 IMRKTATKTRSGAIAYAVRNNIV 246
           I+ K   + R  A+ YA R+ +V
Sbjct: 196 ILTKLDLRDRVQAVVYAYRSGLV 218


>gi|89100033|ref|ZP_01172903.1| response regulator [Bacillus sp. NRRL B-14911]
 gi|89085267|gb|EAR64398.1| response regulator [Bacillus sp. NRRL B-14911]
          Length = 210

 Score = 49.7 bits (117), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 41/61 (67%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE+E L  ++EGKT+ EIA  L I+  TV  ++++I+ K   + R+ A+ YA +++
Sbjct: 148 ELTSREMEILLLMTEGKTNQEIADELFIALKTVKTHVSNILSKLQVQDRTQAVIYAFKHS 207

Query: 245 I 245
           +
Sbjct: 208 L 208


>gi|262281348|ref|ZP_06059129.1| transcriptional activator protein phzR [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257174|gb|EEY75911.1| transcriptional activator protein phzR [Acinetobacter calcoaceticus
           RUH2202]
          Length = 238

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT RE E L W +EGKTS EIA ILG++  TVN ++ + M+K     +  A   AV
Sbjct: 178 LTNREKEVLRWTAEGKTSAEIAQILGVTERTVNFHLCNSMQKLNVNNKISAAIRAV 233


>gi|206970021|ref|ZP_03230974.1| DNA-binding response regulator [Bacillus cereus AH1134]
 gi|229193664|ref|ZP_04320607.1| Two component transcriptional regulator, LuxR [Bacillus cereus ATCC
           10876]
 gi|206734598|gb|EDZ51767.1| DNA-binding response regulator [Bacillus cereus AH1134]
 gi|228589817|gb|EEK47693.1| Two component transcriptional regulator, LuxR [Bacillus cereus ATCC
           10876]
          Length = 215

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|327439935|dbj|BAK16300.1| response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Solibacillus silvestris StLB046]
          Length = 232

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 159 LWEIGLLAAYQANMFKSYDVH-WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTV 217
           L E  L ++    M  ++  +    + +L+ RE E +  ++ G +S +IA +L IS  T+
Sbjct: 143 LMEANLFSSQVGEMLFNHPCYVENNEIKLSKREFEVMKCVAFGYSSKQIAHLLEISETTI 202

Query: 218 NNYIASIMRKTATKTRSGAIAYAVRNNIV 246
             YI S+M KT T  R+ A+A+  +  I+
Sbjct: 203 KQYIKSVMSKTNTSNRTHAVAFLFQKRIL 231


>gi|299771984|ref|YP_003734010.1| Transcriptional activator protein phzR [Acinetobacter sp. DR1]
 gi|284158686|gb|ADB80058.1| AqsR [Acinetobacter sp. DR1]
 gi|298702072|gb|ADI92637.1| Transcriptional activator protein [Acinetobacter sp. DR1]
          Length = 238

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT RE E L W +EGKTS EIA ILG++  TVN ++ + M+K     +  A   AV
Sbjct: 178 LTNREKEVLRWTAEGKTSAEIAQILGVTERTVNFHLCNSMQKLNVNNKISAAIRAV 233


>gi|228942557|ref|ZP_04105092.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|228975490|ref|ZP_04136045.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228982123|ref|ZP_04142415.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis Bt407]
 gi|228777661|gb|EEM25936.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis Bt407]
 gi|228784284|gb|EEM32308.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228817150|gb|EEM63240.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|326943209|gb|AEA19105.1| two-component response regulator yhcZ [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 215

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|229176087|ref|ZP_04303581.1| Two component transcriptional regulator, LuxR [Bacillus cereus MM3]
 gi|228607431|gb|EEK64759.1| Two component transcriptional regulator, LuxR [Bacillus cereus MM3]
          Length = 215

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|167581251|ref|ZP_02374125.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis TXDOH]
 gi|167619336|ref|ZP_02387967.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis Bt4]
 gi|257138549|ref|ZP_05586811.1| ATP-dependent transcription regulator LuxR [Burkholderia
           thailandensis E264]
          Length = 237

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT REVE L W ++GKTS EI+ IL IS +TVN ++ + + K  T  ++ A+  A 
Sbjct: 176 LTEREVEVLKWAADGKTSGEISKILAISVDTVNFHVKNAILKLRTANKTAAVVRAA 231


>gi|94497651|ref|ZP_01304219.1| putative transcription regulator protein [Sphingomonas sp. SKA58]
 gi|94422868|gb|EAT07901.1| putative transcription regulator protein [Sphingomonas sp. SKA58]
          Length = 208

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/38 (57%), Positives = 28/38 (73%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           LT REVECL W + GKT++EI +ILG+ R TV  +I S
Sbjct: 144 LTKREVECLRWAAAGKTNEEIGIILGLQRTTVRFHIRS 181


>gi|229164358|ref|ZP_04292288.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           R309803]
 gi|228619101|gb|EEK75997.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           R309803]
          Length = 215

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|153011539|ref|YP_001372753.1| regulatory protein LuxR [Ochrobactrum anthropi ATCC 49188]
 gi|151563427|gb|ABS16924.1| regulatory protein LuxR [Ochrobactrum anthropi ATCC 49188]
          Length = 260

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REV+CL W + GKT  EIA IL I+R TV  Y+ +   K     R+ A+A A+   I
Sbjct: 191 LTPREVDCLRWAANGKTDGEIAEILSIARWTVVTYLQNAKIKLNCSNRTSAVATALSLGI 250

Query: 246 V 246
           +
Sbjct: 251 I 251


>gi|307944862|ref|ZP_07660200.1| ATP-dependent transcription regulator LuxR [Roseibium sp.
           TrichSKD4]
 gi|307772076|gb|EFO31299.1| ATP-dependent transcription regulator LuxR [Roseibium sp.
           TrichSKD4]
          Length = 240

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 46/89 (51%), Gaps = 1/89 (1%)

Query: 154 ILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-LTGREVECLTWISEGKTSDEIAVILGI 212
           +L+DR  E   LA +     K   +H       LT RE+ECL W+S G  + E+A  L I
Sbjct: 147 VLQDREAEFHFLANFLHLRMKDVALHAHSSAPVLTRRELECLKWLSAGLRTAELADKLAI 206

Query: 213 SRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           S  TV  +I +   K + KTR  A+A AV
Sbjct: 207 SGPTVEFHIKNAREKLSAKTREQAVARAV 235


>gi|228924157|ref|ZP_04087433.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228835647|gb|EEM81012.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
          Length = 214

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 154 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGI 213

Query: 246 V 246
           V
Sbjct: 214 V 214


>gi|297196049|ref|ZP_06913447.1| two-component system response regulator [Streptomyces
           pristinaespiralis ATCC 25486]
 gi|197723312|gb|EDY67220.1| two-component system response regulator [Streptomyces
           pristinaespiralis ATCC 25486]
          Length = 219

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H   D  LT RE E L  ++EG++S +IA IL IS  TV  + A+++RK   + R     
Sbjct: 150 HETPDQILTAREEEVLKLVAEGRSSKDIAEILFISVKTVQRHRANLLRKLGLRDRLDLTR 209

Query: 239 YAVRNNIV 246
           YA+R  ++
Sbjct: 210 YAIRAGLI 217


>gi|91978329|ref|YP_570988.1| response regulator receiver [Rhodopseudomonas palustris BisB5]
 gi|91684785|gb|ABE41087.1| two component transcriptional regulator, LuxR family
           [Rhodopseudomonas palustris BisB5]
          Length = 309

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
            +  +F LT RE E L W+S+GKT+ +IA ILG+S  TV+ ++  I  K   + R
Sbjct: 240 EFATEFGLTSRESEVLAWLSKGKTNRDIAQILGLSPRTVDKHLEQIYAKLGVENR 294


>gi|294142230|ref|YP_003558208.1| LuxR family transcriptional regulator [Shewanella violacea DSS12]
 gi|293328699|dbj|BAJ03430.1| transcriptional regulator, LuxR family [Shewanella violacea DSS12]
          Length = 250

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L W SEGK+S EI +I  I+  TV  ++ +I +K   + R+ AI  A+R  
Sbjct: 189 ELTKREREILAWSSEGKSSWEIGMICSITERTVKFHLKNIYKKLNVQNRAQAIVCAIRQG 248

Query: 245 IV 246
           ++
Sbjct: 249 LI 250


>gi|228911248|ref|ZP_04075053.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis IBL 200]
 gi|228848424|gb|EEM93273.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis IBL 200]
          Length = 215

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|83720643|ref|YP_442349.1| ATP-dependent transcription regulator LuxR [Burkholderia
           thailandensis E264]
 gi|83654468|gb|ABC38531.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia thailandensis E264]
          Length = 241

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT REVE L W ++GKTS EI+ IL IS +TVN ++ + + K  T  ++ A+  A 
Sbjct: 180 LTEREVEVLKWAADGKTSGEISKILAISVDTVNFHVKNAILKLRTANKTAAVVRAA 235


>gi|51893773|ref|YP_076464.1| two-component response regulator [Symbiobacterium thermophilum IAM
           14863]
 gi|51857462|dbj|BAD41620.1| two-component response regulator [Symbiobacterium thermophilum IAM
           14863]
          Length = 224

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 36/58 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           L+ RE + L  I+ G T+ EIA  LG+S NTV NY+ SI+ K   + R  A A+A+ N
Sbjct: 157 LSPREAQILRRIAAGNTNREIAEQLGLSENTVKNYVKSILAKLNLENRVQAAAWALNN 214


>gi|71057001|emb|CAI51628.1| eR transcriptional regulator [Acidithiobacillus ferrooxidans]
          Length = 214

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 34/57 (59%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +L+ REVE L W  EGKTS EIA IL I+  TVN +I+  M K     ++ A+  A 
Sbjct: 152 QLSCREVEVLRWTGEGKTSGEIANILNITERTVNFHISKAMAKLNAVNKTAAVLQAA 208


>gi|260467388|ref|ZP_05813560.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|259028848|gb|EEW30152.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
          Length = 242

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           LT RE E L W ++GK++D+IA ILG++RNTV ++  +I  K      + AI  A+R  
Sbjct: 180 LTARERELLEWSAQGKSTDDIACILGVTRNTVESHQRNIRAKLDAINVAHAIVKALRRQ 238


>gi|295402434|ref|ZP_06812387.1| two component transcriptional regulator, LuxR family [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312112712|ref|YP_003991028.1| LuxR family transcriptional regulator [Geobacillus sp. Y4.1MC1]
 gi|294975525|gb|EFG51150.1| two component transcriptional regulator, LuxR family [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311217813|gb|ADP76417.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. Y4.1MC1]
          Length = 210

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 42/62 (67%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE+E L  +++GKT+ EIA  L I+  TV  ++++I+ K   + R+ A+ YA +++
Sbjct: 148 ELTNREMEVLLLMAQGKTNQEIADELFIAVKTVKVHVSNILSKLGVQDRTQAVIYAFKHS 207

Query: 245 IV 246
           +V
Sbjct: 208 LV 209


>gi|229000199|ref|ZP_04159768.1| Two component transcriptional regulator, LuxR [Bacillus mycoides
           Rock3-17]
 gi|229007721|ref|ZP_04165313.1| Two component transcriptional regulator, LuxR [Bacillus mycoides
           Rock1-4]
 gi|228753589|gb|EEM03035.1| Two component transcriptional regulator, LuxR [Bacillus mycoides
           Rock1-4]
 gi|228759531|gb|EEM08508.1| Two component transcriptional regulator, LuxR [Bacillus mycoides
           Rock3-17]
          Length = 215

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILGKLNLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|73662256|ref|YP_301037.1| two-component response regulator [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|72494771|dbj|BAE18092.1| two-component response regulator [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
          Length = 207

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +L+ RE E LT +++GKT+ EIA  L +S  T+  +++ I  K     R+ A  YA++NN
Sbjct: 146 KLSKRESEVLTEMAKGKTNKEIAETLFVSEKTIKTHVSHIFSKLQVTDRTQAAIYAMQNN 205

Query: 245 IV 246
           ++
Sbjct: 206 LI 207


>gi|56421302|ref|YP_148620.1| hypothetical protein GK2767 [Geobacillus kaustophilus HTA426]
 gi|56381144|dbj|BAD77052.1| hypothetical protein [Geobacillus kaustophilus HTA426]
          Length = 500

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+E L  ++EG ++ E A  L +S  TV +Y+++I++K   K R+ AI  A+R+ I
Sbjct: 440 LSPREIEVLKLVAEGASTYEAAKRLHLSEYTVRDYVSAILQKMNAKNRTEAIVKAIRDGI 499

Query: 246 V 246
           +
Sbjct: 500 I 500


>gi|325291914|ref|YP_004277778.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
 gi|325059767|gb|ADY63458.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
          Length = 248

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 36/57 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE+ CL    +G+ S+EIAV LG+S +TVN Y+ S   K  +  R  AIA A+R
Sbjct: 187 LSEREIACLQLAGDGRISEEIAVKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIR 243


>gi|238795934|ref|ZP_04639446.1| Transcriptional activator protein echR [Yersinia mollaretii ATCC
           43969]
 gi|238720139|gb|EEQ11943.1| Transcriptional activator protein echR [Yersinia mollaretii ATCC
           43969]
          Length = 245

 Score = 49.3 bits (116), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 59/119 (49%), Gaps = 15/119 (12%)

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYD---VHWGKD 183
           D+ Y   + +V + +I ++L+    +           +L  YQ N+ ++ +   V  G++
Sbjct: 132 DSIYFDESIEVNKEKIQMLLILTHDK-----------MLGLYQKNINENNELGKVPNGRE 180

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
              + RE E L W S GKT  EIA+ILGI R+TV  +I +++RK        AI   + 
Sbjct: 181 I-FSPRENEILYWASVGKTYSEIAIILGIKRSTVKFHIGNVVRKLGVLNAKHAIRLGIE 238


>gi|182677912|ref|YP_001832058.1| LuxR family transcriptional regulator [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182633795|gb|ACB94569.1| transcriptional regulator, LuxR family [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 268

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 169 QANMFKSYDVHWGKDFE-LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRK 227
           Q   F+ +    G D   +T RE+E L+W +EGKT ++I+V++ IS+ TV  ++ S   K
Sbjct: 189 QQRAFEMHHQDEGIDINTITKREIEALSWSAEGKTLEDISVLMRISQETVKAHLDSARYK 248

Query: 228 TATKTRSGAIAYAVRNNIV 246
                R  A+A A+R  ++
Sbjct: 249 LGALNRIHAVAKAIRAGLI 267


>gi|30023441|ref|NP_835072.1| two-component response regulator yhcZ [Bacillus cereus ATCC 14579]
 gi|228961674|ref|ZP_04123282.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|229051082|ref|ZP_04194629.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH676]
 gi|229112824|ref|ZP_04242356.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock1-15]
 gi|229130659|ref|ZP_04259615.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           BDRD-Cer4]
 gi|229147955|ref|ZP_04276296.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           BDRD-ST24]
 gi|296505833|ref|YP_003667533.1| two-component response regulator yhcZ [Bacillus thuringiensis
           BMB171]
 gi|29899002|gb|AAP12273.1| Two-component response regulator yhcZ [Bacillus cereus ATCC 14579]
 gi|228635605|gb|EEK92094.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           BDRD-ST24]
 gi|228652998|gb|EEL08880.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           BDRD-Cer4]
 gi|228670658|gb|EEL25970.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock1-15]
 gi|228722293|gb|EEL73691.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH676]
 gi|228798024|gb|EEM45029.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|296326885|gb|ADH09813.1| two-component response regulator yhcZ [Bacillus thuringiensis
           BMB171]
          Length = 215

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|13488404|ref|NP_109411.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
 gi|14028158|dbj|BAB54750.1| probable transcriptional regulator [Mesorhizobium loti MAFF303099]
          Length = 242

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           LT RE E L W ++GK++D+IA ILG++RNTV ++  +I  K      + AI  A+R  
Sbjct: 180 LTARERELLEWSAQGKSTDDIACILGVTRNTVESHQRNIRGKLDAINVAHAIVKALRRQ 238


>gi|76811685|ref|YP_334182.1| ATP-dependent transcription regulator LuxR [Burkholderia
           pseudomallei 1710b]
 gi|124386221|ref|YP_001028861.1| ATP-dependent transcription regulator LuxR [Burkholderia mallei
           NCTC 10229]
 gi|126450742|ref|YP_001081227.1| ATP-dependent transcription regulator LuxR [Burkholderia mallei
           NCTC 10247]
 gi|167003830|ref|ZP_02269610.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei PRL-20]
 gi|167720437|ref|ZP_02403673.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei DM98]
 gi|167816634|ref|ZP_02448314.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 91]
 gi|167825038|ref|ZP_02456509.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 9]
 gi|167846546|ref|ZP_02472054.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei B7210]
 gi|167895126|ref|ZP_02482528.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 7894]
 gi|167903510|ref|ZP_02490715.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei NCTC 13177]
 gi|167919762|ref|ZP_02506853.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei BCC215]
 gi|242317090|ref|ZP_04816106.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106b]
 gi|254195948|ref|ZP_04902374.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei S13]
 gi|76581138|gb|ABA50613.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1710b]
 gi|124294241|gb|ABN03510.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei NCTC 10229]
 gi|126243612|gb|ABO06705.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei NCTC 10247]
 gi|169652693|gb|EDS85386.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei S13]
 gi|242140329|gb|EES26731.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106b]
 gi|243060693|gb|EES42879.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei PRL-20]
          Length = 237

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT REVE L W ++GKTS EI+ IL IS +TVN ++ + + K  T  ++ A+  A 
Sbjct: 176 LTEREVEVLKWAADGKTSGEISKILAISVDTVNFHVKNAILKLRTANKTAAVVRAA 231


>gi|15887874|ref|NP_353555.1| LuxR family transcriptional regulator [Agrobacterium tumefaciens
           str. C58]
 gi|15155462|gb|AAK86340.1| transcriptional regulator, LuxR family [Agrobacterium tumefaciens
           str. C58]
          Length = 251

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 36/57 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE+ CL    +G+ S+EIAV LG+S +TVN Y+ S   K  +  R  AIA A+R
Sbjct: 190 LSEREIACLQLAGDGRISEEIAVKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIR 246


>gi|239834457|ref|ZP_04682785.1| regulatory protein LuxR [Ochrobactrum intermedium LMG 3301]
 gi|239822520|gb|EEQ94089.1| regulatory protein LuxR [Ochrobactrum intermedium LMG 3301]
          Length = 260

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REV+CL W + GKT  EIA IL I+R TV  Y+ +   K     R+ A+A A+   I
Sbjct: 191 LTPREVDCLRWAANGKTDGEIAEILNIARWTVVTYLQNAKIKLNCSNRTSAVATALSLGI 250

Query: 246 V 246
           +
Sbjct: 251 I 251


>gi|271962079|ref|YP_003336275.1| response regulator receiver protein [Streptosporangium roseum DSM
           43021]
 gi|270505254|gb|ACZ83532.1| response regulator receiver protein [Streptosporangium roseum DSM
           43021]
          Length = 212

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E LT I+ G+++ EIA  L ++  TV  ++++++ K   + R+ A  YAVRN +
Sbjct: 152 LTDREREVLTLIASGRSNREIARELAVAEKTVKTHVSNVLMKLGVQDRTQAALYAVRNGL 211


>gi|218675092|ref|ZP_03524761.1| LuxR family transcriptional regulator [Rhizobium etli GR56]
          Length = 81

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 25/61 (40%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           +T RE E + W++ GKT+ EI  IL IS  TVN +IA+   K      +  +A A+RN I
Sbjct: 20  VTPREREIIGWMAAGKTAAEIGAILAISPITVNTHIANAKAKLGVFKETALVAAALRNGI 79

Query: 246 V 246
           +
Sbjct: 80  I 80


>gi|53725659|ref|YP_102421.1| ATP-dependent transcription regulator LuxR [Burkholderia mallei
           ATCC 23344]
 gi|121600864|ref|YP_993677.1| ATP-dependent transcription regulator LuxR [Burkholderia mallei
           SAVP1]
 gi|126442199|ref|YP_001059696.1| ATP-dependent transcription regulator LuxR [Burkholderia
           pseudomallei 668]
 gi|126451641|ref|YP_001066980.1| ATP-dependent transcription regulator LuxR [Burkholderia
           pseudomallei 1106a]
 gi|134277810|ref|ZP_01764525.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 305]
 gi|217421088|ref|ZP_03452593.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 576]
 gi|226200000|ref|ZP_03795550.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pakistan 9]
 gi|237813089|ref|YP_002897540.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei MSHR346]
 gi|238562977|ref|ZP_00439585.2| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei GB8 horse 4]
 gi|254177786|ref|ZP_04884441.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei ATCC 10399]
 gi|254184304|ref|ZP_04890894.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1655]
 gi|254199322|ref|ZP_04905688.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei FMH]
 gi|254205635|ref|ZP_04911987.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei JHU]
 gi|254261005|ref|ZP_04952059.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1710a]
 gi|254296964|ref|ZP_04964417.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 406e]
 gi|254357791|ref|ZP_04974064.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei 2002721280]
 gi|52429082|gb|AAU49675.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei ATCC 23344]
 gi|121229674|gb|ABM52192.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei SAVP1]
 gi|126221692|gb|ABN85198.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 668]
 gi|126225283|gb|ABN88823.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106a]
 gi|134251460|gb|EBA51539.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 305]
 gi|147748918|gb|EDK55992.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei FMH]
 gi|147753078|gb|EDK60143.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei JHU]
 gi|148026918|gb|EDK84939.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei 2002721280]
 gi|157806879|gb|EDO84049.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 406e]
 gi|160698825|gb|EDP88795.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei ATCC 10399]
 gi|184214835|gb|EDU11878.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1655]
 gi|217396500|gb|EEC36517.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 576]
 gi|225928056|gb|EEH24093.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pakistan 9]
 gi|237504732|gb|ACQ97050.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei MSHR346]
 gi|238521581|gb|EEP85031.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei GB8 horse 4]
 gi|254219694|gb|EET09078.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1710a]
          Length = 241

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT REVE L W ++GKTS EI+ IL IS +TVN ++ + + K  T  ++ A+  A 
Sbjct: 180 LTEREVEVLKWAADGKTSGEISKILAISVDTVNFHVKNAILKLRTANKTAAVVRAA 235


>gi|225628596|ref|ZP_03786630.1| LuxR family transcriptional regulator [Brucella ceti str. Cudo]
 gi|225616442|gb|EEH13490.1| LuxR family transcriptional regulator [Brucella ceti str. Cudo]
          Length = 268

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REV+CL W + GKT  EIA IL I+R TV  Y+ +   K     R+ A+A A+   I
Sbjct: 199 LTPREVDCLRWAANGKTDGEIAEILSIARWTVVTYLQNAKIKLNCSNRTSAVATALSLGI 258

Query: 246 V 246
           +
Sbjct: 259 I 259


>gi|294853143|ref|ZP_06793815.1| HTH-type quorum sensing-dependent transcriptional regulator vjbR
           [Brucella sp. NVSL 07-0026]
 gi|294818798|gb|EFG35798.1| HTH-type quorum sensing-dependent transcriptional regulator vjbR
           [Brucella sp. NVSL 07-0026]
          Length = 268

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REV+CL W + GKT  EIA IL I+R TV  Y+ +   K     R+ A+A A+   I
Sbjct: 199 LTPREVDCLRWAANGKTDGEIAEILSIARWTVVTYLQNAKIKLNCSNRTSAVATALSLGI 258

Query: 246 V 246
           +
Sbjct: 259 I 259


>gi|167739431|ref|ZP_02412205.1| LuxR family regulatory protein [Burkholderia pseudomallei 14]
 gi|167911761|ref|ZP_02498852.1| LuxR family regulatory protein [Burkholderia pseudomallei 112]
 gi|254191335|ref|ZP_04897839.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pasteur 52237]
 gi|157939007|gb|EDO94677.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pasteur 52237]
          Length = 237

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT REVE L W ++GKTS EI+ IL IS +TVN ++ + + K  T  ++ A+  A 
Sbjct: 176 LTEREVEVLKWAADGKTSGEISKILAISVDTVNFHVKNAILKLRTANKTAAVVRAA 231


>gi|226312803|ref|YP_002772697.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
 gi|226095751|dbj|BAH44193.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
          Length = 228

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 40/62 (64%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE++ L  I++G  +D+IA  L IS  TV  ++  I++K   + R+ A+A A+R+ 
Sbjct: 166 ELTDRELDVLQQIADGYRNDQIAQNLFISEGTVKTHVHRILQKMGVEDRTQAVAKALRHK 225

Query: 245 IV 246
           IV
Sbjct: 226 IV 227


>gi|187930859|ref|YP_001901345.1| two component transcriptional regulator, LuxR family [Ralstonia
           pickettii 12J]
 gi|241664112|ref|YP_002982472.1| two component LuxR family transcriptional regulator [Ralstonia
           pickettii 12D]
 gi|187728903|gb|ACD30066.1| two component transcriptional regulator, LuxR family [Ralstonia
           pickettii 12J]
 gi|240866139|gb|ACS63800.1| two component transcriptional regulator, LuxR family [Ralstonia
           pickettii 12D]
          Length = 201

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 1/84 (1%)

Query: 164 LLAAYQANMFKSYDVHWGKD-FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIA 222
           L++  Q  + +    H      +L+ RE E L W + GKTS EIA ILG+S+ TV+ ++ 
Sbjct: 116 LISIVQTRLARRPRTHAAHPPVQLSEREAEVLAWSARGKTSGEIATILGLSKRTVDFHMD 175

Query: 223 SIMRKTATKTRSGAIAYAVRNNIV 246
           +   K    TR  A+  A    I+
Sbjct: 176 NAREKLGVATRIEAVVRASSAGII 199


>gi|75760127|ref|ZP_00740188.1| Two-component response regulator yhcZ [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|218900537|ref|YP_002448948.1| DNA-binding response regulator [Bacillus cereus G9842]
 gi|228903890|ref|ZP_04068005.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis IBL 4222]
 gi|228968544|ref|ZP_04129531.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|74492399|gb|EAO55554.1| Two-component response regulator yhcZ [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|218542579|gb|ACK94973.1| DNA-binding response regulator [Bacillus cereus G9842]
 gi|228791148|gb|EEM38763.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|228855799|gb|EEN00344.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis IBL 4222]
          Length = 215

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|300088572|ref|YP_003759094.1| LuxR family two component transcriptional regulator
           [Dehalogenimonas lykanthroporepellens BL-DC-9]
 gi|299528305|gb|ADJ26773.1| two component transcriptional regulator, LuxR family
           [Dehalogenimonas lykanthroporepellens BL-DC-9]
          Length = 220

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 35/59 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           LT RE+E LT I+ GK + EIA  L I   TV N+I  I  K   K+R  AI+Y +R N
Sbjct: 159 LTAREIEILTLIAAGKGNREIAETLFIEEKTVKNHINVIYSKLRIKSRYEAISYMLRQN 217


>gi|218460014|ref|ZP_03500105.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli Kim 5]
          Length = 198

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L +++EG TS EI+ +L IS +TV+ Y+  +  K   K R  A+A A R+ +
Sbjct: 137 LTRREMEILHYLAEGMTSMEISKMLKISNHTVDWYMNGLQNKLKAKNRQQAVALAFRHGL 196

Query: 246 V 246
           +
Sbjct: 197 I 197


>gi|258541258|ref|YP_003186691.1| LuxR family transcriptional regulator [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632336|dbj|BAH98311.1| two component response regulator LuxR [Acetobacter pasteurianus IFO
           3283-01]
 gi|256635393|dbj|BAI01362.1| two component response regulator LuxR [Acetobacter pasteurianus IFO
           3283-03]
 gi|256638448|dbj|BAI04410.1| two component response regulator LuxR [Acetobacter pasteurianus IFO
           3283-07]
 gi|256641502|dbj|BAI07457.1| two component response regulator LuxR [Acetobacter pasteurianus IFO
           3283-22]
 gi|256644557|dbj|BAI10505.1| two component response regulator LuxR [Acetobacter pasteurianus IFO
           3283-26]
 gi|256647612|dbj|BAI13553.1| two component response regulator LuxR [Acetobacter pasteurianus IFO
           3283-32]
 gi|256650665|dbj|BAI16599.1| two component response regulator LuxR [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256653656|dbj|BAI19583.1| two component response regulator LuxR [Acetobacter pasteurianus IFO
           3283-12]
          Length = 299

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 33/57 (57%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           K   LT RE E L WI++GKT+ +IA IL IS  TVN ++     K   + R+ A A
Sbjct: 235 KRLNLTAREAEVLFWIAKGKTNRDIAEILSISHRTVNKHLEQSYIKIGVENRAAATA 291


>gi|167837236|ref|ZP_02464119.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis MSMB43]
          Length = 237

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT REVE L W ++GKTS EI+ IL IS +TVN ++ + + K  T  ++ A+  A 
Sbjct: 176 LTEREVEVLKWAADGKTSGEISKILAISVDTVNFHVKNAILKLRTANKTAAVVRAA 231


>gi|311103299|ref|YP_003976152.1| sensory box protein 1 [Achromobacter xylosoxidans A8]
 gi|310757988|gb|ADP13437.1| sensory box protein 1 [Achromobacter xylosoxidans A8]
          Length = 499

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G+  +LT RE E L  + +G T  EIA  L +SRNTV N++A++  K     RS AI +A
Sbjct: 422 GELADLTPREREILGLMCQGHTDAEIAASLHLSRNTVRNHVAALYSKLDVHRRSAAIIWA 481

Query: 241 VRNNIV 246
            +  IV
Sbjct: 482 RQRGIV 487


>gi|90022619|ref|YP_528446.1| response regulator receiver domain-containing protein
           [Saccharophagus degradans 2-40]
 gi|89952219|gb|ABD82234.1| response regulator receiver [Saccharophagus degradans 2-40]
          Length = 303

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 38/61 (62%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           + F +T RE +   W+++GKT+ EIA I+ IS  TVN ++  + +K A   R+ A A A+
Sbjct: 236 EQFGITKRESDVFLWLAKGKTNREIAQIIDISPRTVNKHLEQLFKKLAVDNRTTAAAMAI 295

Query: 242 R 242
           +
Sbjct: 296 Q 296


>gi|53719957|ref|YP_108943.1| LuxR family regulatory protein [Burkholderia pseudomallei K96243]
 gi|52210371|emb|CAH36350.1| LuxR family regulatory protein [Burkholderia pseudomallei K96243]
 gi|156105364|gb|ABU49181.1| BpsR5 [Burkholderia pseudomallei]
          Length = 241

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT REVE L W ++GKTS EI+ IL IS +TVN ++ + + K  T  ++ A+  A 
Sbjct: 180 LTEREVEVLKWAADGKTSGEISKILAISVDTVNFHVKNAILKLRTANKTAAVVRAA 235


>gi|327189418|gb|EGE56584.1| LuxR family transcriptional regulator [Rhizobium etli CNPAF512]
          Length = 65

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 25/61 (40%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           +T RE E + W++ GKT+ EI  IL IS  TVN +IA+   K      +  +A A+RN I
Sbjct: 4   VTPREREIIGWMAAGKTAAEIGAILAISPITVNTHIANAKAKLGVFKETALVAEALRNGI 63

Query: 246 V 246
           +
Sbjct: 64  I 64


>gi|148558318|ref|YP_001257186.1| LuxR family transcriptional regulator [Brucella ovis ATCC 25840]
 gi|148369603|gb|ABQ62475.1| transcriptional regulator, LuxR family [Brucella ovis ATCC 25840]
          Length = 268

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REV+CL W + GKT  EIA IL I+R TV  Y+ +   K     R+ A+A A+   I
Sbjct: 199 LTPREVDCLRWAANGKTDGEIAEILSIARWTVVTYLQNAKIKLNCSNRTSAVATALSLGI 258

Query: 246 V 246
           +
Sbjct: 259 I 259


>gi|332528409|ref|ZP_08404401.1| two component LuxR family transcriptional regulator [Hylemonella
           gracilis ATCC 19624]
 gi|332042088|gb|EGI78422.1| two component LuxR family transcriptional regulator [Hylemonella
           gracilis ATCC 19624]
          Length = 312

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 33/49 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRS 234
           LT RE E L+W+++GKT+ +I  ILG+S  TVN ++  I  K   +TR+
Sbjct: 251 LTPRETEVLSWLAKGKTNRDIGDILGMSPRTVNKHLEHIFEKLGVETRT 299


>gi|294010385|ref|YP_003543845.1| LuxR-family transcriptional regulator [Sphingobium japonicum UT26S]
 gi|292673715|dbj|BAI95233.1| LuxR-family transcriptional regulator [Sphingobium japonicum UT26S]
          Length = 265

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/38 (57%), Positives = 28/38 (73%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           LT REVECL W + GKT++EI +ILG+ R TV  +I S
Sbjct: 201 LTKREVECLRWAAAGKTNEEIGIILGLQRTTVRFHIRS 238


>gi|291616969|ref|YP_003519711.1| SdiA [Pantoea ananatis LMG 20103]
 gi|291151999|gb|ADD76583.1| SdiA [Pantoea ananatis LMG 20103]
 gi|327393397|dbj|BAK10819.1| cell division activating regulatory protein SdiA [Pantoea ananatis
           AJ13355]
          Length = 240

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 37/61 (60%), Gaps = 2/61 (3%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G DF  + RE+E L W +EGKTS EI++IL IS +TVN Y  ++ ++     ++    YA
Sbjct: 177 GNDF--SQRELEILRWTAEGKTSQEISLILSISEHTVNFYQKNMKKRFNVSNKTQIACYA 234

Query: 241 V 241
            
Sbjct: 235 A 235


>gi|270308516|ref|YP_003330574.1| DNA-binding response regulator, LuxR family [Dehalococcoides sp.
           VS]
 gi|270154408|gb|ACZ62246.1| DNA-binding response regulator, LuxR family [Dehalococcoides sp.
           VS]
          Length = 225

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 5/68 (7%)

Query: 180 WGKDFE-----LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRS 234
            GKD       LT RE + LT I+ G T+ +IA  L IS  T+ N++++I+RK     R+
Sbjct: 152 LGKDASNFVTPLTNREKQILTLIANGNTNKQIANSLEISEQTIKNHVSAILRKLNANDRA 211

Query: 235 GAIAYAVR 242
            A+  A+R
Sbjct: 212 HAVVVAIR 219


>gi|18104535|gb|AAL59595.1|AF393621_2 CinR [Rhizobium etli]
          Length = 241

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+ECL W + GK   +I+VILGIS +T  +Y+ +   K    T S A + AV+  I
Sbjct: 179 LSPREIECLHWTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATISAAASRAVQLRI 238

Query: 246 V 246
           +
Sbjct: 239 I 239


>gi|300311949|ref|YP_003776041.1| two component response regulator protein [Herbaspirillum
           seropedicae SmR1]
 gi|300074734|gb|ADJ64133.1| two component response regulator protein [Herbaspirillum
           seropedicae SmR1]
          Length = 318

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           LT RE + L W+ +GKT+ +IA ILG+S  TVN ++  I  K   +TRS A   A
Sbjct: 259 LTPRESDVLLWLGKGKTNRDIADILGMSPRTVNKHLEHIFVKLGVETRSAAAVLA 313


>gi|297560053|ref|YP_003679027.1| LuxR family transcriptional regulator [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296844501|gb|ADH66521.1| two component transcriptional regulator, LuxR family [Nocardiopsis
           dassonvillei subsp. dassonvillei DSM 43111]
          Length = 200

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 36/58 (62%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           D  LT REV+ L   SEG +  +IA  L ++  TV NY+++ M+KT T+TR  A  YA
Sbjct: 137 DCPLTDREVDVLRATSEGYSVADIAAQLHLAEGTVRNYLSNAMQKTQTRTRHEAARYA 194


>gi|256014910|ref|YP_003104919.1| transcriptional regulator, LuxR family [Brucella microti CCM 4915]
 gi|255997570|gb|ACU49257.1| transcriptional regulator, LuxR family [Brucella microti CCM 4915]
          Length = 259

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REV+CL W + GKT  EIA IL I+R TV  Y+ +   K     R+ A+A A+   I
Sbjct: 190 LTPREVDCLRWAANGKTDGEIAEILSIARWTVVTYLQNAKIKLNCSNRTSAVATALSLGI 249

Query: 246 V 246
           +
Sbjct: 250 I 250


>gi|226311708|ref|YP_002771602.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
 gi|226094656|dbj|BAH43098.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
          Length = 215

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E + ++  GKT+ EI+  L I+ NTV N++ +I+ K     R    AYAVR+++
Sbjct: 153 LTPREREIVMYVGAGKTNREISEALIIAENTVKNHLKNILEKLQLANRVQLAAYAVRHHL 212

Query: 246 V 246
           V
Sbjct: 213 V 213


>gi|288919634|ref|ZP_06413962.1| transcriptional regulator, LuxR family [Frankia sp. EUN1f]
 gi|288348923|gb|EFC83172.1| transcriptional regulator, LuxR family [Frankia sp. EUN1f]
          Length = 90

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  +++G  + +IA  L IS NTV N+I +I+ K    +R  A+ YAVR  +
Sbjct: 27  LTDREMEVLRLVAKGLNNRDIAKQLYISENTVKNHIRNILEKLQLHSRMEAVVYAVREKL 86

Query: 246 V 246
           +
Sbjct: 87  L 87


>gi|117165074|emb|CAJ88627.1| putative two component response regulator-like [Streptomyces
           ambofaciens ATCC 23877]
          Length = 223

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%)

Query: 171 NMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTAT 230
           +  +    H  ++  LT RE E L  ++EG ++ +IA  LGIS + V   +AS++ K   
Sbjct: 146 DRLRESGQHRPREVSLTARENEVLLLLAEGMSNKQIARRLGISSHGVKRIVASLLLKLGA 205

Query: 231 KTRSGAIAYAVRNNIV 246
             R+ A+  A++N ++
Sbjct: 206 PNRTAAVVTAIQNGLI 221


>gi|229035051|ref|ZP_04188998.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH1271]
 gi|228728236|gb|EEL79265.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH1271]
          Length = 215

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|167563421|ref|ZP_02356337.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia oklahomensis EO147]
 gi|167570595|ref|ZP_02363469.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia oklahomensis C6786]
          Length = 237

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT REVE L W ++GKTS EI+ IL IS +TVN ++ + + K  T  ++ A+  A 
Sbjct: 176 LTEREVEVLKWAADGKTSGEISKILAISVDTVNFHVKNAILKLRTANKTAAVVRAA 231


>gi|306841076|ref|ZP_07473798.1| regulatory protein LuxR [Brucella sp. BO2]
 gi|306846307|ref|ZP_07478868.1| regulatory protein LuxR [Brucella sp. BO1]
 gi|306273302|gb|EFM55171.1| regulatory protein LuxR [Brucella sp. BO1]
 gi|306288886|gb|EFM60191.1| regulatory protein LuxR [Brucella sp. BO2]
          Length = 258

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REV+CL W + GKT  EIA IL I+R TV  Y+ +   K     R+ A+A A+   I
Sbjct: 189 LTPREVDCLRWAANGKTDGEIAEILSIARWTVVTYLQNAKIKLNCSNRTSAVATALSLGI 248

Query: 246 V 246
           +
Sbjct: 249 I 249


>gi|254699430|ref|ZP_05161258.1| regulatory protein LuxR [Brucella suis bv. 5 str. 513]
 gi|261749881|ref|ZP_05993590.1| regulatory protein LuxR [Brucella suis bv. 5 str. 513]
 gi|261739634|gb|EEY27560.1| regulatory protein LuxR [Brucella suis bv. 5 str. 513]
          Length = 259

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REV+CL W + GKT  EIA IL I+R TV  Y+ +   K     R+ A+A A+   I
Sbjct: 190 LTPREVDCLRWAANGKTDGEIAEILSIARWTVVTYLQNAKIKLNCSNRTSAVATALSLGI 249

Query: 246 V 246
           +
Sbjct: 250 I 250


>gi|228991252|ref|ZP_04151210.1| DNA-binding response regulator [Bacillus pseudomycoides DSM 12442]
 gi|228997351|ref|ZP_04156973.1| DNA-binding response regulator [Bacillus mycoides Rock3-17]
 gi|229004976|ref|ZP_04162703.1| DNA-binding response regulator [Bacillus mycoides Rock1-4]
 gi|228756324|gb|EEM05642.1| DNA-binding response regulator [Bacillus mycoides Rock1-4]
 gi|228762443|gb|EEM11368.1| DNA-binding response regulator [Bacillus mycoides Rock3-17]
 gi|228768476|gb|EEM17081.1| DNA-binding response regulator [Bacillus pseudomycoides DSM 12442]
          Length = 211

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  I++G+++ EIA  L I+  TV  ++++++ K     R+ A  YAV+N +
Sbjct: 151 LTKREKEVLREIAKGRSNKEIAAELHITEQTVKTHVSNVLAKLEVDDRTQAALYAVKNGV 210

Query: 246 V 246
           V
Sbjct: 211 V 211


>gi|255600849|ref|XP_002537550.1| conserved hypothetical protein [Ricinus communis]
 gi|223515958|gb|EEF24832.1| conserved hypothetical protein [Ricinus communis]
          Length = 219

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           L+ RE E L W+  GKT+ EI +IL IS NTV N++  I +K     R+ A+A
Sbjct: 155 LSDREQEILHWVRSGKTNLEIGMILNISANTVKNHLKRIFQKLDVSCRAQAVA 207


>gi|86748375|ref|YP_484871.1| two component LuxR family transcriptional regulator
           [Rhodopseudomonas palustris HaA2]
 gi|86571403|gb|ABD05960.1| two component transcriptional regulator, LuxR family
           [Rhodopseudomonas palustris HaA2]
          Length = 309

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (64%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           +F LT RE E L W+S+GKT+ +IA ILG+S  TV+ ++  I  K   + R
Sbjct: 244 EFGLTSRESEVLAWLSKGKTNRDIAQILGLSPRTVDKHLEQIYAKLGVENR 294


>gi|187927560|ref|YP_001898047.1| LuxR family transcriptional regulator [Ralstonia pickettii 12J]
 gi|187724450|gb|ACD25615.1| transcriptional regulator, LuxR family [Ralstonia pickettii 12J]
          Length = 253

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 33/56 (58%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT RE ECL W + GKTS EIA IL +S  TV  +I +  +K     R  A+A A+
Sbjct: 191 LTSREKECLQWAAAGKTSWEIARILSVSERTVIFHIGNATKKLGATNRRQAVARAI 246


>gi|325293644|ref|YP_004279508.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
 gi|325061497|gb|ADY65188.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
          Length = 238

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE++ + W ++GKTS EIA +L IS +TVN Y+ + +RK     R+  +A  +R  +
Sbjct: 177 LTKRELDVVRWTAQGKTSVEIAELLSISEHTVNTYMNNAIRKLDCVNRAQLVAKTIRLGL 236

Query: 246 V 246
           +
Sbjct: 237 I 237


>gi|254720638|ref|ZP_05182449.1| regulatory protein LuxR [Brucella sp. 83/13]
 gi|265985682|ref|ZP_06098417.1| regulatory protein LuxR [Brucella sp. 83/13]
 gi|264664274|gb|EEZ34535.1| regulatory protein LuxR [Brucella sp. 83/13]
          Length = 259

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REV+CL W + GKT  EIA IL I+R TV  Y+ +   K     R+ A+A A+   I
Sbjct: 190 LTPREVDCLRWAANGKTDGEIAEILSIARWTVVTYLQNAKIKLNCSNRTSAVATALSLGI 249

Query: 246 V 246
           +
Sbjct: 250 I 250


>gi|307152023|ref|YP_003887407.1| LuxR family two component transcriptional regulator [Cyanothece sp.
           PCC 7822]
 gi|306982251|gb|ADN14132.1| two component transcriptional regulator, LuxR family [Cyanothece
           sp. PCC 7822]
          Length = 226

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 86/191 (45%), Gaps = 17/191 (8%)

Query: 72  QKLDSIVSSDWPFDLVRCMALSEKDKY---YNVLQRPTELFCPVFHTLPENITPP----- 123
           Q+  S++ +  P  LV  + +   D Y     V QRP     PV     ++ T       
Sbjct: 36  QEALSLLETYHPHLLVSDIKMPRTDGYELVAQVRQRPEFRLLPVVFLTEKSTTHERIRGY 95

Query: 124 -AGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGK 182
            AG D  Y    F++  +   +  L  + +I+  +  ++   L   QA + KS       
Sbjct: 96  QAGCDV-YLPKPFEMEELGAVIRNLLERSQIMESEWRYKNRQLQEKQAELKKSQPPPPLP 154

Query: 183 DF-------ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSG 235
           +        ELT RE + L  +++G ++ EI   L +S  TV  Y++S++RKT T  R+ 
Sbjct: 155 ELPTLNPPPELTAREKQVLELLAQGLSNVEIGQQLHLSPRTVEKYVSSLLRKTETNNRAE 214

Query: 236 AIAYAVRNNIV 246
            + +A+ +++V
Sbjct: 215 LVRFALEHHLV 225


>gi|182677961|ref|YP_001832107.1| two component LuxR family transcriptional regulator [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182633844|gb|ACB94618.1| two component transcriptional regulator, LuxR family [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 309

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             LT RE E LTW++ GK++ +I  ILG+S  TV+ ++  +  K   + R  A A A++ 
Sbjct: 246 LNLTSREAEVLTWVARGKSNRDIGEILGLSPRTVDKHLEQVYAKIGVENRVAATALAIQT 305


>gi|163943094|ref|YP_001647978.1| two component LuxR family transcriptional regulator [Bacillus
           weihenstephanensis KBAB4]
 gi|229014574|ref|ZP_04171690.1| Two component transcriptional regulator, LuxR [Bacillus mycoides
           DSM 2048]
 gi|229065062|ref|ZP_04200357.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH603]
 gi|229136229|ref|ZP_04264978.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           BDRD-ST196]
 gi|229170116|ref|ZP_04297805.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH621]
 gi|163865291|gb|ABY46350.1| two component transcriptional regulator, LuxR family [Bacillus
           weihenstephanensis KBAB4]
 gi|228613347|gb|EEK70483.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH621]
 gi|228647209|gb|EEL03295.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           BDRD-ST196]
 gi|228716204|gb|EEL67920.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH603]
 gi|228746726|gb|EEL96613.1| Two component transcriptional regulator, LuxR [Bacillus mycoides
           DSM 2048]
          Length = 215

 Score = 49.3 bits (116), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHMSSILSKLHLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|328951086|ref|YP_004368421.1| two component transcriptional regulator, LuxR family [Marinithermus
           hydrothermalis DSM 14884]
 gi|328451410|gb|AEB12311.1| two component transcriptional regulator, LuxR family [Marinithermus
           hydrothermalis DSM 14884]
          Length = 216

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT REV+ L  +++G T+ EIA  LG+S  TV N ++ I  K     R+ A  YA+R  
Sbjct: 151 ELTEREVQILRLLAQGATNQEIADELGLSEKTVRNRLSEIFAKLHLNNRTQAALYAIREG 210

Query: 245 IV 246
           + 
Sbjct: 211 LA 212


>gi|269837258|ref|YP_003319486.1| transcriptional regulator, LuxR family [Sphaerobacter thermophilus
           DSM 20745]
 gi|269786521|gb|ACZ38664.1| transcriptional regulator, LuxR family [Sphaerobacter thermophilus
           DSM 20745]
          Length = 549

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REVE L  ++EGKT+  IA  L IS  TV  +I++I  K    +R+ A AYA  + I
Sbjct: 485 LTAREVEVLRLVAEGKTNRAIAEDLFISEKTVARHISNIFTKLDLSSRAAATAYAYEHGI 544

Query: 246 V 246
           V
Sbjct: 545 V 545


>gi|17230648|ref|NP_487196.1| two-component response regulator [Nostoc sp. PCC 7120]
 gi|17132251|dbj|BAB74855.1| two-component response regulator [Nostoc sp. PCC 7120]
          Length = 228

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 39/64 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  LTGRE+E L  +++GKT+ EIA +L I+  TV  ++ +I+ K     R  A+  A++
Sbjct: 157 DHPLTGRELEILALLAKGKTNQEIATVLYITPGTVRVHVHAILHKLEVSDRHQAVVVALQ 216

Query: 243 NNIV 246
             ++
Sbjct: 217 KRLI 220


>gi|23499883|ref|NP_699323.1| LuxR family transcriptional regulator [Brucella suis 1330]
 gi|62317073|ref|YP_222926.1| LuxR family transcriptional regulator [Brucella abortus bv. 1 str.
           9-941]
 gi|83269066|ref|YP_418357.1| LuxR family regulatory protein [Brucella melitensis biovar Abortus
           2308]
 gi|161620206|ref|YP_001594092.1| regulatory protein LuxR [Brucella canis ATCC 23365]
 gi|163844315|ref|YP_001621970.1| hypothetical protein BSUIS_B0125 [Brucella suis ATCC 23445]
 gi|189022339|ref|YP_001932080.1| Bacterial regulatory protein, LuxR family [Brucella abortus S19]
 gi|225685981|ref|YP_002733953.1| regulatory protein LuxR [Brucella melitensis ATCC 23457]
 gi|254691441|ref|ZP_05154695.1| regulatory protein LuxR [Brucella abortus bv. 6 str. 870]
 gi|254695262|ref|ZP_05157090.1| regulatory protein LuxR [Brucella abortus bv. 3 str. Tulya]
 gi|254698360|ref|ZP_05160188.1| regulatory protein LuxR [Brucella abortus bv. 2 str. 86/8/59]
 gi|254711984|ref|ZP_05173795.1| regulatory protein LuxR [Brucella ceti M644/93/1]
 gi|254715054|ref|ZP_05176865.1| regulatory protein LuxR [Brucella ceti M13/05/1]
 gi|254731805|ref|ZP_05190383.1| regulatory protein LuxR [Brucella abortus bv. 4 str. 292]
 gi|256043041|ref|ZP_05445986.1| regulatory protein LuxR [Brucella melitensis bv. 1 str. Rev.1]
 gi|256059638|ref|ZP_05449835.1| regulatory protein LuxR [Brucella neotomae 5K33]
 gi|256111973|ref|ZP_05452924.1| regulatory protein LuxR [Brucella melitensis bv. 3 str. Ether]
 gi|256256626|ref|ZP_05462162.1| regulatory protein LuxR [Brucella abortus bv. 9 str. C68]
 gi|256262895|ref|ZP_05465427.1| bacterial regulatory protein [Brucella melitensis bv. 2 str. 63/9]
 gi|260544312|ref|ZP_05820133.1| bacterial regulatory protein [Brucella abortus NCTC 8038]
 gi|260564274|ref|ZP_05834759.1| bacterial regulatory protein [Brucella melitensis bv. 1 str. 16M]
 gi|260568545|ref|ZP_05839014.1| bacterial regulatory protein [Brucella suis bv. 4 str. 40]
 gi|260757058|ref|ZP_05869406.1| regulatory protein LuxR [Brucella abortus bv. 6 str. 870]
 gi|260759571|ref|ZP_05871919.1| regulatory protein LuxR [Brucella abortus bv. 4 str. 292]
 gi|260762815|ref|ZP_05875147.1| regulatory protein LuxR [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882868|ref|ZP_05894482.1| regulatory protein LuxR [Brucella abortus bv. 9 str. C68]
 gi|261215627|ref|ZP_05929908.1| regulatory protein LuxR [Brucella abortus bv. 3 str. Tulya]
 gi|261216761|ref|ZP_05931042.1| regulatory protein LuxR [Brucella ceti M13/05/1]
 gi|261319628|ref|ZP_05958825.1| regulatory protein LuxR [Brucella ceti M644/93/1]
 gi|261323608|ref|ZP_05962805.1| regulatory protein LuxR [Brucella neotomae 5K33]
 gi|265989480|ref|ZP_06102037.1| regulatory protein LuxR [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993421|ref|ZP_06105978.1| regulatory protein LuxR [Brucella melitensis bv. 3 str. Ether]
 gi|297249982|ref|ZP_06933683.1| hypothetical protein BAYG_02758 [Brucella abortus bv. 5 str. B3196]
 gi|75505158|sp|Q579W9|VJBR_BRUAB RecName: Full=HTH-type quorum sensing-dependent transcriptional
           regulator vjbR
 gi|81751697|sp|Q8FXF9|VJBR_BRUSU RecName: Full=HTH-type quorum sensing-dependent transcriptional
           regulator vjbR
 gi|123754460|sp|Q2YJ50|VJBR_BRUA2 RecName: Full=HTH-type quorum sensing-dependent transcriptional
           regulator vjbR
 gi|190360175|sp|Q8YAY5|VJBR_BRUME RecName: Full=HTH-type quorum sensing-dependent transcriptional
           regulator vjbR
 gi|23463458|gb|AAN33328.1| transcriptional regulator, LuxR family [Brucella suis 1330]
 gi|62197266|gb|AAX75565.1| transcriptional regulator, LuxR family [Brucella abortus bv. 1 str.
           9-941]
 gi|82939340|emb|CAJ12284.1| Bacterial regulatory protein, LuxR family [Brucella melitensis
           biovar Abortus 2308]
 gi|161337017|gb|ABX63321.1| regulatory protein LuxR [Brucella canis ATCC 23365]
 gi|163675038|gb|ABY39148.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|189020913|gb|ACD73634.1| Bacterial regulatory protein, LuxR family [Brucella abortus S19]
 gi|225642086|gb|ACO01999.1| regulatory protein LuxR [Brucella melitensis ATCC 23457]
 gi|260097583|gb|EEW81457.1| bacterial regulatory protein [Brucella abortus NCTC 8038]
 gi|260151917|gb|EEW87010.1| bacterial regulatory protein [Brucella melitensis bv. 1 str. 16M]
 gi|260155210|gb|EEW90291.1| bacterial regulatory protein [Brucella suis bv. 4 str. 40]
 gi|260669889|gb|EEX56829.1| regulatory protein LuxR [Brucella abortus bv. 4 str. 292]
 gi|260673236|gb|EEX60057.1| regulatory protein LuxR [Brucella abortus bv. 2 str. 86/8/59]
 gi|260677166|gb|EEX63987.1| regulatory protein LuxR [Brucella abortus bv. 6 str. 870]
 gi|260872396|gb|EEX79465.1| regulatory protein LuxR [Brucella abortus bv. 9 str. C68]
 gi|260917234|gb|EEX84095.1| regulatory protein LuxR [Brucella abortus bv. 3 str. Tulya]
 gi|260921850|gb|EEX88418.1| regulatory protein LuxR [Brucella ceti M13/05/1]
 gi|261292318|gb|EEX95814.1| regulatory protein LuxR [Brucella ceti M644/93/1]
 gi|261299588|gb|EEY03085.1| regulatory protein LuxR [Brucella neotomae 5K33]
 gi|262764291|gb|EEZ10323.1| regulatory protein LuxR [Brucella melitensis bv. 3 str. Ether]
 gi|263000149|gb|EEZ12839.1| regulatory protein LuxR [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092732|gb|EEZ16941.1| bacterial regulatory protein [Brucella melitensis bv. 2 str. 63/9]
 gi|297173851|gb|EFH33215.1| hypothetical protein BAYG_02758 [Brucella abortus bv. 5 str. B3196]
 gi|326410305|gb|ADZ67369.1| Bacterial regulatory protein, LuxR family [Brucella melitensis M28]
 gi|326553598|gb|ADZ88237.1| Bacterial regulatory protein, LuxR family [Brucella melitensis
           M5-90]
          Length = 259

 Score = 48.9 bits (115), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REV+CL W + GKT  EIA IL I+R TV  Y+ +   K     R+ A+A A+   I
Sbjct: 190 LTPREVDCLRWAANGKTDGEIAEILSIARWTVVTYLQNAKIKLNCSNRTSAVATALSLGI 249

Query: 246 V 246
           +
Sbjct: 250 I 250


>gi|254706324|ref|ZP_05168152.1| regulatory protein LuxR [Brucella pinnipedialis M163/99/10]
 gi|254711385|ref|ZP_05173196.1| regulatory protein LuxR [Brucella pinnipedialis B2/94]
 gi|256029985|ref|ZP_05443599.1| regulatory protein LuxR [Brucella pinnipedialis M292/94/1]
 gi|256158149|ref|ZP_05456065.1| regulatory protein LuxR [Brucella ceti M490/95/1]
 gi|256252900|ref|ZP_05458436.1| regulatory protein LuxR [Brucella ceti B1/94]
 gi|261219988|ref|ZP_05934269.1| regulatory protein LuxR [Brucella ceti B1/94]
 gi|261313770|ref|ZP_05952967.1| regulatory protein LuxR [Brucella pinnipedialis M163/99/10]
 gi|261318991|ref|ZP_05958188.1| regulatory protein LuxR [Brucella pinnipedialis B2/94]
 gi|265987006|ref|ZP_06099563.1| regulatory protein LuxR [Brucella pinnipedialis M292/94/1]
 gi|265996667|ref|ZP_06109224.1| regulatory protein LuxR [Brucella ceti M490/95/1]
 gi|260918572|gb|EEX85225.1| regulatory protein LuxR [Brucella ceti B1/94]
 gi|261298214|gb|EEY01711.1| regulatory protein LuxR [Brucella pinnipedialis B2/94]
 gi|261302796|gb|EEY06293.1| regulatory protein LuxR [Brucella pinnipedialis M163/99/10]
 gi|262550964|gb|EEZ07125.1| regulatory protein LuxR [Brucella ceti M490/95/1]
 gi|264659203|gb|EEZ29464.1| regulatory protein LuxR [Brucella pinnipedialis M292/94/1]
          Length = 259

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REV+CL W + GKT  EIA IL I+R TV  Y+ +   K     R+ A+A A+   I
Sbjct: 190 LTPREVDCLRWAANGKTDGEIAEILSIARWTVVTYLQNAKIKLNCSNRTSAVATALSLGI 249

Query: 246 V 246
           +
Sbjct: 250 I 250


>gi|221196069|ref|ZP_03569116.1| N-acyl homoserine lactone transcriptional regulator [Burkholderia
           multivorans CGD2M]
 gi|221202743|ref|ZP_03575762.1| N-acyl homoserine lactone transcriptional regulator [Burkholderia
           multivorans CGD2]
 gi|221176677|gb|EEE09105.1| N-acyl homoserine lactone transcriptional regulator [Burkholderia
           multivorans CGD2]
 gi|221182623|gb|EEE15023.1| N-acyl homoserine lactone transcriptional regulator [Burkholderia
           multivorans CGD2M]
          Length = 239

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTAREREVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGASNKVQAVVKAISAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|190893853|ref|YP_001980395.1| transcriptional regulator protein, LuxR family [Rhizobium etli CIAT
           652]
 gi|190699132|gb|ACE93217.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CIAT 652]
          Length = 251

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L +++EG TS EI+ +L IS +TV+ Y+  +  K   K R  A+A A R+ +
Sbjct: 190 LTRREMEILHYLAEGMTSMEISKMLKISNHTVDWYMNGLQGKLKAKNRQQAVALAFRHGL 249

Query: 246 V 246
           +
Sbjct: 250 I 250


>gi|190892657|ref|YP_001979199.1| autoinducer transcriptional regulator protein [Rhizobium etli CIAT
           652]
 gi|190697936|gb|ACE92021.1| autoinducer transcriptional regulator protein [Rhizobium etli CIAT
           652]
          Length = 260

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+ECL W + GK   +I+VILGIS +T  +Y+ +   K    T S A + AV+  I
Sbjct: 198 LSPREIECLHWTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATISAAASRAVQLRI 257

Query: 246 V 246
           +
Sbjct: 258 I 258


>gi|330809090|ref|YP_004353552.1| response regulator, NarL family [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327377198|gb|AEA68548.1| putative response regulator, NarL family [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 272

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 40/62 (64%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT +E++CL W SEGKT+ EI+ IL  S  T++ ++ +  RK  + +R  A++ AV   
Sbjct: 192 DLTPKEMDCLYWASEGKTTWEISHILTCSERTIDFHLLNARRKLGSVSRQQAVSAAVACG 251

Query: 245 IV 246
           +V
Sbjct: 252 LV 253


>gi|229085213|ref|ZP_04217456.1| DNA-binding response regulator [Bacillus cereus Rock3-44]
 gi|228698080|gb|EEL50822.1| DNA-binding response regulator [Bacillus cereus Rock3-44]
          Length = 211

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  I++G+++ EIA  L I+  TV  ++++++ K     R+ A  YAV+N +
Sbjct: 151 LTKREKEVLREITKGRSNKEIAAELHITEQTVKTHVSNVLAKLEVDDRTQAALYAVKNGV 210

Query: 246 V 246
           V
Sbjct: 211 V 211


>gi|149915149|ref|ZP_01903677.1| two-component response regulator, putative [Roseobacter sp.
           AzwK-3b]
 gi|149810870|gb|EDM70709.1| two-component response regulator, putative [Roseobacter sp.
           AzwK-3b]
          Length = 299

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 46/92 (50%), Gaps = 6/92 (6%)

Query: 151 GRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVIL 210
           G  I RD L +I LL         S +      F+LT RE E L W++ GKT+ +I+ IL
Sbjct: 208 GVSIARDYLVKITLLEG------ASNEEKLRAAFDLTARESEVLFWLTLGKTNRDISAIL 261

Query: 211 GISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
            +S  TVN ++  + +K     R+ A   A R
Sbjct: 262 DLSARTVNKHLEQVFQKMGVDNRTSAAVLADR 293


>gi|206558215|sp|A5VTN1|VJBR_BRUO2 RecName: Full=HTH-type quorum sensing-dependent transcriptional
           regulator vjbR
          Length = 259

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REV+CL W + GKT  EIA IL I+R TV  Y+ +   K     R+ A+A A+   I
Sbjct: 190 LTPREVDCLRWAANGKTDGEIAEILSIARWTVVTYLQNAKIKLNCSNRTSAVATALSLGI 249

Query: 246 V 246
           +
Sbjct: 250 I 250


>gi|47177072|ref|YP_015683.1| hypothetical protein pHCG3_p118 [Oligotropha carboxidovorans OM5]
 gi|47115463|emb|CAG28516.1| probable TraR [Oligotropha carboxidovorans OM5]
          Length = 239

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 35/63 (55%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           +ELT REV CLTW S GKT  EIA +L I   TV NY+     K      + A+  AV  
Sbjct: 177 YELTPREVTCLTWASLGKTMSEIADLLQIDVRTVRNYLDLAREKLGGSNIAHAVRLAVMQ 236

Query: 244 NIV 246
           +++
Sbjct: 237 HLI 239


>gi|328951621|ref|YP_004368956.1| two component transcriptional regulator, LuxR family [Marinithermus
           hydrothermalis DSM 14884]
 gi|328451945|gb|AEB12846.1| two component transcriptional regulator, LuxR family [Marinithermus
           hydrothermalis DSM 14884]
          Length = 222

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT REV+ L  +++G T+ EIA  LG+S  TV N ++ I  K     R+ A  YA+R  
Sbjct: 151 ELTEREVQILRLLAQGATNQEIADELGLSEKTVRNRLSEIFAKLHLNNRTQAALYAIREG 210

Query: 245 IV 246
           + 
Sbjct: 211 LA 212


>gi|188586933|ref|YP_001918478.1| two component transcriptional regulator, LuxR family
           [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179351620|gb|ACB85890.1| two component transcriptional regulator, LuxR family
           [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 228

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 40/62 (64%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELTGRE E L  +++G T+ EI+  L IS  TV N++++I+RK     R+ A+  A++  
Sbjct: 165 ELTGREKEILELMAQGYTNKEISKELYISEKTVKNHVSNILRKMDVTDRTQAVITALKCG 224

Query: 245 IV 246
           +V
Sbjct: 225 VV 226


>gi|311743637|ref|ZP_07717443.1| LuxR family DNA-binding response regulator [Aeromicrobium marinum
           DSM 15272]
 gi|311312767|gb|EFQ82678.1| LuxR family DNA-binding response regulator [Aeromicrobium marinum
           DSM 15272]
          Length = 220

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 40/61 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE++ L  +++G ++ EIA  L IS NTV N+I +I+ K   K+R  A  YAVR+ +
Sbjct: 157 LTARELQVLRHVAKGFSNREIAGELFISENTVKNHIRNILEKLQMKSRMEAAMYAVRSRL 216

Query: 246 V 246
           V
Sbjct: 217 V 217


>gi|12620899|gb|AAG61129.1|AF330018_1 AHL receptor [Burkholderia cepacia ATCC 25416]
 gi|17939926|emb|CAD19536.1| CepR protein [Burkholderia cepacia]
 gi|288551614|gb|ADC53303.1| transcriptional activator [Burkholderia cepacia]
          Length = 239

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTAREREVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|138894116|ref|YP_001124569.1| DNA-binding response regulator [Geobacillus thermodenitrificans
           NG80-2]
 gi|196250655|ref|ZP_03149344.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. G11MC16]
 gi|134265629|gb|ABO65824.1| DNA-binding response regulator [Geobacillus thermodenitrificans
           NG80-2]
 gi|196209874|gb|EDY04644.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. G11MC16]
          Length = 210

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 41/62 (66%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE+E L  +++GKT+ E+A  L IS  TV  ++++I+ K   + R+ A+ YA R+ 
Sbjct: 148 QLTSREMEVLLLMAQGKTNQEMADELFISLKTVKVHVSNILAKLGVQDRTQAVIYAFRHG 207

Query: 245 IV 246
           +V
Sbjct: 208 LV 209


>gi|50085580|ref|YP_047090.1| putative two-component response regulator protein [Acinetobacter
           sp. ADP1]
 gi|49531556|emb|CAG69268.1| putative two-component response regulator protein [Acinetobacter
           sp. ADP1]
          Length = 320

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           +LT RE E   W++ GKT+ +IA IL +S  TVN ++  I  K   + R+ A+AY
Sbjct: 256 QLTQREAEVSHWLALGKTNKDIAEILELSPRTVNKHLEHIFEKLCVENRTAAVAY 310


>gi|149923436|ref|ZP_01911840.1| two component transcriptional regulator, LuxR family protein
           [Plesiocystis pacifica SIR-1]
 gi|149815688|gb|EDM75215.1| two component transcriptional regulator, LuxR family protein
           [Plesiocystis pacifica SIR-1]
          Length = 220

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E LT + EGK+S EIA ILG+S  T+  +   IM K      +G +  A+R  +
Sbjct: 156 LTKREREVLTLVGEGKSSPEIAKILGLSVKTIEGHRGRIMAKLGVHNVAGLVRQAIRIGL 215

Query: 246 V 246
           V
Sbjct: 216 V 216


>gi|313201574|ref|YP_004040232.1| LuxR family transcriptional regulator [Methylovorus sp. MP688]
 gi|26005747|dbj|BAC41336.1| transcription regulator like protein EpsA [Methylobacillus sp. 12S]
 gi|312440890|gb|ADQ84996.1| transcriptional regulator, LuxR family [Methylovorus sp. MP688]
          Length = 265

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 3/78 (3%)

Query: 164 LLAAYQANMFKSYDVHWGKDF---ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNY 220
           L   + A+   S D+H  ++    +L+ RE+E + W+  GKT+ EI +IL IS  TV N+
Sbjct: 179 LPVQHPADKEASEDLHEEENEALEQLSSREIEIMEWVRNGKTNQEIGMILDISSFTVKNH 238

Query: 221 IASIMRKTATKTRSGAIA 238
           +  I +K     R+ A++
Sbjct: 239 LQRIFKKLDVLNRAQAVS 256


>gi|115526593|ref|YP_783504.1| two component LuxR family transcriptional regulator
           [Rhodopseudomonas palustris BisA53]
 gi|115520540|gb|ABJ08524.1| two component transcriptional regulator, LuxR family
           [Rhodopseudomonas palustris BisA53]
          Length = 309

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRS 234
           K+  LT RE E L+W+S+GKT+ +IA ILG+S  TV+ ++  I  K   + R+
Sbjct: 243 KELGLTTRESEVLSWLSKGKTNRDIAQILGLSPRTVDKHLEQIYAKLGVENRT 295


>gi|228955660|ref|ZP_04117658.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|229072878|ref|ZP_04206076.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           F65185]
 gi|229082623|ref|ZP_04215086.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock4-2]
 gi|229153573|ref|ZP_04281751.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           m1550]
 gi|228630177|gb|EEK86828.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           m1550]
 gi|228701055|gb|EEL53578.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock4-2]
 gi|228710221|gb|EEL62197.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           F65185]
 gi|228804029|gb|EEM50650.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
          Length = 215

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ E+A +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEVASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|14586754|gb|AAK70349.1|AF333004_1 N-acyl homoserine lactone transcriptional regulator [Burkholderia
           multivorans ATCC BAA-247]
          Length = 239

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTAREREVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|291514919|emb|CBK64129.1| Response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Alistipes shahii WAL 8301]
          Length = 212

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 39/64 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D +L+ RE E L  +  G ++ EIA  L IS+ TV+ + A+I+ KT  K  +  + YA+R
Sbjct: 147 DEQLSSREREILVAVCRGLSNQEIADELFISKRTVDKHRANILEKTGCKNTASLVVYAIR 206

Query: 243 NNIV 246
           N IV
Sbjct: 207 NGIV 210


>gi|253999547|ref|YP_003051610.1| LuxR family transcriptional regulator [Methylovorus sp. SIP3-4]
 gi|253986226|gb|ACT51083.1| transcriptional regulator, LuxR family [Methylovorus sp. SIP3-4]
          Length = 265

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 34/54 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           +L+ RE+E + W+  GKT+ EI +IL IS  TV N++  I +K     R+ A++
Sbjct: 203 QLSSREIEIMEWVRNGKTNQEIGMILDISSFTVKNHLQRIFKKLDVLNRAQAVS 256


>gi|261418763|ref|YP_003252445.1| LuxR family transcriptional regulator [Geobacillus sp. Y412MC61]
 gi|297531272|ref|YP_003672547.1| LuxR family transcriptional regulator [Geobacillus sp. C56-T3]
 gi|319765579|ref|YP_004131080.1| LuxR family transcriptional regulator [Geobacillus sp. Y412MC52]
 gi|261375220|gb|ACX77963.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. Y412MC61]
 gi|297254524|gb|ADI27970.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. C56-T3]
 gi|317110445|gb|ADU92937.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. Y412MC52]
          Length = 210

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 41/62 (66%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE+E L  +++GKT+ E+A  L IS  TV  ++++I+ K   + R+ A+ YA R+ 
Sbjct: 148 QLTSREMEVLLLMAQGKTNQEMADELFISLKTVKVHVSNILAKLGVQDRTQAVIYAFRHG 207

Query: 245 IV 246
           +V
Sbjct: 208 LV 209


>gi|115524334|ref|YP_781245.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           BisA53]
 gi|115518281|gb|ABJ06265.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           BisA53]
          Length = 246

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W ++GK++ EI  IL I++ T   ++A+  RK     ++ A+A A+R  +
Sbjct: 184 LTHRECETLNWTAQGKSAWEIGEILQIAQRTAEEHLATAARKLGAVNKTHAVAIAIRQKL 243

Query: 246 V 246
           +
Sbjct: 244 I 244


>gi|218514607|ref|ZP_03511447.1| autoinducer transcriptional regulator protein [Rhizobium etli 8C-3]
          Length = 161

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+ECL W + GK   +I+VILGIS +T  +Y+ +   K    T S A + AV+  I
Sbjct: 99  LSPREIECLHWTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATISAAASRAVQLRI 158

Query: 246 V 246
           +
Sbjct: 159 I 159


>gi|313679613|ref|YP_004057352.1| two component LuxR family transcriptional regulator [Oceanithermus
           profundus DSM 14977]
 gi|313152328|gb|ADR36179.1| two component transcriptional regulator, LuxR family [Oceanithermus
           profundus DSM 14977]
          Length = 219

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT REV+ L  +++G T+ EIA  LGIS  TV N ++ I  K     R+ A  YA+R  
Sbjct: 154 DLTDREVQILRLLAQGATNQEIADELGISEKTVRNRLSEIFSKLHLNNRTQAALYAIREG 213

Query: 245 IV 246
           + 
Sbjct: 214 LA 215


>gi|254788088|ref|YP_003075517.1| response regulator receiver domain-containing protein
           [Teredinibacter turnerae T7901]
 gi|237687530|gb|ACR14794.1| response regulator receiver domain protein [Teredinibacter turnerae
           T7901]
          Length = 303

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 35/59 (59%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
             LT RE E L W++ GKT+ EI  ILG S  T+N ++  I +K   + R+ A A A++
Sbjct: 242 LPLTTRESEVLLWLARGKTNREIGQILGTSPRTINKHLEQIYKKLEVENRTTAAAKALQ 300


>gi|218437044|ref|YP_002375373.1| LuxR family transcriptional regulator [Cyanothece sp. PCC 7424]
 gi|218169772|gb|ACK68505.1| two component transcriptional regulator, LuxR family [Cyanothece
           sp. PCC 7424]
          Length = 229

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE + L  +++G ++ EI   L +S  TV  Y++S++RKT T  R+  + +A+ N+
Sbjct: 167 ELTEREKQVLELLAQGLSNVEIGQKLHLSPRTVEKYVSSLLRKTETNNRAELVRFALDND 226

Query: 245 IV 246
           +V
Sbjct: 227 LV 228


>gi|313158308|gb|EFR57710.1| response regulator receiver domain protein [Alistipes sp. HGB5]
          Length = 211

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 3/83 (3%)

Query: 164 LLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           LL++    M    DV    D +L+ RE E L  +  G ++ EIA  L IS+ TV+ + A+
Sbjct: 130 LLSSLTGRMRTRDDV---PDEQLSVREREILVAVCRGLSNQEIADELFISKRTVDKHRAN 186

Query: 224 IMRKTATKTRSGAIAYAVRNNIV 246
           I+ KT  K  +  + YA+RN IV
Sbjct: 187 ILEKTGCKNTASLVVYAIRNGIV 209


>gi|297537928|ref|YP_003673697.1| LuxR family transcriptional regulator [Methylotenera sp. 301]
 gi|297257275|gb|ADI29120.1| transcriptional regulator, LuxR family [Methylotenera sp. 301]
          Length = 247

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 36/57 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +T RE E L W+  GKT+ EI+ IL IS+ TV N++ +I+RK   + RS A   A +
Sbjct: 183 MTKRESEILQWLHMGKTNWEISSILDISQLTVKNHVQNILRKLDVQNRSQAAVKAAK 239


>gi|297529073|ref|YP_003670348.1| LuxR family transcriptional regulator [Geobacillus sp. C56-T3]
 gi|297252325|gb|ADI25771.1| transcriptional regulator, LuxR family [Geobacillus sp. C56-T3]
          Length = 500

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            L+ RE+E L  ++EG ++ E A  L +S  TV +Y+++I++K   K R+ AI  A+R+ 
Sbjct: 439 HLSPREIEVLKLVAEGASTYEAARRLHLSEYTVRDYVSAILQKMNAKNRTEAIVKAIRDG 498

Query: 245 IV 246
           I+
Sbjct: 499 II 500


>gi|14586760|gb|AAK70352.1|AF333007_1 N-acyl homoserine lactone transcriptional regulator [Burkholderia
           vietnamiensis]
          Length = 239

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTAREREVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|196230839|ref|ZP_03129700.1| two component transcriptional regulator, LuxR family
           [Chthoniobacter flavus Ellin428]
 gi|196225180|gb|EDY19689.1| two component transcriptional regulator, LuxR family
           [Chthoniobacter flavus Ellin428]
          Length = 221

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 37/66 (56%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
            +D+ LT RE E L  + +GKT  E A  L IS  T + YI S+  K   ++RS A+A A
Sbjct: 151 ARDYGLTPREQEILEVLVQGKTIKEAAAALKISYYTADEYIRSVYDKLQVRSRSSAVAKA 210

Query: 241 VRNNIV 246
           V   +V
Sbjct: 211 VSEGLV 216


>gi|327189685|gb|EGE56833.1| autoinducer transcriptional regulator protein [Rhizobium etli
           CNPAF512]
          Length = 277

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+ECL W + GK   +I+VILGIS +T  +Y+ +   K    T S A + AV+  I
Sbjct: 215 LSPREIECLHWTALGKDYKDISVILGISEHTTRDYLKTARFKLGCATISAAASRAVQLRI 274

Query: 246 V 246
           +
Sbjct: 275 I 275


>gi|310657820|ref|YP_003935541.1| two-component response regulator yhcz [Clostridium sticklandii DSM
           519]
 gi|308824598|emb|CBH20636.1| Two-component response regulator yhcZ [Clostridium sticklandii]
          Length = 213

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 40/64 (62%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           K  +LT RE++ ++ IS+G ++  IA  L IS  TV N+++SI+RK +   R+    Y +
Sbjct: 149 KSQKLTKRELQVMSLISKGMSNKAIAKHLEISDKTVKNHVSSILRKLSLNDRTQIAVYTL 208

Query: 242 RNNI 245
            NNI
Sbjct: 209 SNNI 212


>gi|294509070|ref|YP_003565959.1| DNA-binding response regulator, luxR family [Bacillus megaterium QM
           B1551]
 gi|294352374|gb|ADE72696.1| DNA-binding response regulator, luxR family [Bacillus megaterium QM
           B1551]
          Length = 202

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%), Gaps = 1/66 (1%)

Query: 182 KDFE-LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           KDFE LT  E + L  IS+ KT+ EI++ L IS+ TV  +I+SI+RK    +R GA+   
Sbjct: 134 KDFETLTSAEQKILLLISKDKTNYEISMDLSISKRTVEYHISSIIRKLDVDSRVGAVVKG 193

Query: 241 VRNNIV 246
           ++  ++
Sbjct: 194 IKKGLI 199


>gi|251771224|gb|EES51805.1| two component transcriptional regulator, LuxR family
           [Leptospirillum ferrodiazotrophum]
          Length = 219

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           L+ RE E L  ++EG+++ +IAV LGIS +TV  +I SI+ K +  TR+ A   A R  
Sbjct: 159 LSARETEVLRLLAEGQSNRDIAVALGISVSTVKAHIQSILVKLSAATRADAAVKAFRKG 217


>gi|206563716|ref|YP_002234479.1| N-acylhomoserine lactone dependent regulatory protein CepR
           [Burkholderia cenocepacia J2315]
 gi|198039756|emb|CAR55726.1| N-acylhomoserine lactone dependent regulatory protein CepR
           [Burkholderia cenocepacia J2315]
          Length = 239

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTAREREVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|12620907|gb|AAG61133.1|AF330022_1 AHL receptor [Burkholderia vietnamiensis]
          Length = 239

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTAREREVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|124268769|ref|YP_001022773.1| two component LuxR family transcriptional regulator [Methylibium
           petroleiphilum PM1]
 gi|124261544|gb|ABM96538.1| two component transcriptional regulator, LuxR family [Methylibium
           petroleiphilum PM1]
          Length = 306

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 32/48 (66%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           LT RE E L+W+++GKT+ +I  ILG+S  TVN ++  I  K   +TR
Sbjct: 245 LTPRETEVLSWLAKGKTNRDIGDILGVSPRTVNKHLEHIFEKLGVETR 292


>gi|310767240|gb|ADP12190.1| DNA-binding transcriptional activator SdiA [Erwinia sp. Ejp617]
          Length = 240

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 36/58 (62%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
            +L+ RE+E L W +EGKTS EI++IL IS NTVN +   + ++     ++   +YA 
Sbjct: 178 LDLSQRELEILKWTAEGKTSAEISLILSISENTVNFHQKKMQKRFNAPNKTQIASYAA 235


>gi|167839488|ref|ZP_02466172.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           thailandensis MSMB43]
          Length = 239

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W  EGKT+ EI  ILGIS  TVN ++ +++ K     +  A+  A+   +
Sbjct: 176 LTHREREVLCWTGEGKTACEIGQILGISERTVNFHVNNVLDKLGATNKVQAVVKAIAMGL 235

Query: 246 V 246
           V
Sbjct: 236 V 236


>gi|206975855|ref|ZP_03236766.1| DNA-binding response regulator [Bacillus cereus H3081.97]
 gi|217962901|ref|YP_002341479.1| DNA-binding response regulator [Bacillus cereus AH187]
 gi|222098883|ref|YP_002532941.1| DNA-binding response regulator [Bacillus cereus Q1]
 gi|229142155|ref|ZP_04270680.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           BDRD-ST26]
 gi|206745949|gb|EDZ57345.1| DNA-binding response regulator [Bacillus cereus H3081.97]
 gi|217063637|gb|ACJ77887.1| DNA-binding response regulator [Bacillus cereus AH187]
 gi|221242942|gb|ACM15652.1| DNA-binding response regulator [Bacillus cereus Q1]
 gi|228641444|gb|EEK97750.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           BDRD-ST26]
          Length = 215

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N +
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGV 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|56418969|ref|YP_146287.1| two-component response regulator [Geobacillus kaustophilus HTA426]
 gi|56378811|dbj|BAD74719.1| two-component response regulator [Geobacillus kaustophilus HTA426]
          Length = 210

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 41/62 (66%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE+E L  +++GKT+ E+A  L IS  TV  ++++I+ K   + R+ A+ YA R+ 
Sbjct: 148 QLTSREMEVLLLMAQGKTNQEMADELFISLKTVKVHVSNILAKLGVQDRTQAVIYAFRHG 207

Query: 245 IV 246
           +V
Sbjct: 208 LV 209


>gi|42784585|ref|NP_981832.1| DNA-binding response regulator [Bacillus cereus ATCC 10987]
 gi|42740517|gb|AAS44440.1| DNA-binding response regulator [Bacillus cereus ATCC 10987]
          Length = 215

 Score = 48.9 bits (115), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ EIA +L I+  TV  +++SI+ K     R+ A  YAV+N +
Sbjct: 155 LTARENEVLQLLAKGMSNKEIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGV 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|284045809|ref|YP_003396149.1| LuxR family transcriptional regulator [Conexibacter woesei DSM
           14684]
 gi|283950030|gb|ADB52774.1| transcriptional regulator, LuxR family [Conexibacter woesei DSM
           14684]
          Length = 381

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           LT RE+E L  ++EG+T+DEIA  L IS  TV  +++SI+RK     R+ A+A
Sbjct: 315 LTRRELEVLRLVAEGRTNDEIATALVISVGTVKFHVSSILRKLRVGNRAQAVA 367


>gi|241206011|ref|YP_002977107.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859901|gb|ACS57568.1| two component transcriptional regulator, LuxR family [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 305

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 56/112 (50%), Gaps = 12/112 (10%)

Query: 137 VARIRIGLMLLFPKGRIILR-DRLWEIG-------LLAAYQANMFKSYDVHWGKDFELTG 188
           VA +R G++ +   G+  L+   L  IG       L AA Q    +S D    + F LT 
Sbjct: 191 VAAVRDGIISIAHAGQAALQLAFLGAIGPDEYLFRLTAASQ----RSDDEVLRQRFSLTQ 246

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           RE E L WI++GK + +I  ILG+S  TVN ++  I  K   + R+ A   A
Sbjct: 247 RESEVLLWIAKGKANRDIGEILGLSARTVNKHLEQIYVKLGVENRASAAVKA 298


>gi|261418220|ref|YP_003251902.1| LuxR family transcriptional regulator [Geobacillus sp. Y412MC61]
 gi|319767820|ref|YP_004133321.1| LuxR family transcriptional regulator [Geobacillus sp. Y412MC52]
 gi|261374677|gb|ACX77420.1| transcriptional regulator, LuxR family [Geobacillus sp. Y412MC61]
 gi|317112686|gb|ADU95178.1| transcriptional regulator, LuxR family [Geobacillus sp. Y412MC52]
          Length = 500

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            L+ RE+E L  ++EG ++ E A  L +S  TV +Y+++I++K   K R+ AI  A+R+ 
Sbjct: 439 HLSPREIEVLKLVAEGASTYEAARRLHLSEYTVRDYVSAILQKMNAKNRTEAIVKAIRDG 498

Query: 245 IV 246
           I+
Sbjct: 499 II 500


>gi|167463570|ref|ZP_02328659.1| hypothetical protein Plarl_13624 [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322381266|ref|ZP_08055269.1| two-component response regulator-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321154842|gb|EFX47113.1| two-component response regulator-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 218

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L+ +++G T+ E+A +L IS  TV N+ A+IM K    TR   I +AV+  
Sbjct: 153 QLTDREKEILSLVAKGYTNKEVADLLSISAKTVENHKANIMDKLNLNTRRDLIRFAVKRG 212

Query: 245 IV 246
           ++
Sbjct: 213 LL 214


>gi|283478850|emb|CAY74766.1| DNA-binding transcriptional activator SdiA [Erwinia pyrifoliae DSM
           12163]
          Length = 242

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 36/58 (62%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
            +L+ RE+E L W +EGKTS EI++IL IS NTVN +   + ++     ++   +YA 
Sbjct: 180 LDLSQRELEILKWTAEGKTSAEISLILSISENTVNFHQKKMQKRFNAPNKTQIASYAA 237


>gi|229181658|ref|ZP_04308983.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           172560W]
 gi|228601854|gb|EEK59350.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           172560W]
          Length = 215

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++G ++ E+A +L I+  TV  +++SI+ K     R+ A  YAV+N I
Sbjct: 155 LTARENEVLQLLAKGMSNKEVASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGI 214

Query: 246 V 246
           V
Sbjct: 215 V 215


>gi|327403986|ref|YP_004344824.1| LuxR family two component transcriptional regulator [Fluviicola
           taffensis DSM 16823]
 gi|327319494|gb|AEA43986.1| two component transcriptional regulator, LuxR family [Fluviicola
           taffensis DSM 16823]
          Length = 224

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+E +  I E KT+ EIA  L I++ TV  +  ++  KT  K  +G I YA++NNI
Sbjct: 156 LSERELEIIQLICEQKTAKEIADKLFINQRTVEGHKNNMFAKTGAKNIAGLIIYAIQNNI 215

Query: 246 V 246
           +
Sbjct: 216 I 216


>gi|307266655|ref|ZP_07548184.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918318|gb|EFN48563.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 208

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 39/68 (57%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H     +LT RE+E L  IS+G ++ EIA  L +S  TV N++ +I +K   K R+ A  
Sbjct: 138 HENLKKDLTPREIEILKLISKGYSNKEIAQKLFLSEKTVKNHVYNIFKKLDVKDRTQAAI 197

Query: 239 YAVRNNIV 246
           Y ++N  +
Sbjct: 198 YMLKNETI 205


>gi|221067422|ref|ZP_03543527.1| two component transcriptional regulator, LuxR family [Comamonas
           testosteroni KF-1]
 gi|220712445|gb|EED67813.1| two component transcriptional regulator, LuxR family [Comamonas
           testosteroni KF-1]
          Length = 254

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 182 KDFE-LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           K FE LT RE E L  I++GK + EI   + IS  TV+ ++ +I RK   +TR+ A+ YA
Sbjct: 189 KKFEKLTDREKEVLRLIAQGKRTHEIGDYMEISALTVSTHVKNIYRKMQVRTRAQAVRYA 248

Query: 241 VRNNIV 246
           V   I+
Sbjct: 249 VLKGII 254


>gi|90421195|ref|ZP_01229096.1| two-component response regulator, LuxR family [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90334572|gb|EAS48355.1| two-component response regulator, LuxR family [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 299

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%)

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           RE E L W+S GK++ +IA IL +S  TVN ++ +I RK   + RS A A A+  
Sbjct: 240 REAEVLLWLSRGKSNQDIADILKLSVRTVNKHLETIFRKLGVENRSAATAIAMEQ 294


>gi|295400759|ref|ZP_06810736.1| two component transcriptional regulator, LuxR family [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294977340|gb|EFG52941.1| two component transcriptional regulator, LuxR family [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 185

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 42/61 (68%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT  E++ L +ISE +T+ EI+ +L IS+ TV ++++SI+RK    +R GA+  A++  I
Sbjct: 124 LTNVELKILQFISEDRTNAEISELLNISKRTVEHHVSSILRKLDVDSRVGAVVKAMKLGI 183

Query: 246 V 246
           +
Sbjct: 184 L 184


>gi|289578700|ref|YP_003477327.1| LuxR family transcriptional regulator [Thermoanaerobacter italicus
           Ab9]
 gi|297544934|ref|YP_003677236.1| two component LuxR family transcriptional regulator
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
 gi|289528413|gb|ADD02765.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter italicus Ab9]
 gi|296842709|gb|ADH61225.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
          Length = 205

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 39/68 (57%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H     +LT RE+E L  IS+G ++ EIA  L +S  TV N++ +I +K   K R+ A  
Sbjct: 135 HENLKKDLTPREIEILKLISKGYSNKEIAQKLFLSEKTVKNHVYNIFKKLDVKDRTQAAI 194

Query: 239 YAVRNNIV 246
           Y ++N  +
Sbjct: 195 YMLKNETI 202


>gi|326391463|ref|ZP_08212998.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter ethanolicus JW 200]
 gi|325992489|gb|EGD50946.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 208

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 39/68 (57%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H     +LT RE+E L  IS+G ++ EIA  L +S  TV N++ +I +K   K R+ A  
Sbjct: 138 HENLKKDLTPREIEILKLISKGYSNKEIAQKLFLSEKTVKNHVYNIFKKLDVKDRTQAAI 197

Query: 239 YAVRNNIV 246
           Y ++N  +
Sbjct: 198 YMLKNETI 205


>gi|242237587|ref|YP_002985768.1| LuxR family transcriptional regulator [Dickeya dadantii Ech703]
 gi|242129644|gb|ACS83946.1| transcriptional regulator, LuxR family [Dickeya dadantii Ech703]
          Length = 236

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 36/68 (52%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H   D   + RE + L W S GKT  EIA+ILGI  +TV  +I +++RK        AI 
Sbjct: 166 HRSNDMLFSERENDILYWASMGKTYQEIALILGIKTSTVKFHIGNVVRKLGVTNAKHAIR 225

Query: 239 YAVRNNIV 246
             +  N++
Sbjct: 226 MGIEMNLI 233


>gi|222086818|ref|YP_002545352.1| two-component response regulator protein [Agrobacterium radiobacter
           K84]
 gi|221724266|gb|ACM27422.1| two-component response regulator protein [Agrobacterium radiobacter
           K84]
          Length = 307

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           + F LT RE E L WI++GK++ +I  ILG+S  TVN ++  I  K   + R+ A   A 
Sbjct: 242 QHFSLTQRESEVLLWIAKGKSNRDIGEILGLSARTVNKHLEQIYVKLGVENRASAAVKAA 301


>gi|107025997|ref|YP_623508.1| LuxR family transcriptional regulator [Burkholderia cenocepacia AU
           1054]
 gi|116692818|ref|YP_838351.1| LuxR family transcriptional regulator [Burkholderia cenocepacia
           HI2424]
 gi|170737931|ref|YP_001779191.1| LuxR family transcriptional regulator [Burkholderia cenocepacia
           MC0-3]
 gi|105895371|gb|ABF78535.1| transcriptional regulator, LuxR family [Burkholderia cenocepacia AU
           1054]
 gi|116650818|gb|ABK11458.1| transcriptional regulator, LuxR family [Burkholderia cenocepacia
           HI2424]
 gi|169820119|gb|ACA94701.1| transcriptional regulator, LuxR family [Burkholderia cenocepacia
           MC0-3]
          Length = 239

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTAREREVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|300914706|ref|ZP_07132022.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter sp. X561]
 gi|307724060|ref|YP_003903811.1| LuxR family two component transcriptional regulator
           [Thermoanaerobacter sp. X513]
 gi|320115614|ref|YP_004185773.1| response regulator receiver [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|300889641|gb|EFK84787.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter sp. X561]
 gi|307581121|gb|ADN54520.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter sp. X513]
 gi|319928705|gb|ADV79390.1| response regulator receiver [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
          Length = 205

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE+E L  IS+G ++ EIA  L +S  TV N++ +I +K   K R+ A  Y ++N 
Sbjct: 141 DLTPREIEILKLISKGYSNKEIAQKLFLSEKTVKNHVYNIFKKLDVKDRTQAAIYMLKNE 200

Query: 245 IV 246
            +
Sbjct: 201 TI 202


>gi|259908860|ref|YP_002649216.1| Regulatory protein [Erwinia pyrifoliae Ep1/96]
 gi|224964482|emb|CAX55992.1| Regulatory protein [Erwinia pyrifoliae Ep1/96]
          Length = 240

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 36/58 (62%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
            +L+ RE+E L W +EGKTS EI++IL IS NTVN +   + ++     ++   +YA 
Sbjct: 178 LDLSQRELEILKWTAEGKTSAEISLILSISENTVNFHQKKMQKRFNAPNKTQIASYAA 235


>gi|224368539|ref|YP_002602702.1| two component transcriptional regulator (LuxR family protein)
           [Desulfobacterium autotrophicum HRM2]
 gi|223691255|gb|ACN14538.1| two component transcriptional regulator (LuxR family protein)
           [Desulfobacterium autotrophicum HRM2]
          Length = 217

 Score = 48.9 bits (115), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 40/59 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           L+ RE E LT ++EGK++ +IA IL IS  TV ++ ASIM++   +T +  I YA+R+ 
Sbjct: 154 LSPREEEVLTLLAEGKSNKKIADILCISTRTVEHHRASIMKRLDLRTLADLIKYAIRHG 212


>gi|148255164|ref|YP_001239749.1| LuxR family transcriptional regulator [Bradyrhizobium sp. BTAi1]
 gi|146407337|gb|ABQ35843.1| putative transcriptional regulatory protein, LuxR family
           [Bradyrhizobium sp. BTAi1]
          Length = 140

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 39/63 (61%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           F+LT RE + L  ++EG ++ EIA  LGIS +T   ++ S++ K     R+ A+A+A R 
Sbjct: 76  FQLTARERDVLALMAEGCSNKEIARSLGISVHTAKFHVGSLLDKLDATGRTDAVAHAARR 135

Query: 244 NIV 246
            I+
Sbjct: 136 GII 138


>gi|319650241|ref|ZP_08004387.1| YhcZ protein [Bacillus sp. 2_A_57_CT2]
 gi|317398072|gb|EFV78764.1| YhcZ protein [Bacillus sp. 2_A_57_CT2]
          Length = 215

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 39/61 (63%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE+E L  I++GK++ EIA  L I+  TV  ++++++ K     R+ A  YAVR+ 
Sbjct: 151 ELTKRELEVLREIAKGKSNKEIASSLYITEKTVKTHVSNLLSKLELADRTQAALYAVRHG 210

Query: 245 I 245
           I
Sbjct: 211 I 211


>gi|261493914|ref|ZP_05990423.1| putative bifunctional amino acid-binding protein/DNA-binding
           protein [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261496858|ref|ZP_05993227.1| putative bifunctional amino acid-binding protein/DNA-binding
           protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261307475|gb|EEY08809.1| putative bifunctional amino acid-binding protein/DNA-binding
           protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261310417|gb|EEY11611.1| putative bifunctional amino acid-binding protein/DNA-binding
           protein [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 583

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 43/68 (63%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H    + L+ RE+E LT IS G +++EIA  L IS+ TV+ +I +I  KT T++R+    
Sbjct: 78  HTDLPYGLSKREIELLTLISSGLSNEEIANELCISKRTVDKHIENIFAKTHTESRTLLAV 137

Query: 239 YAVRNNIV 246
           +A+  ++V
Sbjct: 138 FAITEHLV 145


>gi|260551305|ref|ZP_05825506.1| transcriptional activator protein phzR [Acinetobacter sp. RUH2624]
 gi|260405619|gb|EEW99110.1| transcriptional activator protein phzR [Acinetobacter sp. RUH2624]
          Length = 238

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT RE E L W +EGKTS EIA I+G++  TVN ++ + M+K     +  A   AV
Sbjct: 178 LTNREKEALRWTAEGKTSAEIAQIIGVTERTVNFHLCNSMQKLNVNNKISAAIRAV 233


>gi|78061902|ref|YP_371810.1| LuxR family transcriptional regulator [Burkholderia sp. 383]
 gi|77969787|gb|ABB11166.1| transcriptional regulator, LuxR family [Burkholderia sp. 383]
          Length = 239

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTAREREVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|228994069|ref|ZP_04153970.1| Two-component response regulator [Bacillus pseudomycoides DSM
           12442]
 gi|228765717|gb|EEM14370.1| Two-component response regulator [Bacillus pseudomycoides DSM
           12442]
          Length = 189

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 35/61 (57%)

Query: 180 WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           W +   L+ RE E L    EGKT++EIA  L +S  TV NYI+ ++ K   K R  AIA 
Sbjct: 123 WQEQNPLSDREKEVLLLAKEGKTANEIAKTLYLSSGTVRNYISDVLTKLNAKNRIEAIAI 182

Query: 240 A 240
           A
Sbjct: 183 A 183


>gi|12620903|gb|AAG61131.1|AF330020_1 AHL receptor [Burkholderia cepacia]
          Length = 239

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTAREREVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|167037195|ref|YP_001664773.1| two component LuxR family transcriptional regulator
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|167040665|ref|YP_001663650.1| two component LuxR family transcriptional regulator
           [Thermoanaerobacter sp. X514]
 gi|166854905|gb|ABY93314.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter sp. X514]
 gi|166856029|gb|ABY94437.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
          Length = 208

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE+E L  IS+G ++ EIA  L +S  TV N++ +I +K   K R+ A  Y ++N 
Sbjct: 144 DLTPREIEILKLISKGYSNKEIAQKLFLSEKTVKNHVYNIFKKLDVKDRTQAAIYMLKNE 203

Query: 245 IV 246
            +
Sbjct: 204 TI 205


>gi|17989461|ref|NP_542094.1| transcriptional activator, LUXR family [Brucella melitensis bv. 1
           str. 16M]
 gi|17985340|gb|AAL54358.1| transcriptional activator, luxr family [Brucella melitensis bv. 1
           str. 16M]
          Length = 235

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REV+CL W + GKT  EIA IL I+R TV  Y+ +   K     R+ A+A A+   I
Sbjct: 166 LTPREVDCLRWAANGKTDGEIAEILSIARWTVVTYLQNAKIKLNCSNRTSAVATALSLGI 225

Query: 246 V 246
           +
Sbjct: 226 I 226


>gi|319653424|ref|ZP_08007524.1| response regulator [Bacillus sp. 2_A_57_CT2]
 gi|317394908|gb|EFV75646.1| response regulator [Bacillus sp. 2_A_57_CT2]
          Length = 210

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 42/62 (67%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE+E L  +++GKT+ +IA  L I+  TV  ++++I+ K   + R+ A+ YA +++
Sbjct: 148 ELTSREMEILLLMTQGKTNQDIADELFIALKTVKTHVSNILSKLQVQDRTQAVIYAFKHS 207

Query: 245 IV 246
           +V
Sbjct: 208 LV 209


>gi|313901723|ref|ZP_07835152.1| two component transcriptional regulator, LuxR family
           [Thermaerobacter subterraneus DSM 13965]
 gi|313468011|gb|EFR63496.1| two component transcriptional regulator, LuxR family
           [Thermaerobacter subterraneus DSM 13965]
          Length = 222

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+E L+ I+ GKT+ ++A  L IS  TV N+++ IM+K   + R+ A+ +A+R  +
Sbjct: 155 LSQRELEVLSRIARGKTTAQVARELFISPKTVRNHLSHIMQKLGVRDRTQAVLFALRVGL 214

Query: 246 V 246
           +
Sbjct: 215 I 215


>gi|291301198|ref|YP_003512476.1| LuxR family transcriptional regulator [Stackebrandtia nassauensis
           DSM 44728]
 gi|290570418|gb|ADD43383.1| transcriptional regulator, LuxR family [Stackebrandtia nassauensis
           DSM 44728]
          Length = 826

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 34/55 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           LT RE + LT ++ G+ +  IAV LGI+R TV  +I + MRK   KTR+ A   A
Sbjct: 763 LTSREQQVLTMVAAGEPTRRIAVALGITRETVETHIRAGMRKLGAKTRTEAAVRA 817


>gi|254471852|ref|ZP_05085253.1| transcriptional regulator, LuxR family protein [Pseudovibrio sp.
           JE062]
 gi|211959054|gb|EEA94253.1| transcriptional regulator, LuxR family protein [Pseudovibrio sp.
           JE062]
          Length = 254

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 34/58 (58%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           F  T RE ECL W++ G+ + EIA IL +S  TV ++I    +K     R+ A+A A+
Sbjct: 190 FGFTPREHECLLWLTAGRANKEIAHILNLSEKTVEHHIKRACKKLRVTNRTHAVARAM 247


>gi|15889689|ref|NP_355370.1| LuxR family transcriptional regulator [Agrobacterium tumefaciens
           str. C58]
 gi|15157595|gb|AAK88155.1| transcriptional regulator, LuxR family [Agrobacterium tumefaciens
           str. C58]
          Length = 309

 Score = 48.5 bits (114), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 37/68 (54%)

Query: 174 KSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           KS D      F LT RE E L WI++GK++ +I  ILG+S  TVN ++  I  K   + R
Sbjct: 236 KSDDHLLKSHFALTTRESEVLLWIAKGKSNRDIGDILGLSARTVNKHLEQIYVKLGVENR 295

Query: 234 SGAIAYAV 241
           + A   A 
Sbjct: 296 ASAAVKAA 303


>gi|306837362|ref|ZP_07470241.1| regulatory protein LuxR [Brucella sp. NF 2653]
 gi|306407554|gb|EFM63754.1| regulatory protein LuxR [Brucella sp. NF 2653]
          Length = 235

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REV+CL W + GKT  EIA IL I+R TV  Y+ +   K     R+ A+A A+   I
Sbjct: 166 LTPREVDCLRWAANGKTDGEIAEILSIARWTVVTYLQNAKIKLNCSNRTSAVATALSLGI 225

Query: 246 V 246
           +
Sbjct: 226 I 226


>gi|302543091|ref|ZP_07295433.1| response regulator, two-component system [Streptomyces
           hygroscopicus ATCC 53653]
 gi|302460709|gb|EFL23802.1| response regulator, two-component system [Streptomyces
           himastatinicus ATCC 53653]
          Length = 219

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  LT RE+E L  I++G+++ EIA  L IS+ TV  +++ I+ K   + R  A+ YA R
Sbjct: 155 DNPLTPRELEVLRLIADGRSNSEIAAALQISQETVKTFVSRILTKLDLRDRVQAVVYAYR 214

Query: 243 NNI 245
             +
Sbjct: 215 QGL 217


>gi|13474692|ref|NP_106261.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
 gi|14025447|dbj|BAB52047.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
          Length = 243

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 35/63 (55%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
            ELT RE ECL W + GK+  EI+ ILGIS +T   ++ +   K     R  A+A A+R 
Sbjct: 180 IELTPRERECLQWAAVGKSEWEISQILGISEHTSEKHLLNAKSKLGAVNRVQAVAEAIRR 239

Query: 244 NIV 246
             +
Sbjct: 240 GYI 242


>gi|218513582|ref|ZP_03510422.1| LuxR family transcriptional regulator [Rhizobium etli 8C-3]
          Length = 65

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           +T RE E + W++ GKT+ EI  IL +S  TVN +IA+   K      +  +A A+RN I
Sbjct: 4   VTPREREIIGWMAAGKTAAEIGAILAVSPITVNTHIANAKAKLGVFKETALVAEALRNGI 63

Query: 246 V 246
           +
Sbjct: 64  I 64


>gi|171322367|ref|ZP_02911189.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MEX-5]
 gi|171092309|gb|EDT37680.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MEX-5]
          Length = 239

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTAREREVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAIAAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|254254249|ref|ZP_04947566.1| DNA-binding HTH domain-containing protein [Burkholderia dolosa
           AUO158]
 gi|12620909|gb|AAG61134.1|AF330023_1 AHL receptor [Burkholderia cepacia]
 gi|124898894|gb|EAY70737.1| DNA-binding HTH domain-containing protein [Burkholderia dolosa
           AUO158]
          Length = 239

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTAREREVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|300814540|ref|ZP_07094796.1| transcriptional regulator, LuxR family [Peptoniphilus sp. oral
           taxon 836 str. F0141]
 gi|300511367|gb|EFK38611.1| transcriptional regulator, LuxR family [Peptoniphilus sp. oral
           taxon 836 str. F0141]
          Length = 208

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRS 234
           +LT RE++ L  ++ G  +DEIA  LGIS NTV  +IA ++ KT  KTR+
Sbjct: 143 QLTPREIQVLRLLTTGVGNDEIASKLGISENTVKTHIAHLLSKTGFKTRT 192


>gi|119896947|ref|YP_932160.1| LuxR family transcriptional regulator [Azoarcus sp. BH72]
 gi|119669360|emb|CAL93273.1| putative transcriptional regulator, LuxR family [Azoarcus sp. BH72]
          Length = 318

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 35/58 (60%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           F LT RE E L W++ GKT+ +I  ILG S  TV+ ++  +  K   +TR+ A + A+
Sbjct: 251 FRLTTREAEVLYWVTRGKTNRDIGDILGSSPRTVHKHLEHVFEKLGVETRTAAASMAL 308


>gi|116071519|ref|ZP_01468787.1| transcriptional regulator, LuxR family protein [Synechococcus sp.
           BL107]
 gi|116065142|gb|EAU70900.1| transcriptional regulator, LuxR family protein [Synechococcus sp.
           BL107]
          Length = 92

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 42/71 (59%)

Query: 173 FKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKT 232
             S D     D  L+ RE+E +  ++EG T+ EIA  L IS+ TV+N+++++  KT +K 
Sbjct: 1   MSSVDTTDPLDISLSAREIEIIQLVAEGLTNQEIADRLTISKRTVDNHVSNVFTKTGSKN 60

Query: 233 RSGAIAYAVRN 243
           R   + +++ N
Sbjct: 61  RVALLNWSMDN 71


>gi|73749035|ref|YP_308274.1| LuxR family DNA-binding response regulator [Dehalococcoides sp.
           CBDB1]
 gi|147669801|ref|YP_001214619.1| two component LuxR family transcriptional regulator
           [Dehalococcoides sp. BAV1]
 gi|73660751|emb|CAI83358.1| DNA-binding response regulator, LuxR family [Dehalococcoides sp.
           CBDB1]
 gi|146270749|gb|ABQ17741.1| two component transcriptional regulator, LuxR family
           [Dehalococcoides sp. BAV1]
          Length = 225

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 5/68 (7%)

Query: 180 WGKDFE-----LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRS 234
            GKD       LT RE + LT I+ G T+ +IA  L IS  T+ N++++I+RK     R+
Sbjct: 152 LGKDASSFVAPLTNREKQILTLIANGNTNKQIANNLEISEQTIKNHVSAILRKLNANDRA 211

Query: 235 GAIAYAVR 242
            A+  A+R
Sbjct: 212 HAVVVAIR 219


>gi|332526102|ref|ZP_08402240.1| response regulator [Rubrivivax benzoatilyticus JA2]
 gi|332109945|gb|EGJ10573.1| response regulator [Rubrivivax benzoatilyticus JA2]
          Length = 245

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E LT++S+G T  EIA ++GI   TVN++I SI +K    +R+ A   A +  +
Sbjct: 185 LTPRESEVLTYLSKGFTIKEIASLMGIKWFTVNDHIKSIYKKLNVSSRAEAAVLASKQGL 244

Query: 246 V 246
           V
Sbjct: 245 V 245


>gi|329941415|ref|ZP_08290694.1| two-component system response regulator [Streptomyces
           griseoaurantiacus M045]
 gi|329299946|gb|EGG43845.1| two-component system response regulator [Streptomyces
           griseoaurantiacus M045]
          Length = 226

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 39/64 (60%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +D  LT RE+E L  I++G ++ EIA  L IS+ TV  +++ I+ K   + R  A+ YA 
Sbjct: 161 EDIPLTPRELEVLRLIADGLSNSEIAATLVISQETVKTFVSRILTKLNLRDRVQAVVYAF 220

Query: 242 RNNI 245
           R+ +
Sbjct: 221 RHGL 224


>gi|313895153|ref|ZP_07828710.1| putative nitrate/nitrite response regulator protein NarL
           [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320529859|ref|ZP_08030936.1| putative nitrate/nitrite response regulator protein NarL
           [Selenomonas artemidis F0399]
 gi|312976048|gb|EFR41506.1| putative nitrate/nitrite response regulator protein NarL
           [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320137877|gb|EFW29782.1| putative nitrate/nitrite response regulator protein NarL
           [Selenomonas artemidis F0399]
          Length = 223

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE++ L  I++G ++ +I   LG+S  TV N++ SI  K     R+ A+ Y ++N I
Sbjct: 160 LTPREMDVLGCIAKGLSNQDIGKALGLSEKTVKNHLTSIFHKLKVNDRTQALVYVLKNKI 219

Query: 246 V 246
           V
Sbjct: 220 V 220


>gi|238027274|ref|YP_002911505.1| Autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia glumae BGR1]
 gi|237876468|gb|ACR28801.1| Autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia glumae BGR1]
          Length = 237

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT REVE L W ++GKTS EI+ IL IS +TVN ++ + + K  T  ++ A+  A 
Sbjct: 176 LTDREVEVLKWAADGKTSGEISTILRISVDTVNFHVKNAVAKLKTVNKTSAVVRAA 231


>gi|14586756|gb|AAK70350.1|AF333005_1 N-acyl homoserine lactone transcriptional regulator [Burkholderia
           stabilis]
          Length = 239

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTAREREVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|16332248|ref|NP_442976.1| response regulator like-protein [Synechocystis sp. PCC 6803]
 gi|1653878|dbj|BAA18788.1| response regulator like protein [Synechocystis sp. PCC 6803]
          Length = 228

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 37/68 (54%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           D    +  ELT REV  L  ++EGKT+ EI   L ++ +TV  Y+ +IMRK   + R+ A
Sbjct: 158 DYRKSQKDELTQREVAILRLVAEGKTNSEIGQELHLASSTVREYVQTIMRKLNARDRTSA 217

Query: 237 IAYAVRNN 244
               +R  
Sbjct: 218 AIAGLREG 225


>gi|163801312|ref|ZP_02195211.1| putative transcriptional regulator, LuxR family protein [Vibrio sp.
           AND4]
 gi|159174801|gb|EDP59601.1| putative transcriptional regulator, LuxR family protein [Vibrio sp.
           AND4]
          Length = 217

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 48/80 (60%), Gaps = 1/80 (1%)

Query: 165 LAAYQANMFKSY-DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           L AY AN+  +  ++    + ELT RE + LT + +G ++ +IA  L +S +TV +++ S
Sbjct: 136 LVAYLANLNHTVTELDTQLEIELTRRETQVLTALCQGGSNLDIADSLFVSEHTVKSHLYS 195

Query: 224 IMRKTATKTRSGAIAYAVRN 243
           I RK   K R  AIA+A RN
Sbjct: 196 IFRKLEVKNRMQAIAWAKRN 215


>gi|116253485|ref|YP_769323.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115258133|emb|CAK09234.1| putative LuxR family transcriptional regulator [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 305

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 56/112 (50%), Gaps = 12/112 (10%)

Query: 137 VARIRIGLMLLFPKGRIILR-DRLWEIG-------LLAAYQANMFKSYDVHWGKDFELTG 188
           VA +R G++ +   G+  L+   L  IG       L AA Q    +S D    + F LT 
Sbjct: 191 VAAVRDGIISIAHAGQAALQLAFLGAIGPDEYLFRLTAASQ----RSDDEVLRQRFSLTQ 246

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           RE E L WI++GK + +I  ILG+S  TVN ++  I  K   + R+ A   A
Sbjct: 247 RESEVLLWIAKGKANRDIGEILGLSARTVNKHLEQIYVKLGVENRASAAVKA 298


>gi|331092883|ref|ZP_04586362.2| putative LuxR family regulatory protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331125377|ref|ZP_04592751.2| putative LuxR family regulatory protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331020753|gb|EGI00810.1| putative LuxR family regulatory protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331027159|gb|EGI07214.1| putative LuxR family regulatory protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 235

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 33/61 (54%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W   GKT+ EI+ ILG S  TVN +IA+  RK     R  A+  A+    
Sbjct: 173 LTMRETEVLKWSGAGKTTWEISRILGCSERTVNFHIANASRKLGASNRLQAVGMALAQEF 232

Query: 246 V 246
           +
Sbjct: 233 I 233


>gi|229000138|ref|ZP_04159708.1| Two-component response regulator [Bacillus mycoides Rock3-17]
 gi|229007659|ref|ZP_04165252.1| Two-component response regulator [Bacillus mycoides Rock1-4]
 gi|228753610|gb|EEM03055.1| Two-component response regulator [Bacillus mycoides Rock1-4]
 gi|228759675|gb|EEM08651.1| Two-component response regulator [Bacillus mycoides Rock3-17]
          Length = 189

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 35/61 (57%)

Query: 180 WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           W +   L+ RE E L    EGKT++EIA  L +S  TV NYI+ ++ K   K R  AIA 
Sbjct: 123 WQEQNPLSDREKEVLLLAKEGKTANEIAKTLYLSSGTVRNYISDVLTKLNAKNRIEAIAI 182

Query: 240 A 240
           A
Sbjct: 183 A 183


>gi|254448276|ref|ZP_05061738.1| Two Component Transcriptional Regulator, LuxR family [gamma
           proteobacterium HTCC5015]
 gi|198262143|gb|EDY86426.1| Two Component Transcriptional Regulator, LuxR family [gamma
           proteobacterium HTCC5015]
          Length = 208

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 42/73 (57%)

Query: 152 RIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILG 211
           R +L   L+   L A  Q   ++S DV      EL+GR+++ L  +++G T+ EIA +L 
Sbjct: 114 RRVLAGELYHPALEATAQHPSWESDDVDRAAFSELSGRQMQVLAEMAKGSTNKEIAAVLN 173

Query: 212 ISRNTVNNYIASI 224
           IS +TV  +IA +
Sbjct: 174 ISEHTVKTHIAKL 186


>gi|315506070|ref|YP_004084957.1| two component transcriptional regulator, luxr family
           [Micromonospora sp. L5]
 gi|315412689|gb|ADU10806.1| two component transcriptional regulator, LuxR family
           [Micromonospora sp. L5]
          Length = 603

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 38/64 (59%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  LT RE+E L  I++G ++ EIA  L IS+ TV  Y++ I+ K   + R  A+ YA R
Sbjct: 539 DVGLTPRELEVLRLIADGLSNSEIAARLVISQETVKTYVSRILTKLDLRDRVQAVVYAYR 598

Query: 243 NNIV 246
             +V
Sbjct: 599 TGLV 602


>gi|209809715|ref|YP_002265254.1| transcriptional activator protein LuxR [Aliivibrio salmonicida
           LFI1238]
 gi|21311436|gb|AAM46717.1|AF452135_2 LuxR1 [Aliivibrio salmonicida]
 gi|208011278|emb|CAQ81719.1| transcriptional activator protein LuxR [Aliivibrio salmonicida
           LFI1238]
          Length = 248

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +LT RE ECL W  EGK+S EI++ILG +  TV  ++ +   K  T  R  +++ A+
Sbjct: 182 DLTKREKECLAWACEGKSSWEISIILGCTERTVAFHLTNSQTKLGTTNRCQSVSKAI 238


>gi|85708570|ref|ZP_01039636.1| two-component transcriptional regulator, LuxR family protein
           [Erythrobacter sp. NAP1]
 gi|85690104|gb|EAQ30107.1| two-component transcriptional regulator, LuxR family protein
           [Erythrobacter sp. NAP1]
          Length = 236

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 33/61 (54%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ REVE LTW + GK+   IA IL IS +T   Y   I  K     R GA+  A+R  +
Sbjct: 174 LSEREVEVLTWAARGKSLSAIATILDISPDTAKTYSKRIYAKLDVSDRVGAVVKALRMGL 233

Query: 246 V 246
           V
Sbjct: 234 V 234


>gi|166850622|gb|ABY91283.1| transcriptional regulator [Mesorhizobium huakuii]
          Length = 243

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 35/63 (55%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
            ELT RE ECL W + GK+  EI+ ILGIS +T   ++ +   K     R  A+A A+R 
Sbjct: 180 IELTPRERECLQWAAVGKSEWEISQILGISEHTSEKHLLNAKSKLGAVNRVQAVAEAIRR 239

Query: 244 NIV 246
             +
Sbjct: 240 GYI 242


>gi|149180154|ref|ZP_01858659.1| DNA-binding response regulator [Bacillus sp. SG-1]
 gi|148852346|gb|EDL66491.1| DNA-binding response regulator [Bacillus sp. SG-1]
          Length = 216

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 5/83 (6%)

Query: 164 LLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           LL  +Q N  +  D     D  LT RE E L  + EG ++ EI   L +S  TV  ++++
Sbjct: 133 LLTFHQQNQRQDRD-----DNSLTEREREVLGCLVEGLSNKEIGKRLYVSDKTVKIHVSN 187

Query: 224 IMRKTATKTRSGAIAYAVRNNIV 246
           I +K   K+RS  + YAV+N +V
Sbjct: 188 IFKKLNVKSRSQVVIYAVQNKLV 210


>gi|326334186|ref|ZP_08200409.1| nitrate/nitrite response regulator protein NarL [Nocardioidaceae
           bacterium Broad-1]
 gi|325947977|gb|EGD40094.1| nitrate/nitrite response regulator protein NarL [Nocardioidaceae
           bacterium Broad-1]
          Length = 212

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE+E L  +++G  + EIA  L IS NTV N++ +I+ K    +R  A+ YAVR  
Sbjct: 148 KLTDRELEVLGLVAKGLNNREIAKRLFISENTVKNHVRNILEKLQAHSRMEAVMYAVRQK 207

Query: 245 IV 246
           ++
Sbjct: 208 LL 209


>gi|311032377|ref|ZP_07710467.1| two-component response regulator LiaR [Bacillus sp. m3-13]
          Length = 210

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 42/62 (67%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE+E L  +++GKT+ EIA  L I+  TV  ++++I+ K   + R+ A+ YA +++
Sbjct: 148 ELTNREMEILLLMTQGKTNQEIADELFIALKTVKVHVSNILAKLQVQDRTQAVIYAFKHS 207

Query: 245 IV 246
           +V
Sbjct: 208 LV 209


>gi|256395900|ref|YP_003117464.1| LuxR family transcriptional regulator [Catenulispora acidiphila DSM
           44928]
 gi|256362126|gb|ACU75623.1| two component transcriptional regulator, LuxR family [Catenulispora
           acidiphila DSM 44928]
          Length = 232

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +L+ RE+E L  +++G+++  I   +G+S  TV +++A I RK  T  R+G +A A+R  
Sbjct: 170 DLSAREIEVLRLVADGRSNKAIGQAMGLSALTVKSHLARIARKLGTGDRAGMVAVALRGG 229

Query: 245 IV 246
            +
Sbjct: 230 TI 231


>gi|167584437|ref|ZP_02376825.1| transcriptional regulator, LuxR family protein [Burkholderia
           ubonensis Bu]
          Length = 239

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTAREREVLCWTAEGKTACEIGQILNISERTVNFHVNNILEKLGATNKVQAVVKAISAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|157683240|gb|ABV64383.1| response regulator [Anabaena sp. L-31]
          Length = 228

 Score = 48.5 bits (114), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 43/76 (56%), Gaps = 7/76 (9%)

Query: 171 NMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTAT 230
           N+ KS       D  LTGRE+E L+ +++GKT+ EIA  L I+  TV  ++ +I+ K   
Sbjct: 152 NLIKS-------DHPLTGRELEILSLLAQGKTNQEIATALYITPGTVRVHVHAILHKLDV 204

Query: 231 KTRSGAIAYAVRNNIV 246
             R  A+  A++  ++
Sbjct: 205 SDRHQAVVLALQKRLI 220


>gi|332995574|gb|AEF05629.1| two-component response regulator [Alteromonas sp. SN2]
          Length = 297

 Score = 48.5 bits (114), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 36/61 (59%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           ++  +T RE E L WIS GKTS EI+ IL IS  T N ++  I +K     ++ A A A+
Sbjct: 233 ENLPITKRESEVLYWISFGKTSWEISQILDISPRTANKHLEQIYKKLGVDNKTSAAAIAL 292

Query: 242 R 242
           R
Sbjct: 293 R 293


>gi|238927983|ref|ZP_04659743.1| response regulator [Selenomonas flueggei ATCC 43531]
 gi|238883943|gb|EEQ47581.1| response regulator [Selenomonas flueggei ATCC 43531]
          Length = 223

 Score = 48.5 bits (114), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 54/101 (53%), Gaps = 7/101 (6%)

Query: 147 LFPKGRIILRDRLWEIGLLAAYQANMFKS-YDVHWGKDFELTGREVECLTWISEGKTSDE 205
           ++PK    L +RL+    ++     M K  +D   G+   LT RE++ L  I++G ++ +
Sbjct: 126 VYPK----LAERLFGTSSISGDVGRMAKEIWDESRGE--RLTPREMDVLGCIAKGLSNQD 179

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           I   LG+S  TV N++ S+  K     R+ A+ Y ++N IV
Sbjct: 180 IGKALGLSEKTVKNHLTSVFHKLKVNDRTQALVYVLKNKIV 220


>gi|319793534|ref|YP_004155174.1| two component LuxR family transcriptional regulator [Variovorax
           paradoxus EPS]
 gi|315595997|gb|ADU37063.1| two component transcriptional regulator, LuxR family [Variovorax
           paradoxus EPS]
          Length = 255

 Score = 48.5 bits (114), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 39/66 (59%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G+D  LT RE E L +++ G  S EI   LGI+  TVN +I SI +K    +R+ A+ +A
Sbjct: 190 GRDATLTPRESEILRFVACGYVSAEIGERLGITWQTVNVHIKSIYKKLHVHSRAQAVNFA 249

Query: 241 VRNNIV 246
           V   ++
Sbjct: 250 VHTGLI 255


>gi|253998423|ref|YP_003050486.1| two component LuxR family transcriptional regulator [Methylovorus
           sp. SIP3-4]
 gi|313200498|ref|YP_004039156.1| two component LuxR family transcriptional regulator [Methylovorus
           sp. MP688]
 gi|253985102|gb|ACT49959.1| two component transcriptional regulator, LuxR family [Methylovorus
           sp. SIP3-4]
 gi|312439814|gb|ADQ83920.1| two component transcriptional regulator, LuxR family [Methylovorus
           sp. MP688]
          Length = 314

 Score = 48.5 bits (114), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (59%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           F+LT RE E L W  +GKT+ +I  ILG S  T+N ++  +  K   +TR+ A A A
Sbjct: 252 FKLTRRESEVLYWAMQGKTNRDIGDILGTSPRTINKHLEHVFTKLGVETRTAASALA 308


>gi|160894687|ref|ZP_02075462.1| hypothetical protein CLOL250_02238 [Clostridium sp. L2-50]
 gi|156863621|gb|EDO57052.1| hypothetical protein CLOL250_02238 [Clostridium sp. L2-50]
          Length = 123

 Score = 48.5 bits (114), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
            K ++LT RE E L+ I     +DEIA  LGIS NT+  ++ +I RKT T ++
Sbjct: 64  AKGYDLTPRETEILSLIFSFANNDEIAATLGISENTIQKHLQNIFRKTGTSSK 116


>gi|302035966|ref|YP_003796288.1| putative LuxR family transcriptional regulator [Candidatus
           Nitrospira defluvii]
 gi|300604030|emb|CBK40362.1| putative Transcriptional regulator, LuxR family [Candidatus
           Nitrospira defluvii]
          Length = 265

 Score = 48.5 bits (114), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 36/54 (66%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           L+ RE E L W++ GKT+ EI+VIL +S NTV  ++ ++ +K   + R  AIAY
Sbjct: 184 LSKREEEILRWVAAGKTNWEISVILKVSLNTVKFHLKNVFQKIGVENRWSAIAY 237


>gi|332685604|ref|YP_004455378.1| two-component response regulator [Melissococcus plutonius ATCC
           35311]
 gi|332369613|dbj|BAK20569.1| two-component response regulator [Melissococcus plutonius ATCC
           35311]
          Length = 201

 Score = 48.5 bits (114), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           LT RE+E L  + +G  + +IA  L +S  TV NYI++I+ KT TK+R  AI  A
Sbjct: 141 LTDREIEILNLLKKGANTKQIAENLFLSNGTVRNYISAILNKTGTKSRIEAINLA 195


>gi|294498204|ref|YP_003561904.1| two-component response regulator LiaR [Bacillus megaterium QM
           B1551]
 gi|294348141|gb|ADE68470.1| two-component response regulator LiaR [Bacillus megaterium QM
           B1551]
          Length = 208

 Score = 48.5 bits (114), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 41/62 (66%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE+E L  +++GKT+ EIA  L I+  TV  ++++++ K   + R+ A+ YA ++ 
Sbjct: 146 ELTAREMEILLLMTQGKTNQEIADELFIALKTVKTHVSNLLSKLDVQDRTQAVIYAFKHK 205

Query: 245 IV 246
           +V
Sbjct: 206 LV 207


>gi|148560233|ref|YP_001258220.1| LuxR family transcriptional regulator [Brucella ovis ATCC 25840]
 gi|148371490|gb|ABQ61469.1| transcriptional regulator, LuxR autoinducer regulated family
           [Brucella ovis ATCC 25840]
          Length = 235

 Score = 48.5 bits (114), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 35/58 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           D  LT RE E L W SEGKT++ I  IL IS  TVN +I++++ K     +  A+A A
Sbjct: 172 DVSLTLREREILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVKAVAKA 229


>gi|254690492|ref|ZP_05153746.1| Transcriptional activator, LUXR family protein [Brucella abortus
           bv. 6 str. 870]
          Length = 235

 Score = 48.5 bits (114), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 35/58 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           D  LT RE E L W SEGKT++ I  IL IS  TVN +I++++ K     +  A+A A
Sbjct: 172 DVSLTLREREILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKA 229


>gi|264677722|ref|YP_003277628.1| two component transcriptional regulator, LuxR [Comamonas
           testosteroni CNB-2]
 gi|299530281|ref|ZP_07043706.1| two component transcriptional regulator, LuxR [Comamonas
           testosteroni S44]
 gi|262208234|gb|ACY32332.1| two component transcriptional regulator, LuxR [Comamonas
           testosteroni CNB-2]
 gi|298721652|gb|EFI62584.1| two component transcriptional regulator, LuxR [Comamonas
           testosteroni S44]
          Length = 253

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G    L+ RE E L  ++ G TS EI V L IS  TVN +I +I RK   +TR+ A+ +A
Sbjct: 188 GMSDRLSSRECEVLRMVASGNTSAEIGVQLEISTMTVNTHIKNIYRKLQVRTRAQAVRFA 247


>gi|167566108|ref|ZP_02359024.1| probable transcriptional activator of quorum sensing autoinducer
           synthesis transcription regulator protein [Burkholderia
           oklahomensis EO147]
          Length = 236

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 47/90 (52%), Gaps = 7/90 (7%)

Query: 152 RIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILG 211
           R+ L   L  + L  AY+  M  S D       +L+ REVE L W ++GKT+DEI  IL 
Sbjct: 148 RMCLLADLTHMVLSDAYRKEMTASAD-------KLSAREVEILRWHADGKTADEIGRILS 200

Query: 212 ISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           IS +TV  +  + + K     ++ A+A A 
Sbjct: 201 ISIDTVKFHTKNAVVKLGASNKTAAVARAA 230


>gi|94263624|ref|ZP_01287434.1| regulatory protein, LuxR:Response regulator receiver [delta
           proteobacterium MLMS-1]
 gi|93456044|gb|EAT06195.1| regulatory protein, LuxR:Response regulator receiver [delta
           proteobacterium MLMS-1]
          Length = 218

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           + LT RE E L W+SEGK++ EI VI  IS NTV +++  +M K     R
Sbjct: 153 YGLTPREREILHWLSEGKSNHEIGVITDISENTVKSHVKKLMSKFKVNNR 202


>gi|86356681|ref|YP_468573.1| LuxR family transcriptional regulator [Rhizobium etli CFN 42]
 gi|86280783|gb|ABC89846.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli CFN 42]
          Length = 86

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           +T RE E + W+++GKT+ EI  ILGIS  TVN +I++   K      +  +A A+RN I
Sbjct: 25  VTPREREIIGWMAQGKTAAEIGTILGISPITVNTHISNAKAKLGVFKETALVAAALRNGI 84

Query: 246 V 246
           +
Sbjct: 85  I 85


>gi|326408213|gb|ADZ65278.1| Transcriptional activator, LUXR family [Brucella melitensis M28]
 gi|326537928|gb|ADZ86143.1| Transcriptional activator protein solR [Brucella melitensis M5-90]
          Length = 171

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 35/58 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           D  LT RE E L W SEGKT++ I  IL IS  TVN +I++++ K     +  A+A A
Sbjct: 108 DVSLTLREREILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKA 165


>gi|313887441|ref|ZP_07821130.1| transcriptional regulator, LuxR family [Porphyromonas
           asaccharolytica PR426713P-I]
 gi|312923083|gb|EFR33903.1| transcriptional regulator, LuxR family [Porphyromonas
           asaccharolytica PR426713P-I]
          Length = 201

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 41/73 (56%)

Query: 174 KSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           +S +    K   L+ RE E +TW++ G T+ EIA +L +S +TV  +  +I  K    + 
Sbjct: 121 ESLESEEAKQTPLSQRECEVVTWVARGLTNKEIADVLHLSPHTVVTHRRNIAAKLDIHSP 180

Query: 234 SGAIAYAVRNNIV 246
           SG   YA+ NN++
Sbjct: 181 SGLTIYALMNNLI 193


>gi|294851589|ref|ZP_06792262.1| LuxR family transcriptional regulator [Brucella sp. NVSL 07-0026]
 gi|294820178|gb|EFG37177.1| LuxR family transcriptional regulator [Brucella sp. NVSL 07-0026]
          Length = 238

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 35/58 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           D  LT RE E L W SEGKT++ I  IL IS  TVN +I++++ K     +  A+A A
Sbjct: 175 DVSLTLREREILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKA 232


>gi|260461917|ref|ZP_05810162.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|259032164|gb|EEW33430.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
          Length = 243

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE ECL W + GK+  EI+ ILGIS +T   ++ +   K     R  A+A A+R  
Sbjct: 181 ELTPRERECLQWAAVGKSEWEISQILGISEHTSEKHLLNAKSKLGAVNRVQAVAEAIRRG 240

Query: 245 IV 246
            +
Sbjct: 241 YI 242


>gi|329940650|ref|ZP_08289931.1| response regulator [Streptomyces griseoaurantiacus M045]
 gi|329300711|gb|EGG44608.1| response regulator [Streptomyces griseoaurantiacus M045]
          Length = 287

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (56%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G D  L+ REV+ L W++ G T+  +A  LG+   TV  Y+ S MRK   +TR  A+  A
Sbjct: 221 GADVGLSPREVDVLAWVAVGATNAGVAERLGVRPETVKAYLRSAMRKLGARTRGEAVVAA 280


>gi|301059949|ref|ZP_07200832.1| transcriptional regulator, LuxR family [delta proteobacterium
           NaphS2]
 gi|300445958|gb|EFK09840.1| transcriptional regulator, LuxR family [delta proteobacterium
           NaphS2]
          Length = 294

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++EG +++EI+ +L IS +TV ++I  I  K     R+ A  +A R+N+
Sbjct: 234 LTPRELEVLCILAEGTSNNEISHMLNISPHTVKSHIIHIFNKLGVNDRTQAAVWAARHNL 293

Query: 246 V 246
           +
Sbjct: 294 I 294


>gi|292670350|ref|ZP_06603776.1| nitrate/nitrite response regulator [Selenomonas noxia ATCC 43541]
 gi|292648081|gb|EFF66053.1| nitrate/nitrite response regulator [Selenomonas noxia ATCC 43541]
          Length = 223

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE++ L  I++G ++ +I   LG+S  TV N++ SI  K     R+ A+ Y ++N I
Sbjct: 160 LTPREMDVLGCIAKGFSNQDIGKALGLSEKTVKNHLTSIFHKLKVNDRTQALVYVLKNKI 219

Query: 246 V 246
           V
Sbjct: 220 V 220


>gi|254718404|ref|ZP_05180215.1| Transcriptional activator, LUXR family protein [Brucella sp. 83/13]
 gi|306840172|ref|ZP_07472955.1| LuxR family transcriptional regulator [Brucella sp. NF 2653]
 gi|306844457|ref|ZP_07477047.1| LuxR family transcriptional regulator [Brucella sp. BO1]
 gi|306275270|gb|EFM57020.1| LuxR family transcriptional regulator [Brucella sp. BO1]
 gi|306404737|gb|EFM61033.1| LuxR family transcriptional regulator [Brucella sp. NF 2653]
          Length = 235

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 35/58 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           D  LT RE E L W SEGKT++ I  IL IS  TVN +I++++ K     +  A+A A
Sbjct: 172 DVSLTLREREILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKA 229


>gi|167464268|ref|ZP_02329357.1| two component transcriptional regulator, LuxR family protein
           [Paenibacillus larvae subsp. larvae BRL-230010]
 gi|322383996|ref|ZP_08057726.1| two-component response regulator YfiJ-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321151473|gb|EFX44660.1| two-component response regulator YfiJ-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 225

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E +  +S+G  + +IA+ L IS NTV N++ +I+ K   + R    AYAV++ +
Sbjct: 158 LTARETEIVAHVSKGYNNKQIALRLSISENTVKNHMKNILDKLNLENRVQLTAYAVKHQL 217


>gi|296331212|ref|ZP_06873685.1| two-component response regulator [YvqE] responding to cell wall
           stress [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305675910|ref|YP_003867582.1| two-component response regulator [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296151663|gb|EFG92539.1| two-component response regulator [YvqE] responding to cell wall
           stress [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305414154|gb|ADM39273.1| two-component response regulator [liaS] responding to cell wall
           stress [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 211

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  I+EGKT+ EI   L I+  TV  +I +I+ K     R+ A  YA RN++
Sbjct: 150 LTKRELEILCLIAEGKTNKEIGEELFITIKTVKTHITNILSKLDVSDRTQAAVYAHRNHL 209

Query: 246 V 246
           V
Sbjct: 210 V 210


>gi|308175040|ref|YP_003921745.1| transcriptional regulatory protein liaR [Bacillus amyloliquefaciens
           DSM 7]
 gi|307607904|emb|CBI44275.1| Transcriptional regulatory protein liaR [Bacillus amyloliquefaciens
           DSM 7]
 gi|328555009|gb|AEB25501.1| Transcriptional regulatory protein liaR [Bacillus amyloliquefaciens
           TA208]
 gi|328913364|gb|AEB64960.1| Transcriptional regulatory protein liaR [Bacillus amyloliquefaciens
           LL3]
          Length = 210

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++EGKT+ EI   L I+  TV  +I +I+ K     R+ A  YA RN++
Sbjct: 149 LTKRELEILCLVAEGKTNKEIGEELFITIKTVKTHITNILSKLDVSDRTQAAVYAHRNHL 208

Query: 246 V 246
           V
Sbjct: 209 V 209


>gi|306842528|ref|ZP_07475179.1| Transcriptional activator, LUXR family protein [Brucella sp. BO2]
 gi|306287384|gb|EFM58864.1| Transcriptional activator, LUXR family protein [Brucella sp. BO2]
          Length = 171

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 35/58 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           D  LT RE E L W SEGKT++ I  IL IS  TVN +I++++ K     +  A+A A
Sbjct: 108 DVSLTLREREILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKA 165


>gi|289628275|ref|ZP_06461229.1| putative LuxR-family regulatory protein [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
          Length = 262

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (59%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE+ECL W S GKTS EI+ IL  S  TV+ ++ +  RK  + +R  A+  A    
Sbjct: 174 DLTPRELECLYWASAGKTSWEISHILTRSERTVDFHLLNARRKLGSVSRQQAVGSAAARG 233

Query: 245 IV 246
           ++
Sbjct: 234 LL 235


>gi|256368654|ref|YP_003106160.1| transcriptional regulator, LuxR autoinducer regulated family
           [Brucella microti CCM 4915]
 gi|255998812|gb|ACU47211.1| transcriptional regulator, LuxR autoinducer regulated family
           [Brucella microti CCM 4915]
          Length = 235

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 35/58 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           D  LT RE E L W SEGKT++ I  IL IS  TVN +I++++ K     +  A+A A
Sbjct: 172 DVSLTLREREILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKA 229


>gi|23501101|ref|NP_697228.1| LuxR family transcriptional regulator [Brucella suis 1330]
 gi|62289164|ref|YP_220957.1| LuxR family transcriptional regulator [Brucella abortus bv. 1 str.
           9-941]
 gi|82699104|ref|YP_413678.1| transcriptional regulator LuxR family protein [Brucella melitensis
           biovar Abortus 2308]
 gi|163842459|ref|YP_001626863.1| transcriptional activator protein solR [Brucella suis ATCC 23445]
 gi|254694980|ref|ZP_05156808.1| Transcriptional activator, LUXR family protein [Brucella abortus
           bv. 3 str. Tulya]
 gi|254696612|ref|ZP_05158440.1| Transcriptional activator, LUXR family protein [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|254700994|ref|ZP_05162822.1| Transcriptional activator, LUXR family protein [Brucella suis bv. 5
           str. 513]
 gi|254705366|ref|ZP_05167194.1| Transcriptional activator, LUXR family protein [Brucella suis bv. 3
           str. 686]
 gi|254707120|ref|ZP_05168948.1| Transcriptional activator, LUXR family protein [Brucella
           pinnipedialis M163/99/10]
 gi|254709336|ref|ZP_05171147.1| Transcriptional activator, LUXR family protein [Brucella
           pinnipedialis B2/94]
 gi|254713241|ref|ZP_05175052.1| Transcriptional activator, LUXR family protein [Brucella ceti
           M644/93/1]
 gi|254716405|ref|ZP_05178216.1| Transcriptional activator, LUXR family protein [Brucella ceti
           M13/05/1]
 gi|254731525|ref|ZP_05190103.1| Transcriptional activator, LUXR family protein [Brucella abortus
           bv. 4 str. 292]
 gi|256030859|ref|ZP_05444473.1| Transcriptional activator, LUXR family protein [Brucella
           pinnipedialis M292/94/1]
 gi|256045980|ref|ZP_05448852.1| Transcriptional activator, LUXR family protein [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256060329|ref|ZP_05450502.1| Transcriptional activator, LUXR family protein [Brucella neotomae
           5K33]
 gi|256112692|ref|ZP_05453613.1| Transcriptional activator, LUXR family protein [Brucella melitensis
           bv. 3 str. Ether]
 gi|256158890|ref|ZP_05456740.1| Transcriptional activator, LUXR family protein [Brucella ceti
           M490/95/1]
 gi|256254264|ref|ZP_05459800.1| Transcriptional activator, LUXR family protein [Brucella ceti
           B1/94]
 gi|256258748|ref|ZP_05464284.1| Transcriptional activator, LUXR family protein [Brucella abortus
           bv. 9 str. C68]
 gi|260169762|ref|ZP_05756573.1| Transcriptional activator, LUXR family protein [Brucella sp. F5/99]
 gi|23346971|gb|AAN29143.1| transcriptional regulator, LuxR autoinducer regulated family
           [Brucella suis 1330]
 gi|62195296|gb|AAX73596.1| transcriptional regulator, LuxR autoinducer regulated family
           [Brucella abortus bv. 1 str. 9-941]
 gi|82615205|emb|CAJ10146.1| Bacterial regulatory protein, LuxR family:Autoinducer binding
           domain [Brucella melitensis biovar Abortus 2308]
 gi|163673182|gb|ABY37293.1| Transcriptional activator protein solR [Brucella suis ATCC 23445]
          Length = 235

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 35/58 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           D  LT RE E L W SEGKT++ I  IL IS  TVN +I++++ K     +  A+A A
Sbjct: 172 DVSLTLREREILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKA 229


>gi|260756046|ref|ZP_05868394.1| autoinducer-binding domain-containing protein [Brucella abortus bv.
           6 str. 870]
 gi|260676154|gb|EEX62975.1| autoinducer-binding domain-containing protein [Brucella abortus bv.
           6 str. 870]
          Length = 238

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 35/58 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           D  LT RE E L W SEGKT++ I  IL IS  TVN +I++++ K     +  A+A A
Sbjct: 175 DVSLTLREREILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKA 232


>gi|312112563|ref|YP_003990879.1| LuxR family transcriptional regulator [Geobacillus sp. Y4.1MC1]
 gi|311217664|gb|ADP76268.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. Y4.1MC1]
          Length = 185

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 42/61 (68%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT  E++ L +ISE +T+ EI+ +L IS+ TV ++++SI+RK    +R GA+  A++  I
Sbjct: 124 LTKVELKILQFISEDRTNAEISELLNISKRTVEHHVSSILRKLDVDSRVGAVVKAMKLGI 183

Query: 246 V 246
           +
Sbjct: 184 L 184


>gi|94266341|ref|ZP_01290042.1| regulatory protein, LuxR:Response regulator receiver [delta
           proteobacterium MLMS-1]
 gi|93453055|gb|EAT03537.1| regulatory protein, LuxR:Response regulator receiver [delta
           proteobacterium MLMS-1]
          Length = 218

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           + LT RE E L W+SEGK++ EI VI  IS NTV +++  +M K     R
Sbjct: 153 YGLTPREREILHWLSEGKSNHEIGVITDISENTVKSHVKKLMSKFKVNNR 202


>gi|302542744|ref|ZP_07295086.1| DNA-binding response regulator [Streptomyces hygroscopicus ATCC
           53653]
 gi|302460362|gb|EFL23455.1| DNA-binding response regulator [Streptomyces himastatinicus ATCC
           53653]
          Length = 201

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 37/55 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           LT RE E L   ++G T+ E+A  LG+S+ TV NY+++ ++KTA + R+ A+  A
Sbjct: 141 LTAREREVLGASADGSTNAELARALGLSQGTVRNYLSTAIQKTAARNRADAVRIA 195


>gi|170700319|ref|ZP_02891331.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           IOP40-10]
 gi|170134753|gb|EDT03069.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           IOP40-10]
          Length = 239

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTAREREVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAIGAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|172063602|ref|YP_001811253.1| LuxR family transcriptional regulator [Burkholderia ambifaria
           MC40-6]
 gi|171996119|gb|ACB67037.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MC40-6]
          Length = 239

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTAREREVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAIGAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|89055684|ref|YP_511135.1| LuxR family transcriptional regulator [Jannaschia sp. CCS1]
 gi|88865233|gb|ABD56110.1| transcriptional regulator, LuxR family [Jannaschia sp. CCS1]
          Length = 243

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 48/91 (52%), Gaps = 2/91 (2%)

Query: 151 GRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVIL 210
           GR I   +L   GL+A  + ++      H  +   L+ RE ECL W+S G    +IA  L
Sbjct: 148 GREIAAMQLQLAGLIAFERLSVLTRQANHAHR--RLSPRERECLQWLSAGLRVTQIAHRL 205

Query: 211 GISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
            IS + V+ YI +  RK   +TR  A+A+A+
Sbjct: 206 DISESAVHLYIKNARRKFGARTREQAVAHAI 236


>gi|330941017|gb|EGH43939.1| putative LuxR family regulatory protein [Pseudomonas syringae pv.
           pisi str. 1704B]
          Length = 262

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (59%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE+ECL W S GKTS EI+ IL  S  TV+ ++ +  RK  + +R  A+  A    
Sbjct: 174 DLTPRELECLYWASAGKTSWEISHILTRSERTVDFHLLNARRKLGSVSRQQAVGSAAARG 233

Query: 245 IV 246
           ++
Sbjct: 234 LL 235


>gi|328552560|gb|AEB23052.1| two-component response regulator (YhcY) [Bacillus amyloliquefaciens
           TA208]
 gi|328910960|gb|AEB62556.1| two-component response regulator [Bacillus amyloliquefaciens LL3]
          Length = 214

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 42/69 (60%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           D +  K ++LT RE + L  I++GK++ EIA  L IS  TV  ++++++ K     R+ A
Sbjct: 140 DQNKEKYYQLTPREKDVLQEIAKGKSNKEIAASLFISEKTVKTHVSNLLSKLNLSDRTQA 199

Query: 237 IAYAVRNNI 245
             YAV+ NI
Sbjct: 200 ALYAVKYNI 208


>gi|265983368|ref|ZP_06096103.1| autoinducer-binding domain-containing protein [Brucella sp. 83/13]
 gi|264661960|gb|EEZ32221.1| autoinducer-binding domain-containing protein [Brucella sp. 83/13]
          Length = 238

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 35/58 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           D  LT RE E L W SEGKT++ I  IL IS  TVN +I++++ K     +  A+A A
Sbjct: 175 DVSLTLREREILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKA 232


>gi|253573655|ref|ZP_04850998.1| two-component system response regulator [Paenibacillus sp. oral
           taxon 786 str. D14]
 gi|251847183|gb|EES75188.1| two-component system response regulator [Paenibacillus sp. oral
           taxon 786 str. D14]
          Length = 215

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 37/64 (57%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G+   LT RE E L W+++G T+ EIA +L IS  TV N++ +I++K   + R     YA
Sbjct: 146 GEQPPLTAREREILGWVAQGMTNREIAGVLHISDQTVKNHLKNILQKLHLENRVQLTRYA 205

Query: 241 VRNN 244
           +   
Sbjct: 206 LEQG 209


>gi|163800212|ref|ZP_02194113.1| putative transcriptional regulator, LuxR family protein [Vibrio sp.
           AND4]
 gi|159175655|gb|EDP60449.1| putative transcriptional regulator, LuxR family protein [Vibrio sp.
           AND4]
          Length = 216

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 164 LLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           LL  Y+    +S  +    + ELT RE++ L  + EG ++ EIA  L IS +T+ +++ +
Sbjct: 137 LLTYYKGKELQSM-IEPATEVELTRREIQVLKMLKEGGSNIEIADSLFISEHTIKSHLYN 195

Query: 224 IMRKTATKTRSGAIAYAVRN 243
           I RK   K R+ A  +A RN
Sbjct: 196 IFRKIEVKNRTQATRWAKRN 215


>gi|94269857|ref|ZP_01291582.1| regulatory protein, LuxR:Response regulator receiver [delta
           proteobacterium MLMS-1]
 gi|93451041|gb|EAT02000.1| regulatory protein, LuxR:Response regulator receiver [delta
           proteobacterium MLMS-1]
          Length = 218

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           + LT RE E L W+SEGK++ EI VI  IS NTV +++  +M K     R
Sbjct: 153 YGLTPREREILHWLSEGKSNHEIGVITDISENTVKSHVKKLMSKFKVNNR 202


>gi|226311198|ref|YP_002771092.1| transcriptional regulator [Brevibacillus brevis NBRC 100599]
 gi|226094146|dbj|BAH42588.1| probable transcriptional regulator [Brevibacillus brevis NBRC
           100599]
          Length = 228

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 49/84 (58%), Gaps = 2/84 (2%)

Query: 165 LAAYQANMFK--SYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIA 222
           L+AY + + K  + D    K  +L+ REVE +  +S G++  E+A  +GIS  TV +YI 
Sbjct: 144 LSAYCSMLGKVLATDSLRPKTVKLSRREVEVMQRMSWGESVKEMASWMGISEFTVQDYIK 203

Query: 223 SIMRKTATKTRSGAIAYAVRNNIV 246
           S ++K   + R+  +A A+R  I+
Sbjct: 204 SALKKLGVQNRAQGVADAIRQRII 227


>gi|332299624|ref|YP_004441545.1| transcriptional regulator, LuxR family [Porphyromonas
           asaccharolytica DSM 20707]
 gi|332176687|gb|AEE12377.1| transcriptional regulator, LuxR family [Porphyromonas
           asaccharolytica DSM 20707]
          Length = 201

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 41/73 (56%)

Query: 174 KSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           +S +    K   L+ RE E +TW++ G T+ EIA +L +S +TV  +  +I  K    + 
Sbjct: 121 ESLESEEAKQTPLSQRECEVVTWVARGLTNKEIADVLHLSPHTVVTHRRNIAAKLDIHSP 180

Query: 234 SGAIAYAVRNNIV 246
           SG   YA+ NN++
Sbjct: 181 SGLTIYALMNNLI 193


>gi|322437503|ref|YP_004219593.1| two component transcriptional regulator, LuxR family
           [Acidobacterium sp. MP5ACTX9]
 gi|321165396|gb|ADW71099.1| two component transcriptional regulator, LuxR family
           [Acidobacterium sp. MP5ACTX9]
          Length = 207

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L  I++G+++ EIA  LGI+  TV  +++S++ K   + R+ A  YA++  
Sbjct: 143 DLTPRESEVLVCITQGRSNQEIADELGIAEKTVRIHVSSLLDKMGARDRTQATIYALQRG 202

Query: 245 IV 246
           +V
Sbjct: 203 LV 204


>gi|296268760|ref|YP_003651392.1| LuxR family two component transcriptional regulator [Thermobispora
           bispora DSM 43833]
 gi|296091547|gb|ADG87499.1| two component transcriptional regulator, LuxR family [Thermobispora
           bispora DSM 43833]
          Length = 234

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  +++G  + EIA  L IS NTV N++ +I+ K    +R  A+ YAVR  +
Sbjct: 171 LTEREMEVLRLVAKGMHNREIAKALFISENTVKNHVRNILDKLQLHSRMEAVVYAVRERL 230

Query: 246 V 246
           +
Sbjct: 231 L 231


>gi|206601912|gb|EDZ38394.1| Putative two component transcriptional regulator, LuxR family
           [Leptospirillum sp. Group II '5-way CG']
          Length = 211

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 39/68 (57%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H   D  L+ RE E L  +S+G ++ EI  I GIS +TV  +I SI+ K +  TR+ A  
Sbjct: 144 HPENDNPLSPRETEILKLLSKGLSNREIGDIAGISLSTVKAHIQSILEKLSASTRADAAV 203

Query: 239 YAVRNNIV 246
            A++  ++
Sbjct: 204 KAIKKGLI 211


>gi|17988041|ref|NP_540675.1| transcriptional activator, LUXR family [Brucella melitensis bv. 1
           str. 16M]
 gi|161618178|ref|YP_001592065.1| transcriptional activator protein solR [Brucella canis ATCC 23365]
 gi|189023440|ref|YP_001934208.1| LuxR family transcriptional regulator [Brucella abortus S19]
 gi|225626726|ref|ZP_03784765.1| Transcriptional activator protein solR [Brucella ceti str. Cudo]
 gi|237814657|ref|ZP_04593655.1| Transcriptional activator protein solR [Brucella abortus str. 2308
           A]
 gi|260546462|ref|ZP_05822202.1| transcriptional activator [Brucella abortus NCTC 8038]
 gi|260563261|ref|ZP_05833747.1| transcriptional activator [Brucella melitensis bv. 1 str. 16M]
 gi|260567174|ref|ZP_05837644.1| transcriptional activator [Brucella suis bv. 4 str. 40]
 gi|260759270|ref|ZP_05871618.1| autoinducer-binding domain-containing protein [Brucella abortus bv.
           4 str. 292]
 gi|260760992|ref|ZP_05873335.1| autoinducer-binding domain-containing protein [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260885067|ref|ZP_05896681.1| autoinducer-binding domain-containing protein [Brucella abortus bv.
           9 str. C68]
 gi|261215322|ref|ZP_05929603.1| autoinducer-binding domain-containing protein [Brucella abortus bv.
           3 str. Tulya]
 gi|261218189|ref|ZP_05932470.1| autoinducer-binding domain-containing protein [Brucella ceti
           M13/05/1]
 gi|261221416|ref|ZP_05935697.1| autoinducer-binding domain-containing protein [Brucella ceti B1/94]
 gi|261314598|ref|ZP_05953795.1| autoinducer-binding domain-containing protein [Brucella
           pinnipedialis M163/99/10]
 gi|261316846|ref|ZP_05956043.1| autoinducer-binding domain-containing protein [Brucella
           pinnipedialis B2/94]
 gi|261320963|ref|ZP_05960160.1| autoinducer-binding domain-containing protein [Brucella ceti
           M644/93/1]
 gi|261324304|ref|ZP_05963501.1| autoinducer-binding domain-containing protein [Brucella neotomae
           5K33]
 gi|261751515|ref|ZP_05995224.1| autoinducer-binding domain-containing protein [Brucella suis bv. 5
           str. 513]
 gi|261756080|ref|ZP_05999789.1| autoinducer-binding domain-containing protein [Brucella suis bv. 3
           str. 686]
 gi|261759304|ref|ZP_06003013.1| transcriptional activator [Brucella sp. F5/99]
 gi|265987917|ref|ZP_06100474.1| autoinducer-binding domain-containing protein [Brucella
           pinnipedialis M292/94/1]
 gi|265992391|ref|ZP_06104948.1| autoinducer-binding domain-containing protein [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|265994134|ref|ZP_06106691.1| autoinducer-binding domain-containing protein [Brucella melitensis
           bv. 3 str. Ether]
 gi|265997378|ref|ZP_06109935.1| autoinducer-binding domain-containing protein [Brucella ceti
           M490/95/1]
 gi|297247581|ref|ZP_06931299.1| LuxR family transcriptional regulator [Brucella abortus bv. 5 str.
           B3196]
 gi|17983788|gb|AAL52939.1| transcriptional activator, luxr family [Brucella melitensis bv. 1
           str. 16M]
 gi|161334989|gb|ABX61294.1| Transcriptional activator protein solR [Brucella canis ATCC 23365]
 gi|189019012|gb|ACD71734.1| Transcriptional activator, LUXR family [Brucella abortus S19]
 gi|225618383|gb|EEH15426.1| Transcriptional activator protein solR [Brucella ceti str. Cudo]
 gi|237789494|gb|EEP63704.1| Transcriptional activator protein solR [Brucella abortus str. 2308
           A]
 gi|260096569|gb|EEW80445.1| transcriptional activator [Brucella abortus NCTC 8038]
 gi|260153277|gb|EEW88369.1| transcriptional activator [Brucella melitensis bv. 1 str. 16M]
 gi|260156692|gb|EEW91772.1| transcriptional activator [Brucella suis bv. 4 str. 40]
 gi|260669588|gb|EEX56528.1| autoinducer-binding domain-containing protein [Brucella abortus bv.
           4 str. 292]
 gi|260671424|gb|EEX58245.1| autoinducer-binding domain-containing protein [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260874595|gb|EEX81664.1| autoinducer-binding domain-containing protein [Brucella abortus bv.
           9 str. C68]
 gi|260916929|gb|EEX83790.1| autoinducer-binding domain-containing protein [Brucella abortus bv.
           3 str. Tulya]
 gi|260920000|gb|EEX86653.1| autoinducer-binding domain-containing protein [Brucella ceti B1/94]
 gi|260923278|gb|EEX89846.1| autoinducer-binding domain-containing protein [Brucella ceti
           M13/05/1]
 gi|261293653|gb|EEX97149.1| autoinducer-binding domain-containing protein [Brucella ceti
           M644/93/1]
 gi|261296069|gb|EEX99565.1| autoinducer-binding domain-containing protein [Brucella
           pinnipedialis B2/94]
 gi|261300284|gb|EEY03781.1| autoinducer-binding domain-containing protein [Brucella neotomae
           5K33]
 gi|261303624|gb|EEY07121.1| autoinducer-binding domain-containing protein [Brucella
           pinnipedialis M163/99/10]
 gi|261739288|gb|EEY27284.1| transcriptional activator [Brucella sp. F5/99]
 gi|261741268|gb|EEY29194.1| autoinducer-binding domain-containing protein [Brucella suis bv. 5
           str. 513]
 gi|261745833|gb|EEY33759.1| autoinducer-binding domain-containing protein [Brucella suis bv. 3
           str. 686]
 gi|262551846|gb|EEZ07836.1| autoinducer-binding domain-containing protein [Brucella ceti
           M490/95/1]
 gi|262765115|gb|EEZ11036.1| autoinducer-binding domain-containing protein [Brucella melitensis
           bv. 3 str. Ether]
 gi|263003457|gb|EEZ15750.1| autoinducer-binding domain-containing protein [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|264660114|gb|EEZ30375.1| autoinducer-binding domain-containing protein [Brucella
           pinnipedialis M292/94/1]
 gi|297174750|gb|EFH34097.1| LuxR family transcriptional regulator [Brucella abortus bv. 5 str.
           B3196]
          Length = 238

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 35/58 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           D  LT RE E L W SEGKT++ I  IL IS  TVN +I++++ K     +  A+A A
Sbjct: 175 DVSLTLREREILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKA 232


>gi|225851721|ref|YP_002731954.1| transcriptional activator protein solR [Brucella melitensis ATCC
           23457]
 gi|265999658|ref|ZP_06111771.1| transcriptional activator [Brucella melitensis bv. 2 str. 63/9]
 gi|225640086|gb|ACN99999.1| Transcriptional activator protein solR [Brucella melitensis ATCC
           23457]
 gi|263095176|gb|EEZ18845.1| transcriptional activator [Brucella melitensis bv. 2 str. 63/9]
          Length = 238

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 35/58 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           D  LT RE E L W SEGKT++ I  IL IS  TVN +I++++ K     +  A+A A
Sbjct: 175 DVSLTLREREILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKA 232


>gi|156976380|ref|YP_001447286.1| hypothetical protein VIBHAR_05153 [Vibrio harveyi ATCC BAA-1116]
 gi|156527974|gb|ABU73059.1| hypothetical protein VIBHAR_05153 [Vibrio harveyi ATCC BAA-1116]
          Length = 218

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 44/79 (55%)

Query: 165 LAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASI 224
           L  Y      +Y +    + ELT REV+ L  + +G ++ EIA  L IS +T+ +++ +I
Sbjct: 139 LLTYYKGKESNYIIEPAIEVELTRREVQVLQMLKDGGSNMEIADSLFISEHTIKSHLYNI 198

Query: 225 MRKTATKTRSGAIAYAVRN 243
            RK   K R+ A ++A RN
Sbjct: 199 FRKIEVKNRTQATSWAKRN 217


>gi|163761091|ref|ZP_02168168.1| putative transcriptional regulator protein, LuxR family [Hoeflea
           phototrophica DFL-43]
 gi|162281642|gb|EDQ31936.1| putative transcriptional regulator protein, LuxR family [Hoeflea
           phototrophica DFL-43]
          Length = 260

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           E   R+   L+  SEG TS +IAV L IS +TVN  +AS++R+     R   IA A+R  
Sbjct: 198 EFDARDAAILSLTSEGLTSQQIAVELKISEHTVNANVASMIRRLGVLNRPQLIATAIRKG 257

Query: 245 IV 246
           ++
Sbjct: 258 LI 259


>gi|311896318|dbj|BAJ28726.1| putative two-component system response regulator [Kitasatospora
           setae KM-6054]
          Length = 241

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 45/88 (51%), Gaps = 6/88 (6%)

Query: 165 LAAYQANMFKSYDVHWGKDFEL------TGREVECLTWISEGKTSDEIAVILGISRNTVN 218
           +AA     FKS       D EL      T RE+E L  ++ G  + EIA  L IS NTV 
Sbjct: 151 MAAKLLTEFKSMIQRRSDDRELLPAPRLTDRELEVLKLVATGMNNREIAKELFISENTVK 210

Query: 219 NYIASIMRKTATKTRSGAIAYAVRNNIV 246
           N++ +I+ K    +R  A+ YA+R  I+
Sbjct: 211 NHVRNILEKLQLHSRMEAVVYAMREKIL 238


>gi|262203353|ref|YP_003274561.1| response regulator receiver [Gordonia bronchialis DSM 43247]
 gi|262086700|gb|ACY22668.1| response regulator receiver [Gordonia bronchialis DSM 43247]
          Length = 228

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE + L  ++ G+T+ EIA  LGIS  TV ++I  I  K   + R+ AI YA  ++
Sbjct: 162 ELTERETDVLRLVARGRTNAEIAAGLGISEVTVKSHINHIFTKLDLRDRAAAIVYAFDHS 221

Query: 245 IV 246
           +V
Sbjct: 222 LV 223


>gi|154687422|ref|YP_001422583.1| YvqC [Bacillus amyloliquefaciens FZB42]
 gi|154353273|gb|ABS75352.1| YvqC [Bacillus amyloliquefaciens FZB42]
          Length = 210

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++EGKT+ EI   L I+  TV  +I +I+ K     R+ A  YA RN++
Sbjct: 149 LTKRELEILCLVAEGKTNKEIGEELFITIKTVKTHITNILSKLDVSDRTQAAVYAHRNHL 208

Query: 246 V 246
           V
Sbjct: 209 V 209


>gi|304438628|ref|ZP_07398567.1| nitrate/nitrite response regulator protein NarL [Selenomonas sp.
           oral taxon 149 str. 67H29BP]
 gi|304368466|gb|EFM22152.1| nitrate/nitrite response regulator protein NarL [Selenomonas sp.
           oral taxon 149 str. 67H29BP]
          Length = 233

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 54/101 (53%), Gaps = 7/101 (6%)

Query: 147 LFPKGRIILRDRLWEIGLLAAYQANMFKS-YDVHWGKDFELTGREVECLTWISEGKTSDE 205
           ++PK    L +RL+    ++     M K  +D   G+   LT RE++ L  I++G ++ +
Sbjct: 136 VYPK----LAERLFGTPAISGDVGRMAKEIWDESRGE--RLTPREMDVLGCIAKGLSNQD 189

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           I   LG+S  TV N++ S+  K     R+ A+ Y ++N IV
Sbjct: 190 IGKALGLSEKTVKNHLTSVFHKLKVNDRTQALVYVLKNKIV 230


>gi|296159892|ref|ZP_06842713.1| two component transcriptional regulator, LuxR family [Burkholderia
           sp. Ch1-1]
 gi|295889875|gb|EFG69672.1| two component transcriptional regulator, LuxR family [Burkholderia
           sp. Ch1-1]
          Length = 364

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           F LT RE E L W+S GKT+ +I  ILG++  TVN ++  +  K   +TR
Sbjct: 301 FSLTAREAEVLLWLSRGKTNRDIGDILGMAPRTVNKHLEHVFGKLHVETR 350


>gi|295695123|ref|YP_003588361.1| two component transcriptional regulator, LuxR family [Bacillus
           tusciae DSM 2912]
 gi|295410725|gb|ADG05217.1| two component transcriptional regulator, LuxR family [Bacillus
           tusciae DSM 2912]
          Length = 216

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 35/58 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           LT RE E L  I+ G+++ EIA  L IS NTV N++ +IM K   K R+   A AVR 
Sbjct: 153 LTPREREILGLIARGRSNREIAQALTISENTVKNHLKNIMAKLDVKNRAQLAALAVRG 210


>gi|254780693|ref|YP_003065106.1| transcriptional regulator protein [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040370|gb|ACT57166.1| transcriptional regulator protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 235

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 33/57 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           LT RE  CL    +G TS+EIA  LG+S +TVN Y+ S   K     R  AIA A+R
Sbjct: 174 LTERETSCLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIR 230


>gi|146340687|ref|YP_001205735.1| LuxR family transcriptional regulator [Bradyrhizobium sp. ORS278]
 gi|146193493|emb|CAL77509.1| putative transcriptional regulatory protein, LuxR family
           [Bradyrhizobium sp. ORS278]
          Length = 133

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 3/70 (4%)

Query: 180 WGKD---FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
            G+D   F+LT RE + L  ++EG ++ EIA  LGIS +T   ++ S++ K     R+ A
Sbjct: 62  HGRDSDAFQLTARERDVLALMAEGCSNKEIARSLGISVHTAKFHVGSLLDKLDATGRTDA 121

Query: 237 IAYAVRNNIV 246
           +A+A R  I+
Sbjct: 122 VAHAARRGII 131


>gi|161520519|ref|YP_001583946.1| LuxR family transcriptional regulator [Burkholderia multivorans
           ATCC 17616]
 gi|189353291|ref|YP_001948918.1| LuxR family transcriptional regulator [Burkholderia multivorans
           ATCC 17616]
 gi|221209754|ref|ZP_03582735.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           multivorans CGD1]
 gi|160344569|gb|ABX17654.1| transcriptional regulator, LuxR family [Burkholderia multivorans
           ATCC 17616]
 gi|189337313|dbj|BAG46382.1| LuxR family transcriptional regulator [Burkholderia multivorans
           ATCC 17616]
 gi|221170442|gb|EEE02908.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           multivorans CGD1]
          Length = 239

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTAREREVLCWTAEGKTACEIGQILCISERTVNFHVNNILEKLGATNKVQAVVKAISAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|218674106|ref|ZP_03523775.1| two component transcriptional regulator, LuxR family protein
           [Rhizobium etli GR56]
          Length = 305

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 37/67 (55%)

Query: 174 KSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           +S D    + F LT RE E L WI++GK + +I  ILG+S  TVN ++  I  K   + R
Sbjct: 232 RSDDEALRQRFSLTQRESEVLLWIAKGKANRDIGEILGLSARTVNKHLEQIYVKLGVENR 291

Query: 234 SGAIAYA 240
           + A   A
Sbjct: 292 ASAAVKA 298


>gi|50084356|ref|YP_045866.1| putative transcriptional regulator [Acinetobacter sp. ADP1]
 gi|49530332|emb|CAG68044.1| putative transcriptional regulator, luxR family [Acinetobacter sp.
           ADP1]
          Length = 246

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 33/56 (58%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT RE E L W + G+   EIA IL IS  TV N++ SI +K   K+   AIA A+
Sbjct: 184 LTQREKEILKWTAVGRKQSEIAEILKISERTVENHLRSIRKKLEVKSTGQAIASAL 239


>gi|14627170|gb|AAK50054.2|AF364058_1 transcriptional activator [Burkholderia multivorans ATCC 17616]
          Length = 239

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTAREREVLCWTAEGKTACEIGQILCISERTVNFHVNNILEKLGATNKVQAVVKAISAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|226362510|ref|YP_002780288.1| LuxR family transcriptional regulator [Rhodococcus opacus B4]
 gi|226240995|dbj|BAH51343.1| putative LuxR family transcriptional regulator [Rhodococcus opacus
           B4]
          Length = 127

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 37/56 (66%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           D  LTGRE E L  I++G ++ EI   L ISRNTV  ++++I+RK +   R+ A+A
Sbjct: 63  DDPLTGREHEILGMIADGASNAEIGRDLFISRNTVRFHVSNILRKMSVNNRTAAVA 118


>gi|225875065|ref|YP_002756524.1| two-component response regulator [Acidobacterium capsulatum ATCC
           51196]
 gi|225792729|gb|ACO32819.1| two-component response regulator [Acidobacterium capsulatum ATCC
           51196]
          Length = 213

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 36/62 (58%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  +++G T+ EI  + GIS NT  N++ SI++K     R+ A   A+   
Sbjct: 148 ELTRRETEILEMLAKGLTNKEIGRVFGISENTARNHVNSIIQKLEVSDRTEAATTAILRG 207

Query: 245 IV 246
           I+
Sbjct: 208 II 209


>gi|153832308|ref|ZP_01984975.1| DNA-binding HTH domain-containing protein [Vibrio harveyi HY01]
 gi|148871619|gb|EDL70474.1| DNA-binding HTH domain-containing protein [Vibrio harveyi HY01]
          Length = 217

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 40/61 (65%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + ELT RE++ LT + +G ++ +IA  L +S +TV +++ SI RK   K R  AIA+A R
Sbjct: 155 EIELTRREMQVLTALCQGGSNLDIADSLFVSEHTVKSHLYSIFRKLEVKNRMQAIAWAKR 214

Query: 243 N 243
           N
Sbjct: 215 N 215


>gi|12620901|gb|AAG61130.1|AF330019_1 AHL receptor [Burkholderia multivorans]
          Length = 239

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTAREREVLCWTAEGKTACEIGQILCISERTVNFHVNNILEKLGATNKVQAVVKAISAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|319794223|ref|YP_004155863.1| two component LuxR family transcriptional regulator [Variovorax
           paradoxus EPS]
 gi|315596686|gb|ADU37752.1| two component transcriptional regulator, LuxR family [Variovorax
           paradoxus EPS]
          Length = 303

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 39/75 (52%)

Query: 159 LWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVN 218
           L E  LL A Q +           +  LT RE E L+W+++GKT+ +I  ILG S  TVN
Sbjct: 217 LGETMLLFAMQRDGTAGASSARLAEAALTPRETEVLSWLAKGKTNRDIGEILGTSPRTVN 276

Query: 219 NYIASIMRKTATKTR 233
            ++  I  K   +TR
Sbjct: 277 KHLEHIFEKLGVETR 291


>gi|86358918|ref|YP_470810.1| two-component response regulator protein [Rhizobium etli CFN 42]
 gi|86283020|gb|ABC92083.1| probable two-component response regulator protein [Rhizobium etli
           CFN 42]
          Length = 305

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 41/77 (53%), Gaps = 4/77 (5%)

Query: 164 LLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           L AA Q    +S D    + F LT RE E L WI++GK + +I  ILG+S  TVN ++  
Sbjct: 226 LTAASQ----RSDDEMLRQRFALTQRESEVLLWIAKGKANRDIGEILGLSARTVNKHLEQ 281

Query: 224 IMRKTATKTRSGAIAYA 240
           I  K   + R+ A   A
Sbjct: 282 IYVKLGVENRASAAVKA 298


>gi|155233|gb|AAA27541.1| luxR protein [Aliivibrio fischeri]
 gi|455385|gb|AAA27551.1| regulatory protein [Aliivibrio fischeri]
 gi|225902|prf||1403259A luxR gene
          Length = 250

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +LT RE ECL W  EGK+S +I+ ILG S+ TV  ++ +   K  T  R  +I+ A+
Sbjct: 182 DLTKREKECLAWACEGKSSWDISKILGCSKRTVTFHLTNAQMKLNTTNRCQSISKAI 238


>gi|115358865|ref|YP_776003.1| LuxR family transcriptional regulator [Burkholderia ambifaria AMMD]
 gi|13508495|gb|AAK27306.1| AHL receptor [Burkholderia ambifaria]
 gi|115284153|gb|ABI89669.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           AMMD]
          Length = 239

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTAREREVLRWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAIGAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|188584215|ref|YP_001927660.1| LuxR family transcriptional regulator [Methylobacterium populi
           BJ001]
 gi|179347713|gb|ACB83125.1| transcriptional regulator, LuxR family [Methylobacterium populi
           BJ001]
          Length = 243

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W++EGKT  EI  ++GISR+ V+ ++ S   K    +R+ A+A   R  +
Sbjct: 182 LTPRERESLQWVAEGKTDWEIGELMGISRHGVDFHLRSARVKLGCVSRTQAVAEGFRRGL 241

Query: 246 V 246
           +
Sbjct: 242 I 242


>gi|157412510|ref|YP_001483376.1| LuxR family regulatory protein [Prochlorococcus marinus str. MIT
           9215]
 gi|254526652|ref|ZP_05138704.1| bacterial regulatory protein, LuxR family [Prochlorococcus marinus
           str. MIT 9202]
 gi|157387085|gb|ABV49790.1| Regulatory protein, LuxR family [Prochlorococcus marinus str. MIT
           9215]
 gi|221538076|gb|EEE40529.1| bacterial regulatory protein, LuxR family [Prochlorococcus marinus
           str. MIT 9202]
          Length = 92

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 40/58 (68%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           L+ RE+E +  +++G T+ EIAV L IS+ TV+N+++++  KT +K R   + +A+ N
Sbjct: 16  LSAREMEIIDLVADGLTNQEIAVKLTISKRTVDNHVSNMFTKTGSKNRVALLNWAMDN 73


>gi|312886495|ref|ZP_07746104.1| transcriptional regulator, LuxR family [Mucilaginibacter paludis
           DSM 18603]
 gi|311301123|gb|EFQ78183.1| transcriptional regulator, LuxR family [Mucilaginibacter paludis
           DSM 18603]
          Length = 263

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
            T RE   L +I+EG +S +IA  L IS NT+ N+  +++RKT  K  +  +  AVRN +
Sbjct: 203 FTKREKGVLVYIAEGLSSKQIADKLNISENTIVNHKQNMLRKTNAKNVTELVVMAVRNRV 262

Query: 246 V 246
           +
Sbjct: 263 I 263


>gi|298248918|ref|ZP_06972722.1| transcriptional regulator, LuxR family [Ktedonobacter racemifer DSM
           44963]
 gi|297546922|gb|EFH80789.1| transcriptional regulator, LuxR family [Ktedonobacter racemifer DSM
           44963]
          Length = 788

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 35/62 (56%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT R+VE L  ++EG T  EIA  L IS  TVN ++  I  K    TRS A  YAV   
Sbjct: 727 QLTQRQVEILRLLAEGLTDKEIAERLCISPRTVNAHLNKIYPKIHVSTRSAATRYAVERK 786

Query: 245 IV 246
           ++
Sbjct: 787 LI 788


>gi|163853910|ref|YP_001641953.1| autoinducer-binding domain-containing protein [Methylobacterium
           extorquens PA1]
 gi|163665515|gb|ABY32882.1| Autoinducer-binding domain protein [Methylobacterium extorquens
           PA1]
          Length = 243

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W++EGKT  EI  ++GISR+ V+ ++ S   K    +R+ A+A   R  +
Sbjct: 182 LTPRERESLQWVAEGKTDWEIGELMGISRHGVDFHLRSARVKLGCVSRTQAVAEGFRRGL 241

Query: 246 V 246
           +
Sbjct: 242 I 242


>gi|91787249|ref|YP_548201.1| two component LuxR family transcriptional regulator [Polaromonas
           sp. JS666]
 gi|91696474|gb|ABE43303.1| two component transcriptional regulator, LuxR family [Polaromonas
           sp. JS666]
          Length = 349

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 34/58 (58%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           F+LT RE E L W+ +GK + +IA ILG S  TV  ++  +  K   +TR+ A   A+
Sbjct: 280 FKLTAREAEVLYWVIKGKINRDIAGILGASPATVKKHLEHVYAKLGVETRTAAAGMAL 337


>gi|305673633|ref|YP_003865305.1| two-component response regulator [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|305411877|gb|ADM36996.1| two-component response regulator (paired with YhcY) [Bacillus
           subtilis subsp. spizizenii str. W23]
          Length = 215

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%)

Query: 171 NMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTAT 230
           +M   +D    K ++LT RE + L  I+ GK++ EIA  L IS  TV  ++++++ K   
Sbjct: 135 HMRNQHDPEKEKIYQLTRREKDVLNEIANGKSNKEIAAALFISEKTVKTHVSNLLAKLEV 194

Query: 231 KTRSGAIAYAVRNNI 245
             R+ A  +AV+ N+
Sbjct: 195 ADRTQAALFAVKYNL 209


>gi|256751296|ref|ZP_05492176.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|256749851|gb|EEU62875.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter ethanolicus CCSD1]
          Length = 205

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 37/62 (59%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE+E L  IS G ++ EIA  L +S  TV N++ +I +K   K R+ A  Y ++N 
Sbjct: 141 DLTPREIEILKLISNGYSNKEIAQKLFLSEKTVKNHVYNIFKKLDVKDRTQAAIYMLKNE 200

Query: 245 IV 246
            +
Sbjct: 201 TI 202


>gi|291298679|ref|YP_003509957.1| LuxR family transcriptional regulator [Stackebrandtia nassauensis
           DSM 44728]
 gi|290567899|gb|ADD40864.1| transcriptional regulator, LuxR family [Stackebrandtia nassauensis
           DSM 44728]
          Length = 386

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 41/61 (67%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L+ ++ G ++ ++A  LGIS  TV  ++++++RKT T +R+ A  +AV + 
Sbjct: 299 ELTAREKEVLSCLAAGMSNRQVAKSLGISVRTVTVHVSNLLRKTGTGSRTEAALWAVEHG 358

Query: 245 I 245
           +
Sbjct: 359 L 359


>gi|126649643|ref|ZP_01721884.1| two-component response regulator [Bacillus sp. B14905]
 gi|126593968|gb|EAZ87891.1| two-component response regulator [Bacillus sp. B14905]
          Length = 203

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           LT RE + LT ++EGKT+ EIA  L +S  TV NYI++I+ K     R  AIA
Sbjct: 142 LTERESQVLTLVAEGKTTKEIAAELFLSAGTVRNYISTILEKLNVGNRIEAIA 194


>gi|330870194|gb|EGH04903.1| putative LuxR family regulatory protein [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 280

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (59%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE+ECL W S GKTS EI+ IL  S  TV+ ++ +  RK  + +R  A+  A    
Sbjct: 192 DLTPRELECLYWASAGKTSWEISHILTRSERTVDFHLLNARRKLGSVSRQQAVGSAAARG 251

Query: 245 IV 246
           ++
Sbjct: 252 LL 253


>gi|330992245|ref|ZP_08316193.1| Putative HTH-type transcriptional regulator y4qH [Gluconacetobacter
           sp. SXCC-1]
 gi|329760444|gb|EGG76940.1| Putative HTH-type transcriptional regulator y4qH [Gluconacetobacter
           sp. SXCC-1]
          Length = 244

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (58%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT RE ECLTW+++GK + +I  IL +S NT+  ++ + +RK     R  A   A 
Sbjct: 182 LTRRERECLTWVAQGKDTADIGHILALSDNTIKFHLKNALRKLGCHNRVQAAVKAT 237


>gi|330817555|ref|YP_004361260.1| response regulator receiver protein [Burkholderia gladioli BSR3]
 gi|327369948|gb|AEA61304.1| response regulator receiver protein [Burkholderia gladioli BSR3]
          Length = 324

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (62%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRS 234
           F LT RE E L W+S GKT+ +I  IL ++  TVN ++  + RK   +TRS
Sbjct: 261 FGLTTREAEVLLWVSRGKTNRDIGDILDMAPRTVNKHLEHLFRKLHVETRS 311


>gi|270261276|ref|ZP_06189549.1| transcriptional regulatory protein [Serratia odorifera 4Rx13]
 gi|270044760|gb|EFA17851.1| transcriptional regulatory protein [Serratia odorifera 4Rx13]
          Length = 238

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 33/45 (73%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTAT 230
           LT RE + L W SEGKTS+EIA+++G+S  TVN +I + ++K + 
Sbjct: 178 LTLREKDILRWCSEGKTSEEIAMLMGLSERTVNFHIGNSIKKLSV 222


>gi|297202869|ref|ZP_06920266.1| two-component system response regulator [Streptomyces sviceus ATCC
           29083]
 gi|197715208|gb|EDY59242.1| two-component system response regulator [Streptomyces sviceus ATCC
           29083]
          Length = 230

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REVE L  I+EG T+ EIA  L +S  TV  +I ++  KT  K R+ A+ YA    +
Sbjct: 162 LTAREVEVLALIAEGLTNQEIARELHVSTATVKTHINNLFAKTGIKDRAQAVRYAYAKGL 221

Query: 246 V 246
           V
Sbjct: 222 V 222


>gi|209550642|ref|YP_002282559.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536398|gb|ACI56333.1| two component transcriptional regulator, LuxR family [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 305

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 37/67 (55%)

Query: 174 KSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           +S D    + F LT RE E L WI++GK + +I  ILG+S  TVN ++  I  K   + R
Sbjct: 232 RSDDEMLRQRFSLTQRESEVLLWIAKGKANRDIGEILGLSARTVNKHLEQIYVKLGVENR 291

Query: 234 SGAIAYA 240
           + A   A
Sbjct: 292 ASAAVKA 298


>gi|209550397|ref|YP_002282314.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536153|gb|ACI56088.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 241

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+E + W ++GKTS EI  IL +S +TVN Y+ + ++K     R+  +A A+R  +
Sbjct: 180 LSTRELEVVRWTAQGKTSIEIGQILALSDHTVNAYMTNAIKKLDCVNRTQLVAKAIRLKL 239

Query: 246 V 246
           +
Sbjct: 240 I 240


>gi|328952588|ref|YP_004369922.1| two component transcriptional regulator, LuxR family [Desulfobacca
           acetoxidans DSM 11109]
 gi|328452912|gb|AEB08741.1| two component transcriptional regulator, LuxR family [Desulfobacca
           acetoxidans DSM 11109]
          Length = 222

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 36/59 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           LT RE E L  I+EGK+S EI  +L IS  TV ++ A++MRK   +  +  + YA++  
Sbjct: 155 LTKREKEILRLIAEGKSSKEIGAVLFISSRTVEHHRANMMRKLGCRKIAELVRYAIQKG 213


>gi|297624881|ref|YP_003706315.1| LuxR family two component transcriptional regulator [Truepera
           radiovictrix DSM 17093]
 gi|297166061|gb|ADI15772.1| two component transcriptional regulator, LuxR family [Truepera
           radiovictrix DSM 17093]
          Length = 227

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE   L  +++G ++ EIAV LG+S  TV N ++ I  K     R+ A  YA+R  
Sbjct: 160 ELTEREATILRLLAQGASNQEIAVSLGVSEKTVRNRLSEIFSKLRLNNRTQAALYALREG 219

Query: 245 IV 246
           I 
Sbjct: 220 IA 221


>gi|271962958|ref|YP_003337154.1| response regulator receiver protein [Streptosporangium roseum DSM
           43021]
 gi|270506133|gb|ACZ84411.1| response regulator receiver protein [Streptosporangium roseum DSM
           43021]
          Length = 234

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  +++G  + EIA  L IS NTV N++ +I+ K    +R  A+ YAVR  +
Sbjct: 171 LTDREMEVLRLVAKGMNNREIAKQLFISENTVKNHVRNILDKLQLHSRMEAVVYAVRERM 230

Query: 246 V 246
           +
Sbjct: 231 L 231


>gi|16080361|ref|NP_391188.1| two-component response regulator YvqE responding to cell wall
           stress [Bacillus subtilis subsp. subtilis str. 168]
 gi|221311254|ref|ZP_03593101.1| hypothetical protein Bsubs1_17956 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221315581|ref|ZP_03597386.1| hypothetical protein BsubsN3_17872 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221320496|ref|ZP_03601790.1| hypothetical protein BsubsJ_17835 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221324780|ref|ZP_03606074.1| hypothetical protein BsubsS_17986 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321312856|ref|YP_004205143.1| two-component response regulator YvqE [Bacillus subtilis BSn5]
 gi|68051995|sp|O32197|LIAR_BACSU RecName: Full=Transcriptional regulatory protein liaR
 gi|2635805|emb|CAB15298.1| two-component response regulator [YvqE] responding to cell wall
           stress [Bacillus subtilis subsp. subtilis str. 168]
 gi|2832821|emb|CAA11745.1| YvqC protein [Bacillus subtilis]
 gi|320019130|gb|ADV94116.1| two-component response regulator [YvqE] responding to cell wall
           stress [Bacillus subtilis BSn5]
          Length = 211

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  I+EGKT+ EI   L I+  TV  +I +I+ K     R+ A  YA RN++
Sbjct: 150 LTKRELEILCLIAEGKTNKEIGEELFITIKTVKTHITNILSKLDVSDRTQAAVYAHRNHL 209

Query: 246 V 246
           V
Sbjct: 210 V 210


>gi|251800174|ref|YP_003014905.1| LuxR family transcriptional regulator [Paenibacillus sp. JDR-2]
 gi|247547800|gb|ACT04819.1| transcriptional regulator, LuxR family [Paenibacillus sp. JDR-2]
          Length = 229

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 42/63 (66%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           + L+ +E+  + +I++G T+ EIA  L I+ +TV  +I ++M KT+++ R+ A+A   R 
Sbjct: 166 YALSEKELRVMQYIADGFTTKEIAPFLNIAESTVKYFINNVMLKTSSRNRTEAVANLYRA 225

Query: 244 NIV 246
           N++
Sbjct: 226 NLL 228


>gi|54026217|ref|YP_120459.1| putative two-component system response regulator [Nocardia
           farcinica IFM 10152]
 gi|54017725|dbj|BAD59095.1| putative two-component system response regulator [Nocardia
           farcinica IFM 10152]
          Length = 230

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I  G+ + EIA  LGIS  TV +++  I  K   + R+ AI +A  + 
Sbjct: 162 ELTAREYEVLELIGRGRVNAEIATELGISEVTVKSHVGHIFGKLDLRDRAAAIVFAFDHG 221

Query: 245 IV 246
           +V
Sbjct: 222 VV 223


>gi|27382386|ref|NP_773915.1| transcriptional regulator [Bradyrhizobium japonicum USDA 110]
 gi|27355557|dbj|BAC52540.1| transcriptional regulatory protein [Bradyrhizobium japonicum USDA
           110]
          Length = 123

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 40/65 (61%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +D  LT RE++ L  ++EG ++  IA  LGIS +TV  ++ S++ K     R+ A+A+A 
Sbjct: 57  EDIALTQRELDVLALMAEGASNKMIARQLGISVHTVKFHVGSLLDKLDATGRTDAVAHAA 116

Query: 242 RNNIV 246
           R  ++
Sbjct: 117 RRGVI 121


>gi|226364726|ref|YP_002782508.1| NarL family two-component response regulator [Rhodococcus opacus
           B4]
 gi|226243215|dbj|BAH53563.1| putative NarL family two-component response regulator [Rhodococcus
           opacus B4]
          Length = 230

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query: 164 LLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           +LA Y+  +  S D    +  ELT RE++ L  I  G ++ EI   LGIS  TV +++  
Sbjct: 137 VLATYR-TVAPSTDGERNRLTELTARELDVLALIGRGHSNSEIGRELGISGVTVKSHVGH 195

Query: 224 IMRKTATKTRSGAIAYAVRNNIV 246
           I  K   + R+ AI YA  + IV
Sbjct: 196 IFLKLDLRDRAAAIVYAFDHGIV 218


>gi|148239235|ref|YP_001224622.1| two component system response regulator [Synechococcus sp. WH 7803]
 gi|147847774|emb|CAK23325.1| Possible two component system response regulator [Synechococcus sp.
           WH 7803]
          Length = 227

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 55/110 (50%), Gaps = 9/110 (8%)

Query: 143 GLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-------LTGREVECLT 195
           G+M +   G+ I  D +  +  +A  +   +   DV     +E       L+ RE+E L 
Sbjct: 120 GVMFVSSLGKGIDGDFIRSLSAIA--EGGNYYPKDVQTAAGYEDIEILPELSDREMEVLK 177

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
            +S G T+ EIAV L +S  TV  +++SI+ K   K R+ A+  A++  I
Sbjct: 178 VLSCGMTNKEIAVTLFVSAETVKTHVSSIIGKMGVKDRTQAVIKAIKAGI 227


>gi|27376354|ref|NP_767883.1| transcriptional regulator [Bradyrhizobium japonicum USDA 110]
 gi|27349494|dbj|BAC46508.1| transcriptional regulatory protein [Bradyrhizobium japonicum USDA
           110]
          Length = 242

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 52/101 (51%), Gaps = 2/101 (1%)

Query: 148 FPKGRIILRDR-LWEIGLLAAYQAN-MFKSYDVHWGKDFELTGREVECLTWISEGKTSDE 205
           F    I L +R L  + L+A Y  + + K   +       L+ RE E LT  + G++SDE
Sbjct: 140 FGGAEIDLPERDLPALHLMALYAFDRVLKLRGLPAAPQLALSLREREVLTLAAVGRSSDE 199

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           IA  L I+  TV  +I S  +K    TR+ A+  A+R+ I+
Sbjct: 200 IADALAITGRTVKAHIKSCCKKLGAATRTQAVMIAMRDRII 240


>gi|315121858|ref|YP_004062347.1| transcriptional regulator protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495260|gb|ADR51859.1| transcriptional regulator protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 235

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 33/57 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           LT RE  CL    +G TS+EIA  LG+S +TVN Y+ S   K     R  AIA A+R
Sbjct: 174 LTERETSCLQLAGDGYTSEEIAKKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIR 230


>gi|86739478|ref|YP_479878.1| two component LuxR family transcriptional regulator [Frankia sp.
           CcI3]
 gi|86566340|gb|ABD10149.1| two component transcriptional regulator, LuxR family [Frankia sp.
           CcI3]
          Length = 237

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  +++G  + +IA  L IS NTV N+I +I+ K    +R  A+ YAVR  +
Sbjct: 174 LTDREMEVLRLVAKGMNNRDIAKQLYISENTVKNHIRNILEKLQLHSRMEAVVYAVREKL 233

Query: 246 V 246
           +
Sbjct: 234 L 234


>gi|37523606|ref|NP_926983.1| LuxR family transcriptional regulatory protein [Gloeobacter
           violaceus PCC 7421]
 gi|35214611|dbj|BAC91978.1| LuxR family transcriptional regulatory protein [Gloeobacter
           violaceus PCC 7421]
          Length = 90

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 43/57 (75%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE++ L  +++G T+++IA +L IS+ TV+N++++I++KT TK R   + +A++
Sbjct: 11  LSDREMQILELVAQGHTNEDIAEVLEISKRTVDNHVSNILQKTKTKNRVELVRWALQ 67


>gi|310686584|gb|ADP02958.1| LuxR [Cloning vector pLR3]
 gi|310686589|gb|ADP02962.1| LuxR [Cloning vector pLR4]
          Length = 269

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +LT RE ECL W  EGK+S +I+ ILG S+ TV  ++ +   K  T  R  +I+ A+
Sbjct: 201 DLTKREKECLAWACEGKSSWDISKILGCSKRTVTFHLTNAQMKLNTTNRCQSISKAI 257


>gi|226860311|gb|ACO88865.1| transcriptional regulatory protein [Microbacterium sp. MA1]
          Length = 228

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 37/62 (59%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE + L  I+ G+T+ EIA  LGIS  TV +++  I  K   + R+ AI YA  + 
Sbjct: 162 ELTDRESDVLRLIARGQTNTEIASTLGISSVTVKSHVNHIFTKLDLRDRAAAIVYAFDHG 221

Query: 245 IV 246
           +V
Sbjct: 222 LV 223


>gi|218532854|ref|YP_002423670.1| LuxR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218525157|gb|ACK85742.1| transcriptional regulator, LuxR family [Methylobacterium
           chloromethanicum CM4]
          Length = 243

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W++EGKT  EI  ++GISR+ V+ ++ S   K    +R+ A+A   R  +
Sbjct: 182 LTPRERESLQWVAEGKTDWEIGELMGISRHGVDFHLRSARVKLGCVSRTQAVAEGFRRGL 241

Query: 246 V 246
           +
Sbjct: 242 I 242


>gi|12620905|gb|AAG61132.1|AF330021_1 AHL receptor [Burkholderia stabilis]
          Length = 239

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTAREREVLCWTAEGKTACEIGQILSISGRTVNFHVNNILEKLGATNKVQAVVKAISAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|156741561|ref|YP_001431690.1| two component LuxR family transcriptional regulator [Roseiflexus
           castenholzii DSM 13941]
 gi|156232889|gb|ABU57672.1| two component transcriptional regulator, LuxR family [Roseiflexus
           castenholzii DSM 13941]
          Length = 242

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           LT RE+E L  I+ G ++ EIA  L IS  TV N+I SI+ K     R+ A+ YA++  
Sbjct: 164 LTSREIEILDCIARGLSNKEIATQLSISGQTVKNHITSILSKLQVNDRTMAVIYAIQRG 222


>gi|190892823|ref|YP_001979365.1| transcriptional regulator protein, LuxR family [Rhizobium etli CIAT
           652]
 gi|190698102|gb|ACE92187.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CIAT 652]
 gi|327189482|gb|EGE56638.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli CNPAF512]
          Length = 241

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+E + W ++GKTS EI  IL +S +TVN Y+ + ++K     R+  +A A+R  +
Sbjct: 180 LSARELEVVRWTAQGKTSIEIGQILTLSDHTVNAYMTNAIKKLDCVNRTQLVAKAIRLKL 239

Query: 246 V 246
           +
Sbjct: 240 I 240


>gi|91778395|ref|YP_553603.1| two component LuxR family transcriptional regulator [Burkholderia
           xenovorans LB400]
 gi|91691055|gb|ABE34253.1| two component transcriptional regulator, LuxR family [Burkholderia
           xenovorans LB400]
          Length = 361

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           F LT RE E L W+S GKT+ +I  ILG++  TVN ++  +  K   +TR
Sbjct: 298 FGLTAREAEVLLWLSRGKTNRDIGDILGMAPRTVNKHLEHVFGKLHVETR 347


>gi|308050904|ref|YP_003914470.1| LuxR family transcriptional regulator [Ferrimonas balearica DSM
           9799]
 gi|307633094|gb|ADN77396.1| transcriptional regulator, LuxR family [Ferrimonas balearica DSM
           9799]
          Length = 225

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 61/113 (53%), Gaps = 10/113 (8%)

Query: 130 YCSLTFDVARIRIGLMLLFPKG-RIILRDRLW--------EIGLLAAYQANMFKSYDVHW 180
           + +L F    +R   + + P+  R +L D+LW         +  L     +   S +V  
Sbjct: 92  FIALGFSGLIVRDYTLEMLPRAIRALLADQLWFSREAMSSSLKQLVNVGGHCGHSVNV-L 150

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           G  ++L+ +E +   ++ +GK++ EIA+ + IS +TV N++++I++KT  ++R
Sbjct: 151 GAQYQLSAKEQQVFHYLLQGKSNKEIALGMNISLSTVKNHVSNILQKTHKQSR 203


>gi|229552512|ref|ZP_04441237.1| LuxR family response regulator [Lactobacillus rhamnosus LMS2-1]
 gi|229314064|gb|EEN80037.1| LuxR family response regulator [Lactobacillus rhamnosus LMS2-1]
          Length = 233

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 40/62 (64%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I++GK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA+++ 
Sbjct: 158 ELTNREREVLQLIAQGKSNQEIATELFITLKTVKTHVSNILAKLDVEDRTQAAIYALKHG 217

Query: 245 IV 246
           +V
Sbjct: 218 LV 219


>gi|299534498|ref|ZP_07047831.1| two-component response regulator [Lysinibacillus fusiformis ZC1]
 gi|298730126|gb|EFI70668.1| two-component response regulator [Lysinibacillus fusiformis ZC1]
          Length = 203

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           LT RE + LT ++EGKT+ EIA  L +S  TV NYI++I+ K     R  AIA
Sbjct: 142 LTERESQVLTLVAEGKTTKEIAAELFLSAGTVRNYISTILEKLNVGNRIEAIA 194


>gi|240170339|ref|ZP_04748998.1| transcriptional regulator, LuxR family protein [Mycobacterium
           kansasii ATCC 12478]
          Length = 528

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 33/61 (54%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REVE L  ++ G ++ EIA  L IS  T  N++     K     R GA  YA+RN +
Sbjct: 465 LTPREVEVLCLVARGASNKEIAAALVISEKTARNHVERTYAKIGVTNRIGASMYALRNGL 524

Query: 246 V 246
           V
Sbjct: 525 V 525


>gi|291300839|ref|YP_003512117.1| LuxR family two component transcriptional regulator [Stackebrandtia
           nassauensis DSM 44728]
 gi|290570059|gb|ADD43024.1| two component transcriptional regulator, LuxR family
           [Stackebrandtia nassauensis DSM 44728]
          Length = 219

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 42/82 (51%), Gaps = 2/82 (2%)

Query: 164 LLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           L+  Y A +  + D     D  LT RE+E L  I+ G ++ EIA  L IS  TV  Y++ 
Sbjct: 138 LVGRYAARIRPAEDTP--DDTALTPRELEVLRHIANGLSNSEIAATLVISHETVKTYVSR 195

Query: 224 IMRKTATKTRSGAIAYAVRNNI 245
           I+ K   + R  A+ YA R  +
Sbjct: 196 ILTKLGLRDRVQAVVYAYRRGL 217


>gi|117928597|ref|YP_873148.1| two component LuxR family transcriptional regulator [Acidothermus
           cellulolyticus 11B]
 gi|117649060|gb|ABK53162.1| two component transcriptional regulator, LuxR family [Acidothermus
           cellulolyticus 11B]
          Length = 225

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +L+ RE+E L  +++G+++ EI   LG+S  TV +++A I RK  T  R+  +A A+R  
Sbjct: 163 DLSSREIEVLRLVADGRSNKEIGDQLGLSALTVKSHLARIARKLGTGDRAEMVALAMRAG 222

Query: 245 IV 246
           I+
Sbjct: 223 II 224


>gi|83747411|ref|ZP_00944450.1| SolR [Ralstonia solanacearum UW551]
 gi|207744773|ref|YP_002261165.1| transcriptional activator protein solr [Ralstonia solanacearum
           IPO1609]
 gi|83725868|gb|EAP73007.1| SolR [Ralstonia solanacearum UW551]
 gi|206596183|emb|CAQ63110.1| transcriptional activator protein solr [Ralstonia solanacearum
           IPO1609]
          Length = 236

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W  EGKT+ EI  IL IS  TVN ++ +++ K A   +  A+  A+   +
Sbjct: 176 LTAREREVLCWTGEGKTAYEIGQILHISERTVNFHVNNVLLKLAATNKVQAVVKAIATGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|269965326|ref|ZP_06179446.1| putative transcriptional regulator, LuxR family [Vibrio
           alginolyticus 40B]
 gi|269829972|gb|EEZ84201.1| putative transcriptional regulator, LuxR family [Vibrio
           alginolyticus 40B]
          Length = 218

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 39/61 (63%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + ELT REV+ L  + EG ++ EIA  L IS +T+ +++ +I RK   K R+ A ++A R
Sbjct: 157 EVELTRREVQVLKMLKEGGSNMEIADSLFISEHTIKSHLYNIFRKLEVKNRTQATSWAKR 216

Query: 243 N 243
           N
Sbjct: 217 N 217


>gi|264679733|ref|YP_003279642.1| LuxR family transcriptional regulator [Comamonas testosteroni
           CNB-2]
 gi|262210248|gb|ACY34346.1| two component transcriptional regulator, LuxR family [Comamonas
           testosteroni CNB-2]
          Length = 274

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (58%), Gaps = 2/80 (2%)

Query: 168 YQANMFKSYDVHWGKDFE-LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMR 226
           ++AN F    +   K FE LT REVE L  I++GK+S E+A  L IS  TV+ +I +I  
Sbjct: 196 FKAN-FHEESIFKHKSFESLTEREVEILKLIAQGKSSLEVASYLQISPLTVSTHIKNIYG 254

Query: 227 KTATKTRSGAIAYAVRNNIV 246
           K   +TR+ A+  A+   I+
Sbjct: 255 KMQVRTRAQAVRCAILIGII 274


>gi|169825786|ref|YP_001695944.1| two-component response regulator [Lysinibacillus sphaericus C3-41]
 gi|168990274|gb|ACA37814.1| two-component response regulator [Lysinibacillus sphaericus C3-41]
          Length = 199

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           LT RE + LT ++EGKT+ EIA  L +S  TV NYI++I+ K     R  AIA
Sbjct: 138 LTERESQVLTLVAEGKTTKEIAAELFLSAGTVRNYISTILEKLNVGNRIEAIA 190


>gi|75910055|ref|YP_324351.1| two component LuxR family transcriptional regulator [Anabaena
           variabilis ATCC 29413]
 gi|75703780|gb|ABA23456.1| two component transcriptional regulator, LuxR family [Anabaena
           variabilis ATCC 29413]
          Length = 227

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 39/64 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  LTGRE+E L+ +++GKT+ EIA  L I+  TV  ++ +I+ K     R  A+  A++
Sbjct: 157 DHPLTGRELEILSLLAKGKTNQEIATALYITPGTVRVHVHAILHKLEVSDRHQAVVVALQ 216

Query: 243 NNIV 246
             ++
Sbjct: 217 KRLI 220


>gi|307141914|gb|ADN34749.1| transcriptional activator CmrR [Pseudomonas sp. CMR12a]
          Length = 235

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           + +LT RE E L W   GKTS EI+ +L IS NTVN +I + + K +   ++ A+  A
Sbjct: 171 EVKLTSREKEVLKWTGSGKTSFEISCLLAISENTVNFHIKNSILKLSAANKTAAVIQA 228


>gi|329940013|ref|ZP_08289295.1| two-component response regulator [Streptomyces griseoaurantiacus
           M045]
 gi|329300839|gb|EGG44735.1| two-component response regulator [Streptomyces griseoaurantiacus
           M045]
          Length = 225

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REVE L  I+EG ++ EIA  L +S  TV  +I ++  KT  K R+ A+ YA R  +
Sbjct: 161 LTVREVEVLVLIAEGLSNQEIARRLHVSTATVKTHINNMFAKTGLKDRAQAVRYAFRKGL 220

Query: 246 V 246
           V
Sbjct: 221 V 221


>gi|302867524|ref|YP_003836161.1| response regulator receiver [Micromonospora aurantiaca ATCC 27029]
 gi|302570383|gb|ADL46585.1| response regulator receiver [Micromonospora aurantiaca ATCC 27029]
          Length = 219

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 37/64 (57%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  LT RE+E L  I++G  + EIA  L IS+ TV  Y++ I+ K   + R  A+ YA R
Sbjct: 155 DVGLTPRELEVLRLIADGLANSEIAARLVISQETVKTYVSRILTKLDLRDRVQAVVYAYR 214

Query: 243 NNIV 246
             +V
Sbjct: 215 TGLV 218


>gi|254563872|ref|YP_003070967.1| N-acylhomoserine lactone LuxR family transcriptional regulator
           [Methylobacterium extorquens DM4]
 gi|254271150|emb|CAX27157.1| N-acylhomoserine lactone transcriptional regulator, LuxR family
           [Methylobacterium extorquens DM4]
          Length = 165

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W++EGKT  EI  ++GISR+ V+ ++ S   K    +R+ A+A   R  +
Sbjct: 104 LTPRERESLQWVAEGKTDWEIGELMGISRHGVDFHLRSARVKLGCVSRTQAVAEGFRRGL 163

Query: 246 V 246
           +
Sbjct: 164 I 164


>gi|167584589|ref|ZP_02376977.1| LuxR family transcriptional regulatory protein [Burkholderia
           ubonensis Bu]
          Length = 222

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E LT ++EG  + EIA  L IS NTV  +++SI  K    +R+ A+   +R+ +
Sbjct: 160 LTPREIEVLTMLAEGLGNKEIARQLDISDNTVKFHLSSIFGKLGASSRTEAVMQGMRHGL 219

Query: 246 V 246
           V
Sbjct: 220 V 220


>gi|114328502|ref|YP_745659.1| LuxR family transcriptional regulator [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316676|gb|ABI62736.1| transcriptional regulator, LuxR family [Granulibacter bethesdensis
           CGDNIH1]
          Length = 306

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 33/59 (55%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
             +T RE E L WI  GK + +IA ILG+S  TVN ++  I  K   + R+ A A  ++
Sbjct: 243 LPVTAREAEVLLWIGRGKQNRDIADILGLSPRTVNKHLEQIYTKIGVENRAAAAAVVMK 301


>gi|88854587|ref|ZP_01129254.1| putative two-component system response regulator [marine
           actinobacterium PHSC20C1]
 gi|88816395|gb|EAR26250.1| putative two-component system response regulator [marine
           actinobacterium PHSC20C1]
          Length = 538

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 44/64 (68%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + +L+ RE+E L  +S+G ++ EIA  L +S +TV+ ++A+I+ K    +R+GA +YA++
Sbjct: 475 EGQLSARELEVLRLVSQGLSNPEIAASLVLSEHTVHRHVANILTKLDQTSRTGAASYAIQ 534

Query: 243 NNIV 246
             ++
Sbjct: 535 AGLL 538


>gi|307295298|ref|ZP_07575137.1| transcriptional regulator, LuxR family [Sphingobium
           chlorophenolicum L-1]
 gi|306878801|gb|EFN10020.1| transcriptional regulator, LuxR family [Sphingobium
           chlorophenolicum L-1]
          Length = 222

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           LT  EV CL WI  GKT DE+A I+G +R T+  ++ +  +K     R+ A+  A +
Sbjct: 144 LTPLEVSCLRWIGRGKTDDEVAAIMGRARPTIRFHLQNAAKKLGAVNRTQAVFLAAQ 200


>gi|294340032|emb|CAZ88396.1| autoinducer-binding transcriptional regulator LuxR family
           [Thiomonas sp. 3As]
          Length = 237

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           LT RE+E L W ++GKT+ EIA IL IS  T N +IA+ + K     ++ A+  A
Sbjct: 176 LTDREIEVLRWTADGKTASEIADILNISERTANFHIANAIAKLHAPNKTAAVIRA 230


>gi|229588916|ref|YP_002871035.1| putative LuxR family regulatory protein [Pseudomonas fluorescens
           SBW25]
 gi|229360782|emb|CAY47640.1| putative LuxR-family regulatory protein [Pseudomonas fluorescens
           SBW25]
          Length = 235

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W   GKT+ E++ ILG S  T+N +IA+  RK  + +R  A+  A+   +
Sbjct: 173 LTLRESEVLKWTGVGKTTWEMSCILGCSERTINFHIANASRKLGSFSRRQAVGVALAQGL 232

Query: 246 V 246
           +
Sbjct: 233 I 233


>gi|260466633|ref|ZP_05812821.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|259029639|gb|EEW30927.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
          Length = 256

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 59/119 (49%), Gaps = 7/119 (5%)

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGL----LAAYQANMFKSYDVHWGKDFELT 187
           +L     R + GL++       + +D L+EI      L A  A +  S     G+   ++
Sbjct: 140 ALPVHADRGQCGLVVFLGSEIALPQDTLYEIHARCFSLFAAVARILPS---DAGRTRAIS 196

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE+ECL   + G TS+EIA +L +S +T N Y+    +K     R+ A+A A+R  ++
Sbjct: 197 KRELECLKLTANGNTSEEIARLLKLSVHTANQYLTQSTQKLNAVNRNQAVAKALRLGLI 255


>gi|218441961|ref|YP_002380290.1| LuxR family transcriptional regulator [Cyanothece sp. PCC 7424]
 gi|218174689|gb|ACK73422.1| two component transcriptional regulator, LuxR family [Cyanothece
           sp. PCC 7424]
          Length = 210

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+E L  I EGK+++EIA  L +S NT+  ++  IM K A   R  A   A+R+ I
Sbjct: 150 LSERELEVLKLIVEGKSNNEIAEELYLSTNTIKTHVRGIMNKLAVDDRVQAAVVALRSGI 209

Query: 246 V 246
           V
Sbjct: 210 V 210


>gi|111220761|ref|YP_711555.1| putative protein-glutamate methylesterase [Frankia alni ACN14a]
 gi|111148293|emb|CAJ59965.1| putative Protein-glutamate methylesterase [Frankia alni ACN14a]
          Length = 237

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  +++G  + +IA  L IS NTV N+I +I+ K    +R  A+ YAVR  +
Sbjct: 174 LTDREMEVLRLVAKGMNNRDIAKQLYISENTVKNHIRNILEKLQLHSRMEAVVYAVREKL 233

Query: 246 V 246
           +
Sbjct: 234 L 234


>gi|240141366|ref|YP_002965846.1| N-acylhomoserine lactone transcriptional regulator, LuxR family
           [Methylobacterium extorquens AM1]
 gi|240011343|gb|ACS42569.1| N-acylhomoserine lactone transcriptional regulator, LuxR family
           [Methylobacterium extorquens AM1]
          Length = 165

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W++EGKT  EI  ++GISR+ V+ ++ S   K    +R+ A+A   R  +
Sbjct: 104 LTPRERESLQWVAEGKTDWEIGELMGISRHGVDFHLRSARVKLGCVSRTQAVAEGFRRGL 163

Query: 246 V 246
           +
Sbjct: 164 I 164


>gi|58533128|gb|AAW78919.1| ExpR [Erwinia amylovora]
          Length = 240

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 38/63 (60%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
            + + RE+E L W +EGKTS EI++IL IS+NTVN +   + ++     ++   +YA   
Sbjct: 178 LDFSERELEILKWTAEGKTSAEISLILSISQNTVNFHQKKMQKRFNAPNKTQIASYAAAV 237

Query: 244 NIV 246
            ++
Sbjct: 238 GLI 240


>gi|150376321|ref|YP_001312917.1| response regulator receiver protein [Sinorhizobium medicae WSM419]
 gi|150030868|gb|ABR62984.1| response regulator receiver protein [Sinorhizobium medicae WSM419]
          Length = 309

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 45/91 (49%), Gaps = 9/91 (9%)

Query: 161 EIGLLAAYQANMF---------KSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILG 211
           +I  L A  AN F          S D    + F+LT RE E L WI++GK++ +I  ILG
Sbjct: 214 QISYLGAIGANEFLFRLTTENGMSDDETLRQHFQLTPRESEVLLWIAKGKSNRDIGEILG 273

Query: 212 ISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +S  TV  ++  I  K   + R+ A   A +
Sbjct: 274 LSSRTVTKHLEQIYVKLGVENRASAAVKATQ 304


>gi|300702552|ref|YP_003744152.1| transcriptional activator protein solr [Ralstonia solanacearum
           CFBP2957]
 gi|299070213|emb|CBJ41504.1| Transcriptional activator protein solR [Ralstonia solanacearum
           CFBP2957]
          Length = 236

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W  EGKT+ EI  IL IS  TVN ++ +++ K A   +  A+  A+   +
Sbjct: 176 LTAREREVLCWTGEGKTAYEIGQILRISERTVNFHVNNVLLKLAATNKVQAVVKAIATGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|170739988|ref|YP_001768643.1| LuxR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168194262|gb|ACA16209.1| transcriptional regulator, LuxR family [Methylobacterium sp. 4-46]
          Length = 118

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 38/64 (59%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  LT RE+E L  ++EG ++  IA  LGIS +T   ++ S++ K     R+ A+A+A R
Sbjct: 53  DPGLTPREIEVLGLLAEGASNKAIARRLGISVHTAKFHVGSLLDKLDATGRTDAVAHAAR 112

Query: 243 NNIV 246
             ++
Sbjct: 113 RGVI 116


>gi|311031073|ref|ZP_07709163.1| two-component response regulator [Bacillus sp. m3-13]
          Length = 213

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 36/63 (57%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
            ELT RE   L  + EGK + EIA  L +S  TV N++  I++K   + R+    +A+RN
Sbjct: 151 VELTSRERSILQLVGEGKNNQEIAEALYLSIGTVKNHVTVILQKLGLRDRTQLAIFAIRN 210

Query: 244 NIV 246
            +V
Sbjct: 211 GVV 213


>gi|256396690|ref|YP_003118254.1| LuxR family transcriptional regulator [Catenulispora acidiphila DSM
           44928]
 gi|256362916|gb|ACU76413.1| two component transcriptional regulator, LuxR family [Catenulispora
           acidiphila DSM 44928]
          Length = 225

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE+E L  ++ G+ + EIA  L I+ NTV N++ +I+ K    +R  A+ YAVR  
Sbjct: 161 KLTDREMEVLKLVATGRNNREIAKELFITENTVKNHVRNILEKLNLHSRMEAVVYAVREK 220

Query: 245 IV 246
           ++
Sbjct: 221 LL 222


>gi|229014521|ref|ZP_04171639.1| Two-component response regulator [Bacillus mycoides DSM 2048]
 gi|229136171|ref|ZP_04264924.1| Two-component response regulator [Bacillus cereus BDRD-ST196]
 gi|229170061|ref|ZP_04297752.1| Two-component response regulator [Bacillus cereus AH621]
 gi|228613408|gb|EEK70542.1| Two-component response regulator [Bacillus cereus AH621]
 gi|228647330|gb|EEL03412.1| Two-component response regulator [Bacillus cereus BDRD-ST196]
 gi|228746871|gb|EEL96756.1| Two-component response regulator [Bacillus mycoides DSM 2048]
          Length = 189

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 35/61 (57%)

Query: 180 WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           W +   L+ RE E L    EGKT++EIA +L +S  TV NYI+ ++ K   K R  AI  
Sbjct: 123 WQEQNPLSDREKEVLVLAKEGKTTNEIAKMLYLSPGTVRNYISEVLAKLEAKNRIEAITI 182

Query: 240 A 240
           A
Sbjct: 183 A 183


>gi|222150233|ref|YP_002551190.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
 gi|221737215|gb|ACM38178.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
          Length = 246

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 38/64 (59%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  LT RE+E L ++ EG TS+E++ +L IS +TV+ Y+  +  K   K R   +A A R
Sbjct: 182 DVRLTRRELEILNYLGEGMTSNEMSKLLEISNHTVDWYVNELQDKLNAKNRQHMVAIAYR 241

Query: 243 NNIV 246
             ++
Sbjct: 242 LGLI 245


>gi|9297072|sp|P74946|VANR_VIBAN RecName: Full=Transcriptional activator protein vanR
 gi|1568660|gb|AAC45213.1| VanR [Listonella anguillarum]
          Length = 240

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT REV+CL W +EGK++ EIA I+  S  TV  + ++  +K     R  AI  A+
Sbjct: 176 LTAREVQCLAWAAEGKSAWEIATIINTSERTVKFHFSNACKKLGATNRYQAITKAI 231


>gi|258652644|ref|YP_003201800.1| LuxR family two component transcriptional regulator [Nakamurella
           multipartita DSM 44233]
 gi|258555869|gb|ACV78811.1| two component transcriptional regulator, LuxR family [Nakamurella
           multipartita DSM 44233]
          Length = 220

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 38/64 (59%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G+   LT RE E L  I++G+ + EIA +  +S NT+ +YI S+ RK    +R+ A+ + 
Sbjct: 143 GRAEGLTDREAEILALITQGRGNAEIASMTYLSPNTIKSYIRSVYRKIGVSSRTQAVLWG 202

Query: 241 VRNN 244
           V + 
Sbjct: 203 VHHG 206


>gi|171060622|ref|YP_001792971.1| two component LuxR family transcriptional regulator [Leptothrix
           cholodnii SP-6]
 gi|170778067|gb|ACB36206.1| two component transcriptional regulator, LuxR family [Leptothrix
           cholodnii SP-6]
          Length = 222

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 169 QANMFKSYDVHWGK---DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIM 225
           QAN  ++Y     +   + +LT RE E L  +++G T  EI V LG+SR+T+ +Y+  I 
Sbjct: 140 QANRPQAYQPTTDQLMPNVQLTEREREVLLRVAKGFTLPEIGVQLGLSRHTIADYVKQIY 199

Query: 226 RKTATKTRSGAIAYAVR 242
           RK    +R+ A   A R
Sbjct: 200 RKLNVSSRAEAALEAQR 216


>gi|123967708|ref|YP_001008566.1| LuxR family regulatory protein [Prochlorococcus marinus str.
           AS9601]
 gi|126695511|ref|YP_001090397.1| LuxR family regulatory protein [Prochlorococcus marinus str. MIT
           9301]
 gi|123197818|gb|ABM69459.1| Bacterial regulatory protein, LuxR family [Prochlorococcus marinus
           str. AS9601]
 gi|126542554|gb|ABO16796.1| Bacterial regulatory protein, LuxR family [Prochlorococcus marinus
           str. MIT 9301]
          Length = 92

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 40/58 (68%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           L+ RE+E +  +++G T+ EIAV L IS+ TV+N+++++  KT +K R   + +A+ N
Sbjct: 16  LSAREMEIIDLVADGLTNQEIAVKLTISKRTVDNHVSNMFTKTGSKNRVALLNWAMDN 73


>gi|13472562|ref|NP_104129.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
 gi|14023308|dbj|BAB49915.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
          Length = 256

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 57/113 (50%), Gaps = 9/113 (7%)

Query: 139 RIRIGLMLLFPKGRIILRDRLWEI-----GLLAAYQANMFKSYDVHWGKDFELTGREVEC 193
           R + GL++       + +D L+EI      L AA      +  D   G+   ++ RE+EC
Sbjct: 147 RGQCGLVVFLGSKMALPQDALYEIHARCFSLFAAVA--RIRPSDA--GRMRAISKRELEC 202

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L   + G TS+EIA +L +S +T N Y+    +K     R+ A+A A+R  ++
Sbjct: 203 LKLTANGNTSEEIARLLKLSVHTANQYLTQSTQKLNAVNRNQAVAKALRLGLI 255


>gi|163847477|ref|YP_001635521.1| regulatory protein LuxR [Chloroflexus aurantiacus J-10-fl]
 gi|222525329|ref|YP_002569800.1| LuxR family transcriptional regulator [Chloroflexus sp. Y-400-fl]
 gi|163668766|gb|ABY35132.1| regulatory protein LuxR [Chloroflexus aurantiacus J-10-fl]
 gi|222449208|gb|ACM53474.1| transcriptional regulator, LuxR family [Chloroflexus sp. Y-400-fl]
          Length = 487

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 40/65 (61%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
            + +++ RE E L  ++ G T+ +IA+ L IS NTV  ++ +I  K   ++R+ A  YA+
Sbjct: 3   NESQISEREREILRLVATGATNQQIAIALNISVNTVKVHLRNIFAKIGVESRTEATVYAI 62

Query: 242 RNNIV 246
           RN IV
Sbjct: 63  RNGIV 67


>gi|171058058|ref|YP_001790407.1| LuxR family transcriptional regulator [Leptothrix cholodnii SP-6]
 gi|170775503|gb|ACB33642.1| transcriptional regulator, LuxR family [Leptothrix cholodnii SP-6]
          Length = 267

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           +T RE E L WI  GK++ EI  ILGIS  TV N++  ++ K     R+ A+  A+  ++
Sbjct: 205 ITVREQEILKWIYLGKSNSEIGQILGISALTVKNHVQKMLHKLNVVNRAQAVGRAIEAHL 264

Query: 246 V 246
           +
Sbjct: 265 I 265


>gi|229020573|ref|ZP_04177315.1| Two-component response regulator [Bacillus cereus AH1273]
 gi|229026791|ref|ZP_04183123.1| Two-component response regulator [Bacillus cereus AH1272]
 gi|228734514|gb|EEL85176.1| Two-component response regulator [Bacillus cereus AH1272]
 gi|228740737|gb|EEL90993.1| Two-component response regulator [Bacillus cereus AH1273]
          Length = 189

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 35/61 (57%)

Query: 180 WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           W +   L+ RE E L    EGKT++EIA +L +S  TV NYI+ ++ K   K R  AI  
Sbjct: 123 WQEQNPLSDREKEVLVLAKEGKTTNEIAKMLYLSPGTVRNYISEVLAKLEAKNRIEAITI 182

Query: 240 A 240
           A
Sbjct: 183 A 183


>gi|301305257|ref|ZP_07211354.1| autoinducer binding domain protein [Escherichia coli MS 124-1]
 gi|300839463|gb|EFK67223.1| autoinducer binding domain protein [Escherichia coli MS 124-1]
          Length = 226

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 30/45 (66%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRK 227
           +   + RE E L W +EGKTS EIA+IL IS NTVN +  ++ +K
Sbjct: 177 EMNFSKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKK 221


>gi|69248021|ref|ZP_00604584.1| regulatory protein, LuxR:Response regulator receiver [Enterococcus
           faecium DO]
 gi|227550521|ref|ZP_03980570.1| LuxR family response regulator [Enterococcus faecium TX1330]
 gi|257880197|ref|ZP_05659850.1| regulatory protein [Enterococcus faecium 1,230,933]
 gi|257882998|ref|ZP_05662651.1| regulatory protein [Enterococcus faecium 1,231,502]
 gi|257888548|ref|ZP_05668201.1| regulatory protein [Enterococcus faecium 1,141,733]
 gi|257891419|ref|ZP_05671072.1| regulatory protein [Enterococcus faecium 1,231,410]
 gi|257897077|ref|ZP_05676730.1| regulatory protein [Enterococcus faecium Com12]
 gi|258614385|ref|ZP_05712155.1| LuxR family DNA-binding response regulator [Enterococcus faecium
           DO]
 gi|293377300|ref|ZP_06623504.1| response regulator receiver domain protein [Enterococcus faecium
           PC4.1]
 gi|293572485|ref|ZP_06683464.1| transcriptional regulatory protein DegU [Enterococcus faecium E980]
 gi|294622136|ref|ZP_06701212.1| transcriptional regulatory protein DegU [Enterococcus faecium
           U0317]
 gi|68194589|gb|EAN09079.1| regulatory protein, LuxR:Response regulator receiver [Enterococcus
           faecium DO]
 gi|227180422|gb|EEI61394.1| LuxR family response regulator [Enterococcus faecium TX1330]
 gi|257814425|gb|EEV43183.1| regulatory protein [Enterococcus faecium 1,230,933]
 gi|257818656|gb|EEV45984.1| regulatory protein [Enterococcus faecium 1,231,502]
 gi|257824602|gb|EEV51534.1| regulatory protein [Enterococcus faecium 1,141,733]
 gi|257827779|gb|EEV54405.1| regulatory protein [Enterococcus faecium 1,231,410]
 gi|257833642|gb|EEV60063.1| regulatory protein [Enterococcus faecium Com12]
 gi|291598337|gb|EFF29424.1| transcriptional regulatory protein DegU [Enterococcus faecium
           U0317]
 gi|291607402|gb|EFF36745.1| transcriptional regulatory protein DegU [Enterococcus faecium E980]
 gi|292643992|gb|EFF62098.1| response regulator receiver domain protein [Enterococcus faecium
           PC4.1]
          Length = 210

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  ISEGK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA ++ 
Sbjct: 148 ELTNRENEILMLISEGKSNQEIADELFITLKTVKTHVSNILAKLEVEDRTQAAIYAFKHG 207

Query: 245 IV 246
           +V
Sbjct: 208 LV 209


>gi|330836949|ref|YP_004411590.1| transcriptional regulator, LuxR family [Spirochaeta coccoides DSM
           17374]
 gi|329748852|gb|AEC02208.1| transcriptional regulator, LuxR family [Spirochaeta coccoides DSM
           17374]
          Length = 299

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           + +T RE   +  I+ G+T+ EIA+ L IS NTVNN++A+I  KT  ++R
Sbjct: 237 YHITEREFSVIKLIANGRTNKEIAMELNISTNTVNNHVANIFSKTEVRSR 286


>gi|308172920|ref|YP_003919625.1| two-component response regulator [Bacillus amyloliquefaciens DSM 7]
 gi|307605784|emb|CBI42155.1| two-component response regulator [YhcY] [Bacillus amyloliquefaciens
           DSM 7]
          Length = 214

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 42/69 (60%)

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           D +  K ++LT RE + L  I++GK++ EIA  L IS  TV  ++++++ K     R+ A
Sbjct: 140 DQNKEKYYQLTPREKDVLQEIAKGKSNKEIAASLFISEKTVKTHVSNLLSKLNLSDRTQA 199

Query: 237 IAYAVRNNI 245
             YAV+ N+
Sbjct: 200 ALYAVKYNV 208


>gi|325520628|gb|EGC99691.1| LuxR family transcriptional regulator [Burkholderia sp. TJI49]
          Length = 109

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 46  LTAREREVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGL 105

Query: 246 V 246
           +
Sbjct: 106 I 106


>gi|293553248|ref|ZP_06673885.1| DNA-binding response regulator, LuxR family [Enterococcus faecium
           E1039]
 gi|291602658|gb|EFF32873.1| DNA-binding response regulator, LuxR family [Enterococcus faecium
           E1039]
          Length = 210

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  ISEGK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA ++ 
Sbjct: 148 ELTNRENEILMLISEGKSNQEIADELFITLKTVKTHVSNILAKLEVEDRTQAAIYAFKHG 207

Query: 245 IV 246
           +V
Sbjct: 208 LV 209


>gi|257899016|ref|ZP_05678669.1| regulatory protein [Enterococcus faecium Com15]
 gi|257836928|gb|EEV62002.1| regulatory protein [Enterococcus faecium Com15]
          Length = 210

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  ISEGK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA ++ 
Sbjct: 148 ELTNRENEILMLISEGKSNQEIADELFITLKTVKTHVSNILAKLEVEDRTQAAIYAFKHG 207

Query: 245 IV 246
           +V
Sbjct: 208 LV 209


>gi|257893584|ref|ZP_05673237.1| regulatory protein [Enterococcus faecium 1,231,408]
 gi|260560505|ref|ZP_05832679.1| regulatory protein [Enterococcus faecium C68]
 gi|261209022|ref|ZP_05923427.1| regulatory protein [Enterococcus faecium TC 6]
 gi|289565166|ref|ZP_06445618.1| response regulator LiaR [Enterococcus faecium D344SRF]
 gi|293563601|ref|ZP_06678047.1| DNA-binding response regulator, LuxR family [Enterococcus faecium
           E1162]
 gi|293569319|ref|ZP_06680617.1| DNA-binding response regulator, LuxR family [Enterococcus faecium
           E1071]
 gi|294615290|ref|ZP_06695166.1| DNA-binding response regulator, LuxR family [Enterococcus faecium
           E1636]
 gi|294619055|ref|ZP_06698550.1| DNA-binding response regulator, LuxR family [Enterococcus faecium
           E1679]
 gi|314939788|ref|ZP_07847008.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133a04]
 gi|314942017|ref|ZP_07848877.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133C]
 gi|314950011|ref|ZP_07853304.1| response regulator receiver domain protein [Enterococcus faecium
           TX0082]
 gi|314953533|ref|ZP_07856445.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133A]
 gi|314992148|ref|ZP_07857595.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133B]
 gi|314995132|ref|ZP_07860248.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133a01]
 gi|257829963|gb|EEV56570.1| regulatory protein [Enterococcus faecium 1,231,408]
 gi|260073507|gb|EEW61835.1| regulatory protein [Enterococcus faecium C68]
 gi|260077061|gb|EEW64783.1| regulatory protein [Enterococcus faecium TC 6]
 gi|289162987|gb|EFD10835.1| response regulator LiaR [Enterococcus faecium D344SRF]
 gi|291588025|gb|EFF19875.1| DNA-binding response regulator, LuxR family [Enterococcus faecium
           E1071]
 gi|291591848|gb|EFF23481.1| DNA-binding response regulator, LuxR family [Enterococcus faecium
           E1636]
 gi|291594716|gb|EFF26098.1| DNA-binding response regulator, LuxR family [Enterococcus faecium
           E1679]
 gi|291604451|gb|EFF33939.1| DNA-binding response regulator, LuxR family [Enterococcus faecium
           E1162]
 gi|313590623|gb|EFR69468.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133a01]
 gi|313593289|gb|EFR72134.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133B]
 gi|313594456|gb|EFR73301.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133A]
 gi|313599194|gb|EFR78039.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133C]
 gi|313640928|gb|EFS05508.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133a04]
 gi|313643658|gb|EFS08238.1| response regulator receiver domain protein [Enterococcus faecium
           TX0082]
          Length = 210

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  ISEGK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA ++ 
Sbjct: 148 ELTNRENEILMLISEGKSNQEIADELFITLKTVKTHVSNILAKLEVEDRTQAAIYAFKHG 207

Query: 245 IV 246
           +V
Sbjct: 208 LV 209


>gi|116253270|ref|YP_769108.1| LuxR/GerE family transcriptional regulatory protein [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115257918|emb|CAK09016.1| putative LuxR/GerE family transcriptional regulatory protein
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 238

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+E + W ++GKTS EI  IL +S +TVN Y+ + ++K     R+  +A A+R  +
Sbjct: 177 LSNRELEVVRWTAQGKTSIEIGQILTLSDHTVNAYMTNAIKKLDCVNRTQLVAKAIRLKL 236

Query: 246 V 246
           +
Sbjct: 237 I 237


>gi|91223299|ref|ZP_01258565.1| putative transcriptional regulator, LuxR family protein [Vibrio
           alginolyticus 12G01]
 gi|91192112|gb|EAS78375.1| putative transcriptional regulator, LuxR family protein [Vibrio
           alginolyticus 12G01]
          Length = 210

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 39/61 (63%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + ELT REV+ L  + EG ++ EIA  L IS +T+ +++ +I RK   K R+ A ++A R
Sbjct: 149 EVELTRREVQVLKMLKEGGSNMEIADSLFISEHTIKSHLYNIFRKLEVKNRTQATSWAKR 208

Query: 243 N 243
           N
Sbjct: 209 N 209


>gi|292487894|ref|YP_003530769.1| transcriptional activator protein expR [Erwinia amylovora CFBP1430]
 gi|292899116|ref|YP_003538485.1| LuxR family transcriptional regulator [Erwinia amylovora ATCC
           49946]
 gi|291198964|emb|CBJ46075.1| LuxR-family transcriptional regulator [Erwinia amylovora ATCC
           49946]
 gi|291553316|emb|CBA20361.1| Transcriptional activator protein ExpR [Erwinia amylovora CFBP1430]
          Length = 240

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 36/58 (62%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
            + + RE+E L W +EGKTS EI++IL IS+NTVN +   + ++     ++   +YA 
Sbjct: 178 LDFSERELEILKWTAEGKTSAEISLILSISQNTVNFHQKKMQKRFNAPNKTQIASYAA 235


>gi|182679457|ref|YP_001833603.1| LuxR family transcriptional regulator [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182635340|gb|ACB96114.1| transcriptional regulator, LuxR family [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 239

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +L+ RE E L W + G+   +IA  LG+S  TV N++  I R+ A  T + AI  A+RN 
Sbjct: 176 KLSHREREILAWTAAGRRQADIAATLGLSERTVENHLRRIRRRLAVMTTAQAIRVAIRNG 235


>gi|116696371|ref|YP_841947.1| response regulator [Ralstonia eutropha H16]
 gi|113530870|emb|CAJ97217.1| response regulator, NarL-family [Ralstonia eutropha H16]
          Length = 239

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 40/62 (64%), Gaps = 4/62 (6%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI----AYAV 241
           L+ RE E L +I++G T+ EIA  L +SR T+ +++ +I +K A KTR+ AI    AY V
Sbjct: 178 LSARETEILVFINKGSTNREIADALSLSRLTIESHVKNIYKKLAVKTRTQAIFEARAYGV 237

Query: 242 RN 243
            N
Sbjct: 238 LN 239


>gi|33326387|gb|AAQ08608.1| putative transcription regulator [Agrobacterium vitis]
          Length = 248

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 38/64 (59%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  LT RE+E L ++ EG TS+E++ +L IS +TV+ Y+  +  K   K R   +A A R
Sbjct: 184 DVRLTRRELEILNYLGEGMTSNEMSKLLEISNHTVDWYVNELQDKLNAKNRQHMVAIAYR 243

Query: 243 NNIV 246
             ++
Sbjct: 244 LGLI 247


>gi|260219834|emb|CBA26763.1| hypothetical protein Csp_G38260 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 359

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 34/58 (58%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           F+LT RE E L W+ +GKT+ +I  ILG S  TV  ++  +  K   +TR+ A   A+
Sbjct: 290 FKLTAREAEVLYWVVKGKTNKDIGDILGSSPMTVKKHLERVFVKLGVETRTAAAGMAM 347


>gi|254422985|ref|ZP_05036703.1| response regulator receiver domain protein [Synechococcus sp. PCC
           7335]
 gi|196190474|gb|EDX85438.1| response regulator receiver domain protein [Synechococcus sp. PCC
           7335]
          Length = 233

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 46/89 (51%), Gaps = 2/89 (2%)

Query: 158 RLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTV 217
           ++ EI  L   + +M K  +     DF  T RE + L  ++EG  + EIA  LG +   V
Sbjct: 145 QIEEIKALLTQRGSMIKQNNSGIKIDF--TPREQDVLNLVAEGLMNKEIASRLGTTVRNV 202

Query: 218 NNYIASIMRKTATKTRSGAIAYAVRNNIV 246
             Y++ +  KT T +R+  + YA+ N +V
Sbjct: 203 EKYVSRLFGKTGTNSRTELVRYALENGLV 231


>gi|260773944|ref|ZP_05882859.1| transcriptional activator protein luxR [Vibrio metschnikovii CIP
           69.14]
 gi|260610905|gb|EEX36109.1| transcriptional activator protein luxR [Vibrio metschnikovii CIP
           69.14]
          Length = 240

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           ELT RE +CL+W +EGK++ EIA I+  S  TV  ++++  +K     R  AI  A+
Sbjct: 175 ELTCREGQCLSWAAEGKSAWEIAQIINTSERTVKFHLSNACKKLGATNRYQAITKAI 231


>gi|218662896|ref|ZP_03518826.1| LuxR family transcriptional regulator [Rhizobium etli IE4771]
          Length = 236

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+E + W ++GKTS EI  IL +S +TVN Y+ + ++K     R+  +A A+R  +
Sbjct: 175 LSARELEVVRWTAQGKTSIEIGQILTLSDHTVNAYMTNAIKKLDCVNRTQLVAKAIRLKL 234

Query: 246 V 246
           +
Sbjct: 235 I 235


>gi|229172177|ref|ZP_04299742.1| hypothetical protein bcere0006_12910 [Bacillus cereus MM3]
 gi|228611520|gb|EEK68777.1| hypothetical protein bcere0006_12910 [Bacillus cereus MM3]
          Length = 207

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K     R+ A+ YA R+ 
Sbjct: 145 ELTERESEILLLIAEGKSNQEIADELFIALKTVKTHVSNILNKLNVSDRTQAVIYAFRHQ 204

Query: 245 I 245
           +
Sbjct: 205 L 205


>gi|223935792|ref|ZP_03627707.1| two component transcriptional regulator, LuxR family [bacterium
           Ellin514]
 gi|223895393|gb|EEF61839.1| two component transcriptional regulator, LuxR family [bacterium
           Ellin514]
          Length = 225

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 37/64 (57%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D+ L+ RE + L ++ +G    EIA  +G+S +TVNNY+  I  K    TR GA+A  V 
Sbjct: 156 DYGLSAREKDILQYMVKGLIKKEIAEEMGLSYHTVNNYLRRIYDKLHVHTRGGAVAKTVE 215

Query: 243 NNIV 246
             ++
Sbjct: 216 EKLL 219


>gi|291485797|dbj|BAI86872.1| hypothetical protein BSNT_04924 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 211

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  I+EGKT+ EI   L I+  TV  +I +I+ K     R+ A  YA RN++
Sbjct: 150 LTKRELEILFLIAEGKTNKEIGEELFITIKTVKTHITNILSKLDVSDRTQAAVYAHRNHL 209

Query: 246 V 246
           V
Sbjct: 210 V 210


>gi|312199837|ref|YP_004019898.1| LuxR family transcriptional regulator [Frankia sp. EuI1c]
 gi|311231173|gb|ADP84028.1| two component transcriptional regulator, LuxR family [Frankia sp.
           EuI1c]
          Length = 237

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  +++G  + +IA  L IS NTV N+I +I+ K    +R  A+ YAVR  +
Sbjct: 174 LTDREMEVLRLVAKGLNNRDIAKQLFISENTVKNHIRNILEKLQLHSRMEAVVYAVREKL 233

Query: 246 V 246
           +
Sbjct: 234 L 234


>gi|257885240|ref|ZP_05664893.1| regulatory protein [Enterococcus faecium 1,231,501]
 gi|257821092|gb|EEV48226.1| regulatory protein [Enterococcus faecium 1,231,501]
          Length = 210

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  ISEGK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA ++ 
Sbjct: 148 ELTNRENEILMLISEGKSNQEIADELFITLKTVKTHVSNILAKLEVEDRTQAAIYAFKHG 207

Query: 245 IV 246
           +V
Sbjct: 208 LV 209


>gi|192359370|ref|YP_001983632.1| response regulator [Cellvibrio japonicus Ueda107]
 gi|190685535|gb|ACE83213.1| response regulator [Cellvibrio japonicus Ueda107]
          Length = 225

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I++G T  E+A  LGISR+TV  +I +I RK A   RS A+  A +  
Sbjct: 162 ELTPRETEILRGIAKGFTYTELAEWLGISRHTVPVHIKNIYRKLAANNRSEAVYEASKRG 221

Query: 245 IV 246
           ++
Sbjct: 222 LI 223


>gi|42781357|ref|NP_978604.1| LuxR family DNA-binding response regulator [Bacillus cereus ATCC
           10987]
 gi|42737279|gb|AAS41212.1| DNA-binding response regulator, LuxR family [Bacillus cereus ATCC
           10987]
          Length = 211

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  I++G+++ EIA +L I+  TV  ++++++ K     R+ A  YAV+  +
Sbjct: 151 LTKREQEVLREIAQGRSNKEIAAVLHITEQTVKTHVSNVLAKLEVDDRTQAALYAVKYGV 210

Query: 246 V 246
           +
Sbjct: 211 I 211


>gi|312792317|ref|YP_004025240.1| two component transcriptional regulator, luxr family
           [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312179457|gb|ADQ39627.1| two component transcriptional regulator, LuxR family
           [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 215

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 38/59 (64%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           ELT RE++ +  I++G ++ EIA +L IS  TV NYI+SI++K   + R+    Y  +N
Sbjct: 155 ELTERELDIVKLIAQGYSNKEIANLLFISEGTVRNYISSILQKLQLQNRTQIAIYYYKN 213


>gi|264678731|ref|YP_003278638.1| transcriptional regulator, luxR family [Comamonas testosteroni
           CNB-2]
 gi|262209244|gb|ACY33342.1| transcriptional regulator, luxR family [Comamonas testosteroni
           CNB-2]
          Length = 239

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 33/59 (55%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           L+ RE E L W + G+   EIA  LG+S  TV N++  I ++    T + AI  A+RN 
Sbjct: 177 LSDREREVLAWTAAGRRQTEIAATLGLSERTVENHLRRIRKRLGVATTAQAIRVAIRNG 235


>gi|299529754|ref|ZP_07043189.1| transcriptional regulator, luxR family protein [Comamonas
           testosteroni S44]
 gi|298722272|gb|EFI63194.1| transcriptional regulator, luxR family protein [Comamonas
           testosteroni S44]
          Length = 239

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 33/59 (55%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           L+ RE E L W + G+   EIA  LG+S  TV N++  I ++    T + AI  A+RN 
Sbjct: 177 LSDREREVLAWTAAGRRQTEIAATLGLSERTVENHLRRIRKRLGVATTAQAIRMAIRNG 235


>gi|218896470|ref|YP_002444881.1| DNA-binding response regulator [Bacillus cereus G9842]
 gi|218543325|gb|ACK95719.1| DNA-binding response regulator [Bacillus cereus G9842]
          Length = 210

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K     R+ A+ YA R+ 
Sbjct: 148 ELTERESEILLLIAEGKSNQEIADELFIALKTVKTHVSNILNKLNVSDRTQAVIYAFRHQ 207

Query: 245 I 245
           +
Sbjct: 208 L 208


>gi|159901957|gb|ABX10688.1| two-component system response regulator [uncultured planctomycete
           8FN]
          Length = 210

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +  LT RE E L  ++ GKT+ EIA  L IS  TV  ++ +I+RK     R+ A  +A R
Sbjct: 147 EVPLTAREAEVLKHLTSGKTNKEIANSLTISYETVKEHVQNILRKIGVTDRTQAAVWAFR 206

Query: 243 NNIV 246
             IV
Sbjct: 207 KGIV 210


>gi|153010196|ref|YP_001371410.1| two component LuxR family transcriptional regulator [Ochrobactrum
           anthropi ATCC 49188]
 gi|151562084|gb|ABS15581.1| two component transcriptional regulator, LuxR family [Ochrobactrum
           anthropi ATCC 49188]
          Length = 216

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 40/66 (60%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G+   L+ RE E L  I +G  + EIA  LG+S +TV++Y+ +I +K +  +R+ A   A
Sbjct: 148 GEFIHLSRRETEVLKEIGDGHKNGEIARKLGLSEHTVSDYVKAIYQKLSVSSRAEATREA 207

Query: 241 VRNNIV 246
           +R  +V
Sbjct: 208 IRRGLV 213


>gi|116495146|ref|YP_806880.1| DNA-binding response regulator [Lactobacillus casei ATCC 334]
 gi|191638654|ref|YP_001987820.1| Regulatory protein, LuxR:Response regulator receiver [Lactobacillus
           casei BL23]
 gi|227534839|ref|ZP_03964888.1| LuxR family response regulator [Lactobacillus paracasei subsp.
           paracasei ATCC 25302]
 gi|239632026|ref|ZP_04675057.1| DNA-binding response regulator [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|301066710|ref|YP_003788733.1| CitB family DNA-binding response regulator [Lactobacillus casei
           str. Zhang]
 gi|116105296|gb|ABJ70438.1| DNA-binding response regulator, CitB family (Rec-wHTH domains)
           [Lactobacillus casei ATCC 334]
 gi|190712956|emb|CAQ66962.1| Regulatory protein, LuxR:Response regulator receiver [Lactobacillus
           casei BL23]
 gi|227187595|gb|EEI67662.1| LuxR family response regulator [Lactobacillus paracasei subsp.
           paracasei ATCC 25302]
 gi|239526491|gb|EEQ65492.1| DNA-binding response regulator [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|300439117|gb|ADK18883.1| DNA-binding response regulator, CitB family (Rec-wHTH domains)
           [Lactobacillus casei str. Zhang]
 gi|327382696|gb|AEA54172.1| two component transcriptional regulator, LuxR family [Lactobacillus
           casei LC2W]
 gi|327385883|gb|AEA57357.1| two component transcriptional regulator, LuxR family [Lactobacillus
           casei BD-II]
          Length = 221

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 40/62 (64%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I++GK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA+++ 
Sbjct: 146 ELTNREREVLQLIAQGKSNQEIATELFITLKTVKTHVSNILAKLDVEDRTQAAIYALKHG 205

Query: 245 IV 246
           +V
Sbjct: 206 LV 207


>gi|117928967|ref|YP_873518.1| two component LuxR family transcriptional regulator [Acidothermus
           cellulolyticus 11B]
 gi|117649430|gb|ABK53532.1| two component transcriptional regulator, LuxR family [Acidothermus
           cellulolyticus 11B]
          Length = 303

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 45/78 (57%), Gaps = 1/78 (1%)

Query: 170 ANMFKSYDV-HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKT 228
           A++ K  D  H     +LT RE+E L  +++G  + +IA  L IS NTV N++ +I+ K 
Sbjct: 223 ASLIKRGDARHQVPAPKLTEREMEVLRLVAKGLNNRDIAKQLFISENTVKNHVRNILEKL 282

Query: 229 ATKTRSGAIAYAVRNNIV 246
              +R  A+ YAVR  ++
Sbjct: 283 QLHSRMEAVVYAVREKLL 300


>gi|224552984|gb|ACN54742.1| PagR [Pantoea agglomerans]
          Length = 210

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 156 RDRLWEIGLLAAYQANMFKSYDVHW-GKDFELTGREVECLTWISEGKTSDEIAVILGISR 214
           ++R   +G L          Y  H+  K+  L+ RE + L W+  GKT  E+AVIL I+ 
Sbjct: 117 KNRSEIVGFLVNLHQKTLNLYSQHYQKKNVFLSPRERQILKWVGAGKTYAEVAVILSIAE 176

Query: 215 NTVNNYIASIMRKTATKTRSGAI 237
            TV  ++ ++M+K      + A+
Sbjct: 177 RTVKFHMGNVMKKLGVNNATHAV 199


>gi|222087763|ref|YP_002546300.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
 gi|221725211|gb|ACM28367.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
          Length = 246

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE+E L  ++EG TS +I+  L IS +TV+ Y+ SI  K   + R   +A A RN 
Sbjct: 184 KLTRREIEVLNHLAEGMTSMDISRTLKISNHTVDWYMNSIQDKLNARNRQHIVAIAFRNG 243

Query: 245 IV 246
           +V
Sbjct: 244 LV 245


>gi|78213914|ref|YP_382693.1| LuxR family transcriptional regulator [Synechococcus sp. CC9605]
 gi|78198373|gb|ABB36138.1| transcriptional regulator, LuxR family [Synechococcus sp. CC9605]
          Length = 92

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 40/61 (65%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +  L+ RE+E +  ++EG T+ EIA  L IS+ TV+N+++++  KT +K R   + +A+ 
Sbjct: 11  EISLSAREIEIIELVAEGLTNQEIADRLTISKRTVDNHVSNVFTKTGSKNRVALLNWAMD 70

Query: 243 N 243
           N
Sbjct: 71  N 71


>gi|90422223|ref|YP_530593.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           BisB18]
 gi|90104237|gb|ABD86274.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           BisB18]
          Length = 245

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 37/59 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           L+ RE E + W + GKT+ + A IL IS +TVN ++AS MRK    T++ A+  ++R  
Sbjct: 183 LSPREREVVAWAAVGKTAWDTARILAISTDTVNKHMASAMRKLDACTKTQAVVESIRRG 241


>gi|269963001|ref|ZP_06177338.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269832244|gb|EEZ86366.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 217

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 40/61 (65%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + ELT RE++ LT + +G ++ +IA  L +S +TV +++ SI RK   K R  A+A+A R
Sbjct: 155 EIELTRREMQVLTALCQGGSNLDIADSLFVSEHTVKSHLYSIFRKLEVKNRMQAVAWAKR 214

Query: 243 N 243
           N
Sbjct: 215 N 215


>gi|158317584|ref|YP_001510092.1| two component LuxR family transcriptional regulator [Frankia sp.
           EAN1pec]
 gi|158112989|gb|ABW15186.1| two component transcriptional regulator, LuxR family [Frankia sp.
           EAN1pec]
          Length = 237

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  +++G  + +IA  L IS NTV N+I +I+ K    +R  A+ YAVR  +
Sbjct: 174 LTDREMEVLRLVAKGLNNRDIAKQLYISENTVKNHIRNILEKLQLHSRMEAVVYAVREKL 233

Query: 246 V 246
           +
Sbjct: 234 L 234


>gi|30261536|ref|NP_843913.1| DNA-binding response regulator [Bacillus anthracis str. Ames]
 gi|42780637|ref|NP_977884.1| DNA-binding response regulator [Bacillus cereus ATCC 10987]
 gi|47526732|ref|YP_018081.1| DNA-binding response regulator [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49184365|ref|YP_027617.1| DNA-binding response regulator [Bacillus anthracis str. Sterne]
 gi|49481072|ref|YP_035656.1| response regulator [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|65318804|ref|ZP_00391763.1| COG2197: Response regulator containing a CheY-like receiver domain
           and an HTH DNA-binding domain [Bacillus anthracis str.
           A2012]
 gi|118476998|ref|YP_894149.1| response regulator [Bacillus thuringiensis str. Al Hakam]
 gi|163939354|ref|YP_001644238.1| two component LuxR family transcriptional regulator [Bacillus
           weihenstephanensis KBAB4]
 gi|165872654|ref|ZP_02217284.1| DNA-binding response regulator [Bacillus anthracis str. A0488]
 gi|167634292|ref|ZP_02392613.1| DNA-binding response regulator [Bacillus anthracis str. A0442]
 gi|167641615|ref|ZP_02399861.1| DNA-binding response regulator [Bacillus anthracis str. A0193]
 gi|170706386|ref|ZP_02896847.1| DNA-binding response regulator [Bacillus anthracis str. A0389]
 gi|177651401|ref|ZP_02934190.1| DNA-binding response regulator [Bacillus anthracis str. A0174]
 gi|190568032|ref|ZP_03020942.1| DNA-binding response regulator [Bacillus anthracis Tsiankovskii-I]
 gi|196036887|ref|ZP_03104273.1| DNA-binding response regulator [Bacillus cereus W]
 gi|196047716|ref|ZP_03114919.1| DNA-binding response regulator [Bacillus cereus 03BB108]
 gi|206978391|ref|ZP_03239262.1| DNA-binding response regulator [Bacillus cereus H3081.97]
 gi|217959016|ref|YP_002337564.1| DNA-binding response regulator [Bacillus cereus AH187]
 gi|222095172|ref|YP_002529232.1| DNA-binding response regulator [Bacillus cereus Q1]
 gi|225863403|ref|YP_002748781.1| DNA-binding response regulator [Bacillus cereus 03BB102]
 gi|227815714|ref|YP_002815723.1| DNA-binding response regulator [Bacillus anthracis str. CDC 684]
 gi|229599953|ref|YP_002865949.1| DNA-binding response regulator [Bacillus anthracis str. A0248]
 gi|254682399|ref|ZP_05146260.1| DNA-binding response regulator [Bacillus anthracis str. CNEVA-9066]
 gi|254721216|ref|ZP_05183006.1| DNA-binding response regulator [Bacillus anthracis str. A1055]
 gi|254733815|ref|ZP_05191529.1| DNA-binding response regulator [Bacillus anthracis str. Western
           North America USA6153]
 gi|254740493|ref|ZP_05198184.1| DNA-binding response regulator [Bacillus anthracis str. Kruger B]
 gi|254753884|ref|ZP_05205919.1| DNA-binding response regulator [Bacillus anthracis str. Vollum]
 gi|254758979|ref|ZP_05211006.1| DNA-binding response regulator [Bacillus anthracis str. Australia
           94]
 gi|300118514|ref|ZP_07056253.1| DNA-binding response regulator [Bacillus cereus SJ1]
 gi|301053077|ref|YP_003791288.1| response regulator [Bacillus anthracis CI]
 gi|30255390|gb|AAP25399.1| DNA-binding response regulator [Bacillus anthracis str. Ames]
 gi|42736557|gb|AAS40492.1| DNA-binding response regulator [Bacillus cereus ATCC 10987]
 gi|47501880|gb|AAT30556.1| DNA-binding response regulator [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49178292|gb|AAT53668.1| DNA-binding response regulator [Bacillus anthracis str. Sterne]
 gi|49332628|gb|AAT63274.1| response regulator [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|118416223|gb|ABK84642.1| response regulator [Bacillus thuringiensis str. Al Hakam]
 gi|163861551|gb|ABY42610.1| two component transcriptional regulator, LuxR family [Bacillus
           weihenstephanensis KBAB4]
 gi|164711598|gb|EDR17145.1| DNA-binding response regulator [Bacillus anthracis str. A0488]
 gi|167510408|gb|EDR85808.1| DNA-binding response regulator [Bacillus anthracis str. A0193]
 gi|167530180|gb|EDR92906.1| DNA-binding response regulator [Bacillus anthracis str. A0442]
 gi|170128920|gb|EDS97786.1| DNA-binding response regulator [Bacillus anthracis str. A0389]
 gi|172082679|gb|EDT67742.1| DNA-binding response regulator [Bacillus anthracis str. A0174]
 gi|190560766|gb|EDV14741.1| DNA-binding response regulator [Bacillus anthracis Tsiankovskii-I]
 gi|195990509|gb|EDX54491.1| DNA-binding response regulator [Bacillus cereus W]
 gi|196021466|gb|EDX60170.1| DNA-binding response regulator [Bacillus cereus 03BB108]
 gi|206743396|gb|EDZ54832.1| DNA-binding response regulator [Bacillus cereus H3081.97]
 gi|217065203|gb|ACJ79453.1| DNA-binding response regulator [Bacillus cereus AH187]
 gi|221239230|gb|ACM11940.1| DNA-binding response regulator [Bacillus cereus Q1]
 gi|225787204|gb|ACO27421.1| DNA-binding response regulator [Bacillus cereus 03BB102]
 gi|227006221|gb|ACP15964.1| DNA-binding response regulator [Bacillus anthracis str. CDC 684]
 gi|229264361|gb|ACQ45998.1| DNA-binding response regulator [Bacillus anthracis str. A0248]
 gi|298724038|gb|EFI64741.1| DNA-binding response regulator [Bacillus cereus SJ1]
 gi|300375246|gb|ADK04150.1| response regulator [Bacillus cereus biovar anthracis str. CI]
 gi|324325555|gb|ADY20815.1| response regulator [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 210

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K     R+ A+ YA R+ 
Sbjct: 148 ELTERESEILLLIAEGKSNQEIADELFIALKTVKTHVSNILNKLNVSDRTQAVIYAFRHQ 207

Query: 245 I 245
           +
Sbjct: 208 L 208


>gi|326943150|gb|AEA19046.1| two-component response regulator YocG [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 200

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 35/61 (57%)

Query: 180 WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           W +   L+ RE E L    EGKT++EIA +L +S  TV NYI+ ++ K   K R  AI  
Sbjct: 134 WQEQNPLSDREKEVLLLAKEGKTANEIAKVLYLSPGTVRNYISEVLTKLDAKNRIEAITI 193

Query: 240 A 240
           A
Sbjct: 194 A 194


>gi|302337778|ref|YP_003802984.1| LuxR family transcriptional regulator [Spirochaeta smaragdinae DSM
           11293]
 gi|301634963|gb|ADK80390.1| transcriptional regulator, LuxR family [Spirochaeta smaragdinae DSM
           11293]
          Length = 264

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRS 234
            + KD+ L+ RE E    + +GKT+ EI   L IS  TV  +IASI RKT  + R+
Sbjct: 200 EFAKDYALSPRETEITALLLQGKTNAEICQSLFISLATVKTHIASIFRKTGARNRT 255


>gi|299531690|ref|ZP_07045095.1| two component transcriptional regulator, LuxR family protein
           [Comamonas testosteroni S44]
 gi|298720406|gb|EFI61358.1| two component transcriptional regulator, LuxR family protein
           [Comamonas testosteroni S44]
          Length = 228

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 41/66 (62%), Gaps = 1/66 (1%)

Query: 182 KDFE-LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           K FE LT RE++ L  I++GKT+ EI+  L IS  TV  ++ +I  K   +TR+ A+ YA
Sbjct: 163 KKFESLTEREIDILKLIAQGKTTQEISSYLEISPLTVATHVKNIYGKMQVRTRAQAVRYA 222

Query: 241 VRNNIV 246
           +   I+
Sbjct: 223 MLTGII 228


>gi|258539885|ref|YP_003174384.1| two-component response regulator [Lactobacillus rhamnosus Lc 705]
 gi|257151561|emb|CAR90533.1| Two-component response regulator [Lactobacillus rhamnosus Lc 705]
          Length = 221

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 40/62 (64%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I++GK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA+++ 
Sbjct: 146 ELTNREREVLQLIAQGKSNQEIATELFITLKTVKTHVSNILAKLDVEDRTQAAIYALKHG 205

Query: 245 IV 246
           +V
Sbjct: 206 LV 207


>gi|171912672|ref|ZP_02928142.1| two-component response regulator [Verrucomicrobium spinosum DSM
           4136]
          Length = 210

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 40/62 (64%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           E + RE E L  +++G+++ EIA +LG+S  TV  ++++++ K   + R+ A+  A+R  
Sbjct: 147 EPSPREREVLAQMAKGRSNKEIASVLGLSEETVKRHVSNVLEKLGAQDRTQAVTEAIRRG 206

Query: 245 IV 246
           ++
Sbjct: 207 LL 208


>gi|94971316|ref|YP_593364.1| two component LuxR family transcriptional regulator [Candidatus
           Koribacter versatilis Ellin345]
 gi|94553366|gb|ABF43290.1| two component transcriptional regulator, LuxR family [Candidatus
           Koribacter versatilis Ellin345]
          Length = 218

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  ++EG +  EIAV+LG+S  TV  +  ++MRK     ++  + YA++  I
Sbjct: 152 LTPREREILKLLAEGNSVKEIAVLLGLSVKTVEAHKFNLMRKLDIHNKAQLVTYAIQKKI 211

Query: 246 V 246
           +
Sbjct: 212 I 212


>gi|170689229|ref|ZP_02880425.1| DNA-binding response regulator [Bacillus anthracis str. A0465]
 gi|170666784|gb|EDT17551.1| DNA-binding response regulator [Bacillus anthracis str. A0465]
          Length = 210

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K     R+ A+ YA R+ 
Sbjct: 148 ELTERESEILLLIAEGKSNQEIADELFIALKTVKTHVSNILNKLNVSDRTQAVIYAFRHQ 207

Query: 245 I 245
           +
Sbjct: 208 L 208


>gi|27367916|ref|NP_763443.1| transcriptional regulator VpsT [Vibrio vulnificus CMCP6]
 gi|27359489|gb|AAO08433.1| Transcriptional regulator VpsT [Vibrio vulnificus CMCP6]
          Length = 210

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 39/61 (63%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D ELT RE++ L ++  G ++ EIA  L IS +T+ +++ +I RK   K R+ A A+A R
Sbjct: 149 DIELTRREIQVLQFLKAGGSNMEIADSLFISEHTIKSHLYNIFRKIDVKNRTQATAWAKR 208

Query: 243 N 243
           N
Sbjct: 209 N 209


>gi|152974963|ref|YP_001374480.1| two component LuxR family transcriptional regulator [Bacillus
           cereus subsp. cytotoxis NVH 391-98]
 gi|152023715|gb|ABS21485.1| two component transcriptional regulator, LuxR family [Bacillus
           cytotoxicus NVH 391-98]
          Length = 210

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K     R+ A+ YA R+ 
Sbjct: 148 DLTEREFEILLLIAEGKSNQEIADELFIALKTVKTHVSNILNKLNVSDRTQAVIYAFRHQ 207

Query: 245 IV 246
           ++
Sbjct: 208 LI 209


>gi|260436694|ref|ZP_05790664.1| transcriptional regulator, LuxR family [Synechococcus sp. WH 8109]
 gi|260414568|gb|EEX07864.1| transcriptional regulator, LuxR family [Synechococcus sp. WH 8109]
          Length = 92

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 40/61 (65%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +  L+ RE+E +  ++EG T+ EIA  L IS+ TV+N+++++  KT +K R   + +A+ 
Sbjct: 11  EISLSAREIEIIELVAEGLTNQEIADRLTISKRTVDNHVSNVFTKTGSKNRVALLNWAMD 70

Query: 243 N 243
           N
Sbjct: 71  N 71


>gi|218902648|ref|YP_002450482.1| DNA-binding response regulator [Bacillus cereus AH820]
 gi|218535833|gb|ACK88231.1| DNA-binding response regulator [Bacillus cereus AH820]
          Length = 210

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K     R+ A+ YA R+ 
Sbjct: 148 ELTERESEILLLIAEGKSNQEIADELFIALKTVKTHVSNILNKLNVSDRTQAVIYAFRHQ 207

Query: 245 I 245
           +
Sbjct: 208 L 208


>gi|14586749|gb|AAK70347.1|AF333002_1 N-acyl homoserine lactone transcriptional regulator [Burkholderia
           cepacia]
          Length = 239

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 34/60 (56%)

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T RE E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 177 TAREREVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGASNKVQAVVKAISAGLI 236


>gi|293608422|ref|ZP_06690725.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828995|gb|EFF87357.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 319

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           +LT RE E + W+  GKT+ +IA IL +S  TVN ++  I  K   + R+ A+A+
Sbjct: 256 QLTQREAEVMHWLLLGKTNKDIAEILELSPRTVNKHLEHIFEKLCVENRTAAVAH 310


>gi|228942499|ref|ZP_04105035.1| Two-component response regulator [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228975433|ref|ZP_04135988.1| Two-component response regulator [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228982066|ref|ZP_04142358.1| Two-component response regulator [Bacillus thuringiensis Bt407]
 gi|228777604|gb|EEM25879.1| Two-component response regulator [Bacillus thuringiensis Bt407]
 gi|228784227|gb|EEM32251.1| Two-component response regulator [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228817182|gb|EEM63271.1| Two-component response regulator [Bacillus thuringiensis serovar
           berliner ATCC 10792]
          Length = 189

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 35/61 (57%)

Query: 180 WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           W +   L+ RE E L    EGKT++EIA +L +S  TV NYI+ ++ K   K R  AI  
Sbjct: 123 WQEQNPLSDREKEVLLLAKEGKTANEIAKVLYLSPGTVRNYISEVLTKLDAKNRIEAITI 182

Query: 240 A 240
           A
Sbjct: 183 A 183


>gi|4103042|gb|AAD12726.1| transcriptional activator [Burkholderia cepacia]
          Length = 239

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT R+ E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   +
Sbjct: 176 LTARDREVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|199597190|ref|ZP_03210622.1| DNA-binding response regulator, CitB family (Rec-wHTH domains)
           [Lactobacillus rhamnosus HN001]
 gi|258508705|ref|YP_003171456.1| two-component response regulator [Lactobacillus rhamnosus GG]
 gi|199591994|gb|EDZ00069.1| DNA-binding response regulator, CitB family (Rec-wHTH domains)
           [Lactobacillus rhamnosus HN001]
 gi|257148632|emb|CAR87605.1| Two-component response regulator [Lactobacillus rhamnosus GG]
 gi|259650011|dbj|BAI42173.1| two-component response regulator [Lactobacillus rhamnosus GG]
          Length = 221

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 40/62 (64%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I++GK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA+++ 
Sbjct: 146 ELTNREREVLQLIAQGKSNQEIATELFITLKTVKTHVSNILAKLDVEDRTQAAIYALKHG 205

Query: 245 IV 246
           +V
Sbjct: 206 LV 207


>gi|309792037|ref|ZP_07686513.1| two component LuxR family transcriptional regulator [Oscillochloris
           trichoides DG6]
 gi|308225930|gb|EFO79682.1| two component LuxR family transcriptional regulator [Oscillochloris
           trichoides DG6]
          Length = 234

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           LT RE+E L  I+ G ++ EIA  L IS  TV N+I SI+ K     R+ A+ YA++
Sbjct: 158 LTSREIEILDCIARGLSNKEIANELSISGQTVKNHITSILSKLQVNDRTMAVIYAIK 214


>gi|229822282|ref|YP_002883808.1| two component LuxR family transcriptional regulator [Beutenbergia
           cavernae DSM 12333]
 gi|229568195|gb|ACQ82046.1| two component transcriptional regulator, LuxR family [Beutenbergia
           cavernae DSM 12333]
          Length = 216

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 47/83 (56%)

Query: 164 LLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           +L A +A      D   G   ELT RE+E L  ++ G ++ EIA  L ++  TV N++++
Sbjct: 133 VLRAVRAGSVPLDDAAAGDVQELTSRELEILRLLAAGYSNREIAEALHLAEGTVKNHVST 192

Query: 224 IMRKTATKTRSGAIAYAVRNNIV 246
           ++ K  T+ R+ A+  A+ + ++
Sbjct: 193 VLLKLGTRDRTRAVLRALHHGLL 215


>gi|170743557|ref|YP_001772212.1| LuxR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168197831|gb|ACA19778.1| transcriptional regulator, LuxR family [Methylobacterium sp. 4-46]
          Length = 245

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE E L W ++GK+  EIA  +GIS +    ++ ++ RK  T +R+ A+A  +R  I
Sbjct: 184 LSPRERESLQWAADGKSDQEIADAMGISAHGAIRHLRAVRRKLGTTSRAHAVALGLRLGI 243

Query: 246 V 246
           +
Sbjct: 244 I 244


>gi|148655092|ref|YP_001275297.1| two component LuxR family transcriptional regulator [Roseiflexus
           sp. RS-1]
 gi|148567202|gb|ABQ89347.1| two component transcriptional regulator, LuxR family [Roseiflexus
           sp. RS-1]
          Length = 242

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           LT RE+E L  I+ G ++ EIA  L IS  TV N+I SI+ K     R+ A+ YA++  
Sbjct: 164 LTSREIEILDCIARGLSNKEIASQLSISGQTVKNHITSILSKLQVNDRTMAVIYAIQRG 222


>gi|327190926|gb|EGE57980.1| putative two-component response regulator protein [Rhizobium etli
           CNPAF512]
          Length = 305

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (57%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           F LT RE E L WI++GK + +I  ILG+S  TVN ++  I  K   + R+ A   A
Sbjct: 242 FSLTQRESEVLLWIAKGKPNRDIGEILGLSARTVNKHLEQIYVKLGVENRASAAVKA 298


>gi|190893145|ref|YP_001979687.1| two-component response regulator protein [Rhizobium etli CIAT 652]
 gi|190698424|gb|ACE92509.1| probable two-component response regulator protein [Rhizobium etli
           CIAT 652]
          Length = 305

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (57%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           F LT RE E L WI++GK + +I  ILG+S  TVN ++  I  K   + R+ A   A
Sbjct: 242 FSLTQRESEVLLWIAKGKPNRDIGEILGLSARTVNKHLEQIYVKLGVENRASAAVKA 298


>gi|289641016|ref|ZP_06473185.1| two component transcriptional regulator, LuxR family [Frankia
           symbiont of Datisca glomerata]
 gi|289509136|gb|EFD30066.1| two component transcriptional regulator, LuxR family [Frankia
           symbiont of Datisca glomerata]
          Length = 234

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  +++G  + +IA  L IS NTV N+I +I+ K    +R  A+ YAVR  +
Sbjct: 171 LTDREMEVLRLVAKGLNNRDIAKQLFISENTVKNHIRNILEKLQLHSRMEAVVYAVREKL 230

Query: 246 V 246
           +
Sbjct: 231 L 231


>gi|37676043|ref|NP_936439.1| DNA-binding HTH domain-containing protein [Vibrio vulnificus YJ016]
 gi|37200583|dbj|BAC96409.1| DNA-binding HTH domain-containing protein [Vibrio vulnificus YJ016]
          Length = 219

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 39/61 (63%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D ELT RE++ L ++  G ++ EIA  L IS +T+ +++ +I RK   K R+ A A+A R
Sbjct: 158 DIELTRREIQVLQFLKAGGSNMEIADSLFISEHTIKSHLYNIFRKIDVKNRTQATAWAKR 217

Query: 243 N 243
           N
Sbjct: 218 N 218


>gi|330961628|gb|EGH61888.1| regulatory protein, LuxR [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 77

 Score = 47.4 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 35/55 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           LT RE+E L W +EGKT+ +IA+IL +   T++ +IAS ++K     ++ A   A
Sbjct: 17  LTQREIEVLKWSAEGKTAGDIAIILCLKERTIHFHIASAIQKMGVCNKTAAAVQA 71


>gi|316931698|ref|YP_004106680.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           DX-1]
 gi|315599412|gb|ADU41947.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           DX-1]
          Length = 243

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 39/66 (59%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G+  +LT RE E L W ++GKT+ EI++IL I+  TV  ++    RK     R+ A+A A
Sbjct: 176 GRRNKLTARECEILQWAAQGKTAWEISMILCIAERTVKFHLIEAARKLDAANRTAAVAKA 235

Query: 241 VRNNIV 246
           +   ++
Sbjct: 236 LTLGLI 241


>gi|262204346|ref|YP_003275554.1| response regulator receiver [Gordonia bronchialis DSM 43247]
 gi|262087693|gb|ACY23661.1| response regulator receiver [Gordonia bronchialis DSM 43247]
          Length = 213

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 40/60 (66%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REVE +  I+EG ++ +IA  L +S +TV  +I  I+ KTA + R+  ++YA R+++
Sbjct: 153 LTEREVEVIALIAEGLSNQQIATRLVVSLSTVKTHINHILAKTACRDRAALVSYAFRHHL 212


>gi|163745782|ref|ZP_02153141.1| transcription regulator, LuxR family, putative [Oceanibulbus
           indolifex HEL-45]
 gi|161380527|gb|EDQ04937.1| transcription regulator, LuxR family, putative [Oceanibulbus
           indolifex HEL-45]
          Length = 253

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (61%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           +DF L+ REVE L WI+ GK++  IA ILGIS +TV+  +  I  K     R+ A
Sbjct: 181 RDFGLSPREVEVLEWIATGKSNGVIAEILGISPHTVDTIVRRIFAKLDVNDRTTA 235


>gi|310644345|ref|YP_003949104.1| two component transcriptional regulator, luxr family [Paenibacillus
           polymyxa SC2]
 gi|309249296|gb|ADO58863.1| Two component transcriptional regulator, LuxR family [Paenibacillus
           polymyxa SC2]
          Length = 240

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 66/139 (47%), Gaps = 11/139 (7%)

Query: 112 VFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPK--GRIILRDR----LWEIGLL 165
           VF TL +        D    SL   +  +  G   + PK  G++I + R    L E G +
Sbjct: 99  VFETLRKGANGYLLKDMEAESLINAIRSVHEGYAFIHPKVTGKLIQQLRRMTYLNETGAM 158

Query: 166 AAYQANMFKSYDVHW--GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           A       K   V +  G++  LT RE E L  ++EGK++  I   L IS  TV N+++S
Sbjct: 159 AEGHT---KEAGVKFVAGENNPLTRREAEVLRLMAEGKSNKMIGEYLFISEKTVKNHVSS 215

Query: 224 IMRKTATKTRSGAIAYAVR 242
           I++K     R+ A+  +++
Sbjct: 216 ILQKMEVDDRTQAVINSIK 234


>gi|239503588|ref|ZP_04662898.1| response regulator [Acinetobacter baumannii AB900]
          Length = 319

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           +LT RE E + W+  GKT+ +IA IL +S  TVN ++  I  K   + R+ A+A+
Sbjct: 256 QLTQREAEVMHWLLLGKTNKDIAEILELSPRTVNKHLEHIFEKLCVENRTAAVAH 310


>gi|190890350|ref|YP_001976892.1| transcriptional regulator protein, LuxR family [Rhizobium etli CIAT
           652]
 gi|190695629|gb|ACE89714.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CIAT 652]
          Length = 248

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 97/252 (38%), Gaps = 36/252 (14%)

Query: 11  VLNREDEQRTSFVSHLPTRSDLLARMIPLD---------------CTVSWTMRMYALTEY 55
           V+N  D  R   V+ + +RSDL  R+I +                  +    R+    E 
Sbjct: 8   VMNGADPLRMVRVNRISSRSDLFPRLIAMQKLADAQGFAIYRVSGSGLPAKQRLVCELEN 67

Query: 56  VGASH--FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVF 113
            G+S+  F     D + +  LD I  S  P        LS    +      P + F P  
Sbjct: 68  WGSSNAGFGKAFTDAYGDILLDHIEKSLLP--------LSWAGAHDRAAPGPAD-FAPFM 118

Query: 114 HTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRII--LRDRLWEI-GLLAAYQA 170
             L + I P       +  L F V    +G   +   G  I    D + E+ G       
Sbjct: 119 TRLRDGILP-------FSGLAFPVRLGAVGNGFILFTGDDIDPSSDMIVELHGRCCHIMM 171

Query: 171 NMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTAT 230
           ++    +        L+ RE+ CL    +G+ S+EIA  LG+S +TVN Y+ S   K  +
Sbjct: 172 DLLSLDERRTAAAEALSEREIACLQLAGDGRISEEIAEKLGLSVHTVNAYLGSATIKLDS 231

Query: 231 KTRSGAIAYAVR 242
             R  AIA A+R
Sbjct: 232 VNRIQAIAKAIR 243


>gi|218247412|ref|YP_002372783.1| two component LuxR family transcriptional regulator [Cyanothece sp.
           PCC 8801]
 gi|257061251|ref|YP_003139139.1| two component LuxR family transcriptional regulator [Cyanothece sp.
           PCC 8802]
 gi|218167890|gb|ACK66627.1| two component transcriptional regulator, LuxR family [Cyanothece
           sp. PCC 8801]
 gi|256591417|gb|ACV02304.1| two component transcriptional regulator, LuxR family [Cyanothece
           sp. PCC 8802]
          Length = 210

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+E L  I EGK+++EIA  L +S NT+  ++  IM K A   R  A   A+R+ +
Sbjct: 150 LSERELEVLKLIVEGKSNNEIAEDLYLSTNTIKTHVRGIMNKLAVDDRVQAAVVALRSGL 209

Query: 246 V 246
           V
Sbjct: 210 V 210


>gi|116622583|ref|YP_824739.1| two component LuxR family transcriptional regulator [Candidatus
           Solibacter usitatus Ellin6076]
 gi|116225745|gb|ABJ84454.1| two component transcriptional regulator, LuxR family [Candidatus
           Solibacter usitatus Ellin6076]
          Length = 210

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  I  GK++ EIA +L +S NTV  + A+IM+       +  + YA+R  +
Sbjct: 147 LTTRELEVLQLIVHGKSNKEIAAVLSLSANTVAVHRANIMQTLGIHNTAELVVYAIRQGL 206

Query: 246 V 246
           V
Sbjct: 207 V 207


>gi|327405906|ref|YP_004346744.1| LuxR family two component transcriptional regulator [Fluviicola
           taffensis DSM 16823]
 gi|327321414|gb|AEA45906.1| two component transcriptional regulator, LuxR family [Fluviicola
           taffensis DSM 16823]
          Length = 226

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE E +T ISEG T+  IA  L +S +T+N +  +IM K   K  +G + YAV+ N+
Sbjct: 153 LSERETEIITMISEGLTNIMIADSLCLSNHTINTHRKNIMAKLGVKNTAGIVIYAVKTNL 212

Query: 246 V 246
           V
Sbjct: 213 V 213


>gi|322835285|ref|YP_004215311.1| LuxR family transcriptional regulator [Rahnella sp. Y9602]
 gi|321170486|gb|ADW76184.1| transcriptional regulator, LuxR family [Rahnella sp. Y9602]
          Length = 251

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 47/91 (51%), Gaps = 3/91 (3%)

Query: 155 LRDRLWEIGLLA-AYQANMFKSYD--VHWGKDFELTGREVECLTWISEGKTSDEIAVILG 211
           + D L E+ LLA  +Q  +F  +D  +   +   L+ RE ECLTW +EG T+ EIA  L 
Sbjct: 155 IHDVLAELSLLALTFQECVFPLFDSSILTCRHVRLSKRERECLTWAAEGLTAKEIARKLN 214

Query: 212 ISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
            S  TV  ++ +  RK     R  A+  A+ 
Sbjct: 215 RSIATVTLHLNTAARKLGASNRVQAVVRAMH 245


>gi|312876261|ref|ZP_07736247.1| two component transcriptional regulator, LuxR family
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|311796907|gb|EFR13250.1| two component transcriptional regulator, LuxR family
           [Caldicellulosiruptor lactoaceticus 6A]
          Length = 215

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 38/59 (64%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           ELT RE++ +  I++G ++ EIA +L IS  TV NYI+SI++K   + R+    Y  +N
Sbjct: 155 ELTERELDIVKLIAQGYSNKEIANLLFISEGTVRNYISSILQKLQLQNRTQIAIYYYKN 213


>gi|297531030|ref|YP_003672305.1| LuxR family transcriptional regulator [Geobacillus sp. C56-T3]
 gi|297254282|gb|ADI27728.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. C56-T3]
          Length = 200

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           LT  E+  L  I+  KT+ EI   L IS+ TV ++++SI+RK   K+R+GA+  A R
Sbjct: 139 LTDMELAVLDLIARDKTNREIGEQLNISKRTVEHHVSSILRKLHVKSRAGAVGKAFR 195


>gi|228914112|ref|ZP_04077732.1| hypothetical protein bthur0012_13470 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|229155107|ref|ZP_04283220.1| hypothetical protein bcere0010_13000 [Bacillus cereus ATCC 4342]
 gi|228628392|gb|EEK85106.1| hypothetical protein bcere0010_13000 [Bacillus cereus ATCC 4342]
 gi|228845565|gb|EEM90596.1| hypothetical protein bthur0012_13470 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
          Length = 204

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K     R+ A+ YA R+ 
Sbjct: 142 ELTERESEILLLIAEGKSNQEIADELFIALKTVKTHVSNILNKLNVSDRTQAVIYAFRHQ 201

Query: 245 I 245
           +
Sbjct: 202 L 202


>gi|52143908|ref|YP_082920.1| response regulator [Bacillus cereus E33L]
 gi|51977377|gb|AAU18927.1| response regulator [Bacillus cereus E33L]
          Length = 210

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K     R+ A+ YA R+ 
Sbjct: 148 ELTERESEILLLIAEGKSNQEIADELFIALKTVKTHVSNILNKLNVSDRTQAVIYAFRHQ 207

Query: 245 I 245
           +
Sbjct: 208 L 208


>gi|317121636|ref|YP_004101639.1| LuxR family transcriptional regulator [Thermaerobacter marianensis
           DSM 12885]
 gi|315591616|gb|ADU50912.1| two component transcriptional regulator, LuxR family
           [Thermaerobacter marianensis DSM 12885]
          Length = 222

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 41/61 (67%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+E L+ I+ GK++ ++A  L IS  TV N+++ IM+K   + R+ A+ +A+R  +
Sbjct: 155 LSQRELEVLSRIARGKSTAQVARELYISPKTVRNHLSHIMQKLGVRDRTQAVLFALRVGL 214

Query: 246 V 246
           +
Sbjct: 215 I 215


>gi|226310364|ref|YP_002770258.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
 gi|226093312|dbj|BAH41754.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
          Length = 235

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE + L  +S GK +D+IA  L IS  TV  +I  I++K   + R+ A+A A+R  
Sbjct: 173 QLTDRERDVLEQLSYGKRNDQIAQHLLISGGTVKTHIHRILQKMGVEDRTQAVAKAIRYK 232

Query: 245 IV 246
           IV
Sbjct: 233 IV 234


>gi|332525737|ref|ZP_08401884.1| two component LuxR family transcriptional regulator [Rubrivivax
           benzoatilyticus JA2]
 gi|332109294|gb|EGJ10217.1| two component LuxR family transcriptional regulator [Rubrivivax
           benzoatilyticus JA2]
          Length = 326

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRS 234
            ELT RE E L W+ +GKT+ +I  ILG S  TV  ++  +  K   +TR+
Sbjct: 259 LELTAREAEVLYWVVQGKTNRDIGDILGTSHRTVTKHLEHVFEKLGVETRT 309


>gi|327193021|gb|EGE59933.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli CNPAF512]
          Length = 306

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE+ CL    +G+ S+EIA  LG+S +TVN Y+ S   K  +  R  AIA A+R
Sbjct: 245 LSEREIACLQLAGDGRISEEIAEKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIR 301


>gi|222084852|ref|YP_002543381.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
 gi|221722300|gb|ACM25456.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
          Length = 248

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE+ CL    +G+ S+EIA  LG+S +TVN Y+ S   K  +  R  AIA A+R
Sbjct: 187 LSEREIACLQLAGDGRISEEIAEKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIR 243


>gi|239816122|ref|YP_002945032.1| two component LuxR family transcriptional regulator [Variovorax
           paradoxus S110]
 gi|239802699|gb|ACS19766.1| two component transcriptional regulator, LuxR family [Variovorax
           paradoxus S110]
          Length = 302

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 31/48 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           LT RE E L+W+++GKT+ +I  ILG S  TVN ++  I  K   +TR
Sbjct: 243 LTPRETEVLSWLAKGKTNRDIGEILGTSPRTVNKHLEHIFEKLGVETR 290


>gi|239816173|ref|YP_002945083.1| two component LuxR family transcriptional regulator [Variovorax
           paradoxus S110]
 gi|239802750|gb|ACS19817.1| two component transcriptional regulator, LuxR family [Variovorax
           paradoxus S110]
          Length = 262

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           ++  LT RE E L +++ G  S EI+V LGIS  TVN +I +I +K    +R+ A++ A 
Sbjct: 198 REATLTAREREVLRFVARGCVSKEISVRLGISGQTVNAHIKNIYKKLHVHSRAQAVSLAT 257

Query: 242 RNN 244
              
Sbjct: 258 HTG 260


>gi|317404677|gb|EFV85070.1| hypothetical protein HMPREF0005_04072 [Achromobacter xylosoxidans
           C54]
          Length = 515

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 34/62 (54%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L  + +G   D IA  L +SRNTV N++A+I  K     RS AI +A    
Sbjct: 440 QLTAREREVLGLLCQGHDDDGIARQLRLSRNTVRNHVATIYSKIGVHRRSAAIVWARDRG 499

Query: 245 IV 246
           I 
Sbjct: 500 IT 501


>gi|312115398|ref|YP_004012994.1| LuxR family transcriptional regulator [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311220527|gb|ADP71895.1| transcriptional regulator, LuxR family [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 251

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 38/61 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E ++W +EGK+   IA ILG+S +TV  ++ ++ +K     R+ A   A+R+ +
Sbjct: 185 LTEREKEIMSWAAEGKSDSVIAEILGVSHSTVRFHMNNVFKKLNANERTLATVKAIRHGL 244

Query: 246 V 246
           +
Sbjct: 245 I 245


>gi|158340472|ref|YP_001521466.1| two-component LuxR family transcriptional regulator [Acaryochloris
           marina MBIC11017]
 gi|158310713|gb|ABW32327.1| two-component transcriptional regulator, LuxR family [Acaryochloris
           marina MBIC11017]
          Length = 215

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 38/63 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  LT RE+E L  +++G T+ EIA    +S  TV N++++I+ +   + R+ A  YAV 
Sbjct: 152 DTPLTTRELEVLKLLAKGNTNKEIAKAFNLSEGTVKNHVSNILMRLGLRDRTQAAVYAVE 211

Query: 243 NNI 245
           + +
Sbjct: 212 HGL 214


>gi|228984618|ref|ZP_04144793.1| hypothetical protein bthur0001_13210 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228775145|gb|EEM23536.1| hypothetical protein bthur0001_13210 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
          Length = 204

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K     R+ A+ YA R+ 
Sbjct: 142 ELTERESEILLLIAEGKSNQEIADELFIALKTVKTHVSNILNKLNVSDRTQAVIYAFRHQ 201

Query: 245 I 245
           +
Sbjct: 202 L 202


>gi|228920248|ref|ZP_04083596.1| hypothetical protein bthur0011_12640 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228926569|ref|ZP_04089640.1| hypothetical protein bthur0010_12870 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|229121079|ref|ZP_04250319.1| hypothetical protein bcere0016_13860 [Bacillus cereus 95/8201]
 gi|229138230|ref|ZP_04266826.1| hypothetical protein bcere0013_13520 [Bacillus cereus BDRD-ST26]
 gi|229183733|ref|ZP_04310953.1| hypothetical protein bcere0004_13030 [Bacillus cereus BGSC 6E1]
 gi|229195738|ref|ZP_04322500.1| hypothetical protein bcere0001_13030 [Bacillus cereus m1293]
 gi|228587744|gb|EEK45800.1| hypothetical protein bcere0001_13030 [Bacillus cereus m1293]
 gi|228599776|gb|EEK57376.1| hypothetical protein bcere0004_13030 [Bacillus cereus BGSC 6E1]
 gi|228645262|gb|EEL01498.1| hypothetical protein bcere0013_13520 [Bacillus cereus BDRD-ST26]
 gi|228662408|gb|EEL18008.1| hypothetical protein bcere0016_13860 [Bacillus cereus 95/8201]
 gi|228833157|gb|EEM78723.1| hypothetical protein bthur0010_12870 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228839447|gb|EEM84740.1| hypothetical protein bthur0011_12640 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 204

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K     R+ A+ YA R+ 
Sbjct: 142 ELTERESEILLLIAEGKSNQEIADELFIALKTVKTHVSNILNKLNVSDRTQAVIYAFRHQ 201

Query: 245 I 245
           +
Sbjct: 202 L 202


>gi|115360652|ref|YP_777789.1| LuxR family transcriptional regulator [Burkholderia ambifaria AMMD]
 gi|115285980|gb|ABI91455.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           AMMD]
          Length = 237

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 34/48 (70%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTAT 230
           D ELT REVE L W+++GKT+ EI++I+ IS  TVN ++ + + K  T
Sbjct: 173 DIELTDREVEVLKWVADGKTAAEISMIMLISVYTVNFHVKNAVTKLNT 220


>gi|47569107|ref|ZP_00239795.1| DNA-binding response regulator, LuxR family [Bacillus cereus G9241]
 gi|47554178|gb|EAL12541.1| DNA-binding response regulator, LuxR family [Bacillus cereus G9241]
          Length = 132

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K     R+ A+ YA R+ 
Sbjct: 70  ELTERESEILLLIAEGKSNQEIADELFIALKTVKTHVSNILNKLNVSDRTQAVIYAFRHQ 129

Query: 245 I 245
           +
Sbjct: 130 L 130


>gi|108805421|ref|YP_645358.1| two component LuxR family transcriptional regulator [Rubrobacter
           xylanophilus DSM 9941]
 gi|108766664|gb|ABG05546.1| two component transcriptional regulator, LuxR family [Rubrobacter
           xylanophilus DSM 9941]
          Length = 232

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 35/56 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           ELT RE E L  ++ G+T+ EIA  L ISR T  +++ +I+RK     R+ A+A A
Sbjct: 161 ELTAREREVLVLMARGRTNPEIARELVISRGTAKSHVQNIIRKLGVSDRTQAVARA 216


>gi|253991535|ref|YP_003042891.1| transcriptional regulator [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211638413|emb|CAR67035.1| transcriptional regulator of sqaz gene cluster [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253782985|emb|CAQ86150.1| putative transcriptional regulator [Photorhabdus asymbiotica]
          Length = 236

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 49/98 (50%), Gaps = 14/98 (14%)

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-----LTGR 189
           F VAR          +G I   + L + G+L        K+++    K+ +     L+ R
Sbjct: 128 FSVAR---------KEGPISHNEILNKAGMLGILANECIKTFNNLKNKEDKIIVPTLSTR 178

Query: 190 EVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRK 227
           EVE + W  EGKTS EIA IL IS  TVN +I +IM K
Sbjct: 179 EVEVIRWTCEGKTSAEIANILDISTRTVNFHINNIMEK 216


>gi|156977745|ref|YP_001448651.1| hypothetical protein VIBHAR_06533 [Vibrio harveyi ATCC BAA-1116]
 gi|156529339|gb|ABU74424.1| hypothetical protein VIBHAR_06533 [Vibrio harveyi ATCC BAA-1116]
          Length = 217

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 40/61 (65%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + ELT RE++ LT + +G ++ +IA  L +S +TV +++ SI RK   K R  A+A+A R
Sbjct: 155 EIELTRREMQVLTALCQGGSNLDIADSLFVSEHTVKSHLYSIFRKLEVKNRMQAVAWAKR 214

Query: 243 N 243
           N
Sbjct: 215 N 215


>gi|326326038|ref|YP_004250847.1| putative transcriptional activator protein solR-LuxR [Vibrio
           nigripulchritudo]
 gi|323669089|emb|CBJ93133.1| Putative transcriptional activator protein solR-LuxR [Vibrio
           nigripulchritudo]
          Length = 232

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 36/56 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT RE+E L W +EGKT+ E ++IL IS  TV  +I + ++K  T  ++ A+  AV
Sbjct: 171 LTPREIEILKWSAEGKTASETSMILSISERTVTFHITNAVKKLNTCNKTSAVIKAV 226


>gi|118592081|ref|ZP_01549475.1| transcriptional regulator, LuxR family protein [Stappia aggregata
           IAM 12614]
 gi|118435377|gb|EAV42024.1| transcriptional regulator, LuxR family protein [Stappia aggregata
           IAM 12614]
          Length = 257

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 36/59 (61%)

Query: 180 WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           W    +LTGRE + L  +SEGK   EIA+ L IS  TV +++ ++ +K+   +R+  +A
Sbjct: 190 WAARHQLTGREQDVLCLVSEGKRDREIALDLNISVTTVRSHLKAVFQKSGVTSRAELLA 248


>gi|320158186|ref|YP_004190564.1| transcriptional regulator VpsT [Vibrio vulnificus MO6-24/O]
 gi|319933498|gb|ADV88361.1| transcriptional regulator VpsT [Vibrio vulnificus MO6-24/O]
          Length = 214

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 39/61 (63%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D ELT RE++ L ++  G ++ EIA  L IS +T+ +++ +I RK   K R+ A A+A R
Sbjct: 153 DIELTRREIQVLQFLKAGGSNMEIADSLFISEHTIKSHLYNIFRKIDVKNRTQATAWAKR 212

Query: 243 N 243
           N
Sbjct: 213 N 213


>gi|313902397|ref|ZP_07835800.1| two component transcriptional regulator, LuxR family
           [Thermaerobacter subterraneus DSM 13965]
 gi|313467328|gb|EFR62839.1| two component transcriptional regulator, LuxR family
           [Thermaerobacter subterraneus DSM 13965]
          Length = 218

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 34/59 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           LT RE E L  ++EG ++ EI   L IS  TV N+I SI RK     R+ A+ +A+R  
Sbjct: 156 LTRREFEVLQLVAEGVSNREIGQRLFISEKTVKNHITSIFRKLGVADRTQAVIHAIREG 214


>gi|295402188|ref|ZP_06812146.1| two component transcriptional regulator, LuxR family [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294975779|gb|EFG51399.1| two component transcriptional regulator, LuxR family [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 211

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 37/63 (58%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  L+ RE+     + EGKT+ EIA  L +S  TV N+I  I++K   + R+    YA++
Sbjct: 147 DIPLSPRELMIAKLVGEGKTNKEIAAELHLSIGTVKNHITQILQKLQLRDRTQLAIYAIK 206

Query: 243 NNI 245
           ++I
Sbjct: 207 HDI 209


>gi|255598987|ref|XP_002537125.1| conserved hypothetical protein [Ricinus communis]
 gi|223517394|gb|EEF25258.1| conserved hypothetical protein [Ricinus communis]
          Length = 277

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 41/66 (62%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G+   L+ RE+E L W+  GKT+ EI  I+ +S  T+ N++ +I+RK   + RS A + A
Sbjct: 208 GRIKPLSKRELEVLEWLQAGKTNWEIGNIMQVSPLTIKNHVQNILRKLDVENRSQAASKA 267

Query: 241 VRNNIV 246
           ++  ++
Sbjct: 268 LKLGLI 273


>gi|332527516|ref|ZP_08403568.1| two component LuxR family transcriptional regulator [Rubrivivax
           benzoatilyticus JA2]
 gi|332111923|gb|EGJ11901.1| two component LuxR family transcriptional regulator [Rubrivivax
           benzoatilyticus JA2]
          Length = 214

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +LT RE E L  +++G T  EI V LG+SR+T+ +Y+  I RK    +R+ A   A R
Sbjct: 152 QLTDRESEVLLRVAKGYTLPEIGVQLGLSRHTIADYVKQIYRKLNVSSRAEAALEAQR 209


>gi|311108335|ref|YP_003981188.1| sensory box protein 10 [Achromobacter xylosoxidans A8]
 gi|310763024|gb|ADP18473.1| sensory box protein 10 [Achromobacter xylosoxidans A8]
          Length = 497

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 34/62 (54%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L  + +G   D IA  L +SRNTV N++A+I  K     RS AI +A    
Sbjct: 422 QLTSREREVLGLMCQGHDDDSIARQLKLSRNTVRNHVATIYSKIGVHRRSAAIVWARDRG 481

Query: 245 IV 246
           I 
Sbjct: 482 IT 483


>gi|144899411|emb|CAM76275.1| Signal transduction histidine kinase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 189

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W ++GKT+ E + ILGIS  TV  ++ +  RK    T++  I  A R  +
Sbjct: 127 LTAREREVLLWAAQGKTAWETSAILGISSKTVEFHLGNCGRKLGAATKAQTILAAARRGL 186

Query: 246 V 246
           +
Sbjct: 187 L 187


>gi|57233907|ref|YP_182061.1| LuxR family DNA-binding response regulator [Dehalococcoides
           ethenogenes 195]
 gi|57224355|gb|AAW39412.1| DNA-binding response regulator, LuxR family [Dehalococcoides
           ethenogenes 195]
          Length = 225

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 5/68 (7%)

Query: 180 WGKDFE-----LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRS 234
            GKD       LT R+ + LT I+ G T+ +IA  L IS  T+ N++++I+RK     R+
Sbjct: 152 LGKDASNFVTPLTNRKKQILTLIANGNTNKQIANNLEISEQTIKNHVSAILRKLNANDRA 211

Query: 235 GAIAYAVR 242
            A+  A+R
Sbjct: 212 HAVVVAIR 219


>gi|75910715|ref|YP_325011.1| two component LuxR family transcriptional regulator [Anabaena
           variabilis ATCC 29413]
 gi|75704440|gb|ABA24116.1| two component transcriptional regulator, LuxR family [Anabaena
           variabilis ATCC 29413]
          Length = 236

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G    L+GRE+E L  + EG ++ EIA  L +S NTV  ++  IM K A   R  A   A
Sbjct: 171 GNTANLSGRELEVLKLMVEGLSNPEIAEKLYLSPNTVKTHVRGIMNKLAVDDRVQAAVVA 230

Query: 241 VRNNIV 246
           +R+ +V
Sbjct: 231 LRSGLV 236


>gi|312888670|ref|ZP_07748238.1| transcriptional regulator, LuxR family [Mucilaginibacter paludis
           DSM 18603]
 gi|311298837|gb|EFQ75938.1| transcriptional regulator, LuxR family [Mucilaginibacter paludis
           DSM 18603]
          Length = 313

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 41/62 (66%), Gaps = 1/62 (1%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
            F+LT  E+  + +I +GK++ EIA ++ IS NTV  ++ ++ RK   K+R+ A+ Y ++
Sbjct: 248 HFDLTRTEILIIQYIYKGKSNKEIADLMSISENTVKKHLQNVYRKVNVKSRA-ALIYTLQ 306

Query: 243 NN 244
           N+
Sbjct: 307 NH 308


>gi|241205786|ref|YP_002976882.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859676|gb|ACS57343.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 241

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+E + W ++GKTS EI  IL +S +TVN Y+ + ++K     R+  +A A+R  +
Sbjct: 180 LSTRELEVVRWTAQGKTSIEIGQILTLSDHTVNAYMTNAIKKLDCVNRTQLVAKAIRLKL 239

Query: 246 V 246
           +
Sbjct: 240 I 240


>gi|325121840|gb|ADY81363.1| response regulator receiver signal transduction histidine kinase
           [Acinetobacter calcoaceticus PHEA-2]
          Length = 319

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           +LT RE E + W+  GKT+ +IA IL +S  TVN ++  I  K   + R+ A+A+
Sbjct: 256 QLTQREAEVMHWLLLGKTNKDIAEILELSPRTVNKHLEHIFEKLCVENRTAAVAH 310


>gi|317122051|ref|YP_004102054.1| LuxR family transcriptional regulator [Thermaerobacter marianensis
           DSM 12885]
 gi|315592031|gb|ADU51327.1| two component transcriptional regulator, LuxR family
           [Thermaerobacter marianensis DSM 12885]
          Length = 218

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 34/59 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           LT RE E L  ++EG ++ EI   L IS  TV N+I SI RK     R+ A+ +A+R  
Sbjct: 156 LTRREFEVLQLVAEGVSNREIGQRLFISEKTVKNHITSIFRKLGVADRTQAVIHAIREG 214


>gi|227820844|ref|YP_002824814.1| predicted LuxR family transcriptional regulator [Sinorhizobium
           fredii NGR234]
 gi|227339843|gb|ACP24061.1| predicted LuxR family transcriptional regulator [Sinorhizobium
           fredii NGR234]
          Length = 246

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 42/80 (52%)

Query: 163 GLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIA 222
           G  A   A+M  + +    K   L+ RE+ CL    +G  S+EIA  +G+S +TVN Y+ 
Sbjct: 162 GRCAQVMADMLAADERRLFKGESLSDREIACLQMAGDGYISEEIAEKMGLSVHTVNAYLG 221

Query: 223 SIMRKTATKTRSGAIAYAVR 242
           +   K  +  R  AIA A+R
Sbjct: 222 AATTKLDSVNRIQAIAKAIR 241


>gi|126657363|ref|ZP_01728522.1| NarL subfamily protein [Cyanothece sp. CCY0110]
 gi|126621350|gb|EAZ92062.1| NarL subfamily protein [Cyanothece sp. CCY0110]
          Length = 210

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+E L  I EGK+++EIA  L +S NT+  ++  IM K A   R  A   A+R+ +
Sbjct: 150 LSERELEVLKLIVEGKSNNEIAEDLYLSTNTIKTHVRGIMNKLAVDDRVQAAVVALRSGL 209

Query: 246 V 246
           V
Sbjct: 210 V 210


>gi|308071115|ref|YP_003872720.1| DegU family transcriptional regulator [Paenibacillus polymyxa E681]
 gi|305860394|gb|ADM72182.1| Transcriptional regulatory protein degU [Paenibacillus polymyxa
           E681]
          Length = 240

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 66/139 (47%), Gaps = 11/139 (7%)

Query: 112 VFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPK--GRIILRDR----LWEIGLL 165
           VF TL +        D    SL   +  +  G   + PK  G++I + R    L E G +
Sbjct: 99  VFETLRKGANGYLLKDMEAESLINAIRSVHEGYAFIHPKVTGKLIQQLRRMTYLNETGAM 158

Query: 166 AAYQANMFKSYDVHW--GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           A       K   V +  G++  LT RE E L  ++EGK++  I   L IS  TV N+++S
Sbjct: 159 AEGHT---KEAGVKFVAGENNPLTRREAEVLRLMAEGKSNKMIGEYLFISEKTVKNHVSS 215

Query: 224 IMRKTATKTRSGAIAYAVR 242
           I++K     R+ A+  +++
Sbjct: 216 ILQKMEVDDRTQAVINSIK 234


>gi|312128575|ref|YP_003993449.1| LuxR family transcriptional regulator [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311778594|gb|ADQ08080.1| transcriptional regulator, LuxR family [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 68

 Score = 47.4 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/59 (44%), Positives = 36/59 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           +L+ RE E +  I+EG T+ EIAVIL IS  TV  Y+ +IM K    +R   IA+  +N
Sbjct: 5   KLSYREREIVKLIAEGMTNKEIAVILNISEKTVKTYVKNIMLKLEVDSRYKIIAWYYKN 63


>gi|296447080|ref|ZP_06889013.1| two component transcriptional regulator, LuxR family [Methylosinus
           trichosporium OB3b]
 gi|296255425|gb|EFH02519.1| two component transcriptional regulator, LuxR family [Methylosinus
           trichosporium OB3b]
          Length = 306

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 39/62 (62%), Gaps = 1/62 (1%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           GK F LT RE E ++WI+ GK++ +IA IL IS  TV+ ++  I  K    +RS A + A
Sbjct: 238 GK-FALTSREAEVVSWIARGKSNVDIAEILCISPRTVHKHLERIFIKLGVDSRSSATSVA 296

Query: 241 VR 242
           ++
Sbjct: 297 LQ 298


>gi|259046510|ref|ZP_05736911.1| DNA-binding response regulator [Granulicatella adiacens ATCC 49175]
 gi|259036675|gb|EEW37930.1| DNA-binding response regulator [Granulicatella adiacens ATCC 49175]
          Length = 211

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H+  D +LT RE+E L  I++GK++ EIA  L I+  TV  ++++I+ K   + R+ A  
Sbjct: 143 HFPHD-DLTQRELEVLLLIAQGKSNQEIADELFITLKTVKTHVSNILSKLEVEDRTQATI 201

Query: 239 YAVRNNIV 246
           YA ++ ++
Sbjct: 202 YAFKHQLI 209


>gi|312111451|ref|YP_003989767.1| LuxR family transcriptional regulator [Geobacillus sp. Y4.1MC1]
 gi|311216552|gb|ADP75156.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. Y4.1MC1]
          Length = 211

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 37/63 (58%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  L+ RE+     + EGKT+ EIA  L +S  TV N+I  I++K   + R+    YA++
Sbjct: 147 DIPLSPRELMIAKLVGEGKTNKEIAAELHLSIGTVKNHITQILQKLQLRDRTQLAIYAIK 206

Query: 243 NNI 245
           ++I
Sbjct: 207 HDI 209


>gi|86356299|ref|YP_468191.1| LuxR family transcriptional regulator [Rhizobium etli CFN 42]
 gi|86280401|gb|ABC89464.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CFN 42]
          Length = 248

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE+ CL    +G+ S+EIA  LG+S +TVN Y+ S   K  +  R  AIA A+R
Sbjct: 187 LSEREIACLQLAGDGRISEEIAEKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIR 243


>gi|172037280|ref|YP_001803781.1| two-component response regulator [Cyanothece sp. ATCC 51142]
 gi|171698734|gb|ACB51715.1| two-component response regulator [Cyanothece sp. ATCC 51142]
          Length = 247

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+E L  I EGK+++EIA  L +S NT+  ++  IM K A   R  A   A+R+ +
Sbjct: 187 LSERELEVLKLIVEGKSNNEIAEDLYLSTNTIKTHVRGIMNKLAVDDRVQAAVVALRSGL 246

Query: 246 V 246
           V
Sbjct: 247 V 247


>gi|66044947|ref|YP_234788.1| regulatory protein, LuxR [Pseudomonas syringae pv. syringae B728a]
 gi|63255654|gb|AAY36750.1| regulatory protein, LuxR [Pseudomonas syringae pv. syringae B728a]
          Length = 238

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 36/52 (69%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           ++F +T RE E   W + GKT +EIAVIL IS+ TV+ +I++++ K   +T+
Sbjct: 174 ENFTITDREKEVYIWTAIGKTCNEIAVILNISKRTVDFHISNVISKLGVRTK 225


>gi|312196500|ref|YP_004016561.1| LuxR family transcriptional regulator [Frankia sp. EuI1c]
 gi|311227836|gb|ADP80691.1| two component transcriptional regulator, LuxR family [Frankia sp.
           EuI1c]
          Length = 229

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 39/64 (60%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G+   LT RE E L  I++G+++ E+A I  +S NTV +YI ++ RK    +RS A+ + 
Sbjct: 151 GRGEGLTEREAEVLALITQGRSNAELAEITCLSPNTVKSYIRTLYRKIGVTSRSQAVLWG 210

Query: 241 VRNN 244
           V + 
Sbjct: 211 VNHG 214


>gi|189218591|ref|YP_001939232.1| LuxR family transcriptional regulator [Methylacidiphilum infernorum
           V4]
 gi|189185449|gb|ACD82634.1| Transcriptional regulator LuxR family [Methylacidiphilum infernorum
           V4]
          Length = 251

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L WI +GKT+ EI+ IL IS  TV  ++ +I  K   + R  A+A A    +
Sbjct: 189 LTARELEILKWIMDGKTNWEISCILKISEATVKFHLKNIFLKLDVQNRCQAVATAFHRRL 248

Query: 246 V 246
           +
Sbjct: 249 L 249


>gi|153004251|ref|YP_001378576.1| two component LuxR family transcriptional regulator
           [Anaeromyxobacter sp. Fw109-5]
 gi|152027824|gb|ABS25592.1| two component transcriptional regulator, LuxR family
           [Anaeromyxobacter sp. Fw109-5]
          Length = 212

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 44/84 (52%), Gaps = 3/84 (3%)

Query: 163 GLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIA 222
           G  AA + N   S     G+   LT RE E L  +++G ++ E+A  L IS  TV  + A
Sbjct: 130 GNAAAQERNTVVS---RGGRVTSLTQREREVLRLLAQGDSNREVAGQLSISAKTVETHRA 186

Query: 223 SIMRKTATKTRSGAIAYAVRNNIV 246
           ++MRK    +    + YA+RN IV
Sbjct: 187 NVMRKLGASSIVDLVHYAIRNGIV 210


>gi|260362858|ref|ZP_05775727.1| putative transcriptional regulator [Vibrio parahaemolyticus K5030]
 gi|260880146|ref|ZP_05892501.1| putative transcriptional regulator [Vibrio parahaemolyticus
           AN-5034]
 gi|260895263|ref|ZP_05903759.1| DNA-binding protein [Vibrio parahaemolyticus Peru-466]
 gi|308085787|gb|EFO35482.1| DNA-binding protein [Vibrio parahaemolyticus Peru-466]
 gi|308092058|gb|EFO41753.1| putative transcriptional regulator [Vibrio parahaemolyticus
           AN-5034]
 gi|308112231|gb|EFO49771.1| putative transcriptional regulator [Vibrio parahaemolyticus K5030]
          Length = 214

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (63%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + ELT RE++ L  + EG ++ EIA  L IS +T+ +++ +I RK   K R+ A ++A R
Sbjct: 153 EVELTRREIQVLKMLKEGGSNMEIADSLFISEHTIKSHLYNIFRKLEVKNRTQATSWAKR 212

Query: 243 N 243
           N
Sbjct: 213 N 213


>gi|218514696|ref|ZP_03511536.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli 8C-3]
          Length = 240

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE+ CL    +G+ S+EIA  LG+S +TVN Y+ S   K  +  R  AIA A+R
Sbjct: 179 LSEREIACLQLAGDGRISEEIAEKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIR 235


>gi|26988850|ref|NP_744275.1| LuxR family DNA-binding response regulator [Pseudomonas putida
           KT2440]
 gi|24983655|gb|AAN67739.1|AE016405_2 DNA-binding response regulator, LuxR family [Pseudomonas putida
           KT2440]
          Length = 219

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 38/66 (57%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G+   LT R++E L  I  GK++ EIA  LG+S  TV  + + IM++      +G + +A
Sbjct: 150 GERHNLTSRQLEILRLIVRGKSTREIAAGLGLSIKTVETHRSQIMKRLQIHDVAGLVLFA 209

Query: 241 VRNNIV 246
           VR  I+
Sbjct: 210 VREKII 215


>gi|15964401|ref|NP_384754.1| putative transcription regulator protein [Sinorhizobium meliloti
           1021]
 gi|307311543|ref|ZP_07591184.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
 gi|307318898|ref|ZP_07598329.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|3894103|emb|CAA11949.1| unnamed protein product [Sinorhizobium meliloti]
 gi|15073578|emb|CAC45220.1| Regulator of flagellar operons, LuxR family, probable forming a
           heterodimer with VisN [Sinorhizobium meliloti 1021]
 gi|306895312|gb|EFN26067.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306899560|gb|EFN30189.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
          Length = 246

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 43/79 (54%), Gaps = 8/79 (10%)

Query: 164 LLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           LLAA +  +FK+          L+ RE+ CL    +G  S+EIA  +G+S +TVN Y+ +
Sbjct: 171 LLAADEKRLFKAE--------ALSDREIACLQMAGDGHISEEIAEKMGLSVHTVNAYLGA 222

Query: 224 IMRKTATKTRSGAIAYAVR 242
              K  +  R  AIA A+R
Sbjct: 223 ATTKLDSVNRIQAIAKAIR 241


>gi|325264809|ref|ZP_08131538.1| DNA-binding response regulator, LuxR family [Clostridium sp. D5]
 gi|324030101|gb|EGB91387.1| DNA-binding response regulator, LuxR family [Clostridium sp. D5]
          Length = 198

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 39/69 (56%)

Query: 174 KSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           K  D+   K    T RE E   W+ +GK++ +IA IL +S +TV  ++++I      ++R
Sbjct: 117 KESDMKILKGHGFTEREAEVTYWLCQGKSNGDIAYILNLSVSTVKKHLSNIFDNMGVRSR 176

Query: 234 SGAIAYAVR 242
           S A+A A+ 
Sbjct: 177 SAAVALALE 185


>gi|293607167|ref|ZP_06689509.1| LuxR family sensory box transcriptional regulator [Achromobacter
           piechaudii ATCC 43553]
 gi|292814501|gb|EFF73640.1| LuxR family sensory box transcriptional regulator [Achromobacter
           piechaudii ATCC 43553]
          Length = 508

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 34/62 (54%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L  + +G   D IA  L +SRNTV N++A+I  K     RS AI +A    
Sbjct: 433 QLTTREREVLGLLCQGHDDDGIAKALKLSRNTVRNHVATIYSKIGVHRRSAAIVWARDRG 492

Query: 245 IV 246
           I 
Sbjct: 493 IT 494


>gi|261419001|ref|YP_003252683.1| LuxR family transcriptional regulator [Geobacillus sp. Y412MC61]
 gi|319765817|ref|YP_004131318.1| LuxR family transcriptional regulator [Geobacillus sp. Y412MC52]
 gi|261375458|gb|ACX78201.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. Y412MC61]
 gi|317110683|gb|ADU93175.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. Y412MC52]
          Length = 200

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           LT  E+  L  I+  KT+ EI   L IS+ TV ++++SI+RK   K+R+GA+  A R
Sbjct: 139 LTEMELAVLDLIARDKTNREIGEQLNISKRTVEHHVSSILRKLHVKSRAGAVGKAFR 195


>gi|330975157|gb|EGH75223.1| regulatory protein, LuxR [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 95

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 36/52 (69%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           ++F +T RE E   W + GKT +EIAVIL IS+ TV+ +I++++ K   +T+
Sbjct: 31  ENFTITDREKEVYIWTAIGKTCNEIAVILNISKRTVDFHISNVISKLGVRTK 82


>gi|228900120|ref|ZP_04064353.1| hypothetical protein bthur0014_13270 [Bacillus thuringiensis IBL
           4222]
 gi|228859526|gb|EEN03953.1| hypothetical protein bthur0014_13270 [Bacillus thuringiensis IBL
           4222]
          Length = 199

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K     R+ A+ YA R+ 
Sbjct: 137 ELTERESEILLLIAEGKSNQEIADELFIALKTVKTHVSNILNKLNVSDRTQAVIYAFRHQ 196

Query: 245 I 245
           +
Sbjct: 197 L 197


>gi|229074728|ref|ZP_04207749.1| hypothetical protein bcere0024_12850 [Bacillus cereus Rock4-18]
 gi|228708471|gb|EEL60623.1| hypothetical protein bcere0024_12850 [Bacillus cereus Rock4-18]
          Length = 199

 Score = 47.4 bits (111), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K     R+ A+ YA R+ 
Sbjct: 137 ELTERESEILLLIAEGKSNQEIADELFIALKTVKTHVSNILNKLNVSDRTQAVIYAFRHQ 196

Query: 245 I 245
           +
Sbjct: 197 L 197


>gi|213970237|ref|ZP_03398368.1| transcriptional activator of quorum sensing autoinducer synthesis
           transcription regulator protein [Pseudomonas syringae
           pv. tomato T1]
 gi|213925118|gb|EEB58682.1| transcriptional activator of quorum sensing autoinducer synthesis
           transcription regulator protein [Pseudomonas syringae
           pv. tomato T1]
          Length = 185

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 38/58 (65%), Gaps = 1/58 (1%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRK-TATKTRSGAIAYAV 241
           +L+ REVE L W+++GKT + I  +LG++  TV ++  +IM+K  AT   + A+  A+
Sbjct: 124 KLSTREVEVLKWVADGKTGEVIGKVLGVTERTVTHHTVNIMQKLNATNKTAAAVKAAL 181


>gi|298246526|ref|ZP_06970332.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
 gi|297554007|gb|EFH87872.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
          Length = 228

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 40/66 (60%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
            +  +LT RE+E LT ++ G+ + EIA  L IS  TV  ++A+I  K    +R+ A+A A
Sbjct: 158 AQRVDLTERELEVLTCVARGQRNKEIATYLSISEPTVKTHLANIYFKLQVDSRASAVAVA 217

Query: 241 VRNNIV 246
           ++  ++
Sbjct: 218 MKRGLL 223


>gi|86158419|ref|YP_465204.1| two component LuxR family transcriptional regulator
           [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85774930|gb|ABC81767.1| two component transcriptional regulator, LuxR family
           [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 218

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 54/104 (51%), Gaps = 13/104 (12%)

Query: 143 GLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKT 202
           G ++L P+   + R  + E G  A  +A+ ++S          LT RE + L  ++EG++
Sbjct: 124 GGLVLDPE---VARTAMEEAGPAAPGEADPYES----------LTDREKQVLKLVAEGRS 170

Query: 203 SDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + E+A +LGIS  T  ++   +M K     R+  + +A+R  ++
Sbjct: 171 NKEVADVLGISVKTAMSHREHVMEKLGVHNRTELVRFAIRKGVI 214


>gi|28901301|ref|NP_800956.1| LuxR family transcriptional regulator [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153835889|ref|ZP_01988556.1| DNA-binding HTH domain-containing protein [Vibrio parahaemolyticus
           AQ3810]
 gi|260900615|ref|ZP_05909010.1| putative transcriptional regulator [Vibrio parahaemolyticus AQ4037]
 gi|28809814|dbj|BAC62789.1| putative transcriptional regulator, LuxR family [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149750643|gb|EDM61388.1| DNA-binding HTH domain-containing protein [Vibrio parahaemolyticus
           AQ3810]
 gi|308106917|gb|EFO44457.1| putative transcriptional regulator [Vibrio parahaemolyticus AQ4037]
 gi|328469239|gb|EGF40185.1| LuxR family transcriptional regulator [Vibrio parahaemolyticus
           10329]
          Length = 218

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (63%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + ELT RE++ L  + EG ++ EIA  L IS +T+ +++ +I RK   K R+ A ++A R
Sbjct: 157 EVELTRREIQVLKMLKEGGSNMEIADSLFISEHTIKSHLYNIFRKLEVKNRTQATSWAKR 216

Query: 243 N 243
           N
Sbjct: 217 N 217


>gi|254442908|ref|ZP_05056384.1| transcriptional regulator, LuxR family protein [Verrucomicrobiae
           bacterium DG1235]
 gi|198257216|gb|EDY81524.1| transcriptional regulator, LuxR family protein [Verrucomicrobiae
           bacterium DG1235]
          Length = 200

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 44/76 (57%)

Query: 171 NMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTAT 230
           ++ +S D    +   LT RE E LT+I+ G ++ +IA+ LG+S  T++N+  S+MRK   
Sbjct: 119 SVVRSIDRSSERTDNLTAREREVLTFIASGNSNKDIALKLGLSVKTIDNHRCSMMRKLDL 178

Query: 231 KTRSGAIAYAVRNNIV 246
              +    YAV + IV
Sbjct: 179 HNVADITRYAVEHRIV 194


>gi|148548821|ref|YP_001268923.1| two component LuxR family transcriptional regulator [Pseudomonas
           putida F1]
 gi|148512879|gb|ABQ79739.1| two component transcriptional regulator, LuxR family [Pseudomonas
           putida F1]
          Length = 219

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 38/66 (57%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G+   LT R++E L  I  GK++ EIA  LG+S  TV  + + IM++      +G + +A
Sbjct: 150 GERHNLTSRQLEILRLIVRGKSTREIAAGLGLSIKTVETHRSQIMKRLQIHDVAGLVLFA 209

Query: 241 VRNNIV 246
           VR  I+
Sbjct: 210 VREKII 215


>gi|330973646|gb|EGH73712.1| regulatory protein, LuxR [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 237

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 36/52 (69%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           ++F +T RE E   W + GKT +EIAVIL IS+ TV+ +I++++ K   +T+
Sbjct: 173 ENFTITDREKEVYIWTAIGKTCNEIAVILNISKRTVDFHISNVISKLGVRTK 224


>gi|238786137|ref|ZP_04630091.1| Transcriptional activator protein echR [Yersinia bercovieri ATCC
           43970]
 gi|238712965|gb|EEQ05023.1| Transcriptional activator protein echR [Yersinia bercovieri ATCC
           43970]
          Length = 245

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 66/145 (45%), Gaps = 13/145 (8%)

Query: 99  YNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDR 158
           YN++   T +     H +          D+ Y   + ++ + +I ++L+    +      
Sbjct: 104 YNIINGYTFVLHDNNHNMATLNISNGNDDSIYFDESIEINKEKIQMLLILTHDK------ 157

Query: 159 LWEIGLLAAYQANMFKSYDV-HWGKDFEL-TGREVECLTWISEGKTSDEIAVILGISRNT 216
                +L  YQ N  ++ ++     + E+ + RE E L W S GKT  EIA+ILGI R+T
Sbjct: 158 -----MLGLYQKNNNENKELGRSAAEREIFSPRENEILYWASVGKTYSEIAIILGIKRST 212

Query: 217 VNNYIASIMRKTATKTRSGAIAYAV 241
           V  +I +++RK        AI   +
Sbjct: 213 VKFHIGNVVRKLGVLNAKHAIRLGI 237


>gi|271965882|ref|YP_003340078.1| response regulator receiver protein [Streptosporangium roseum DSM
           43021]
 gi|270509057|gb|ACZ87335.1| response regulator receiver protein [Streptosporangium roseum DSM
           43021]
          Length = 219

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  I++G ++ EIA  L IS+ TV  Y++ I+ K   + R  A+ YA R  +
Sbjct: 158 LTPRELEVLRLIADGLSNSEIAATLVISQETVKTYVSRILTKLDLRDRVQAVVYAYRRGL 217

Query: 246 V 246
           V
Sbjct: 218 V 218


>gi|237808386|ref|YP_002892826.1| two component transcriptional regulator, LuxR family [Tolumonas
           auensis DSM 9187]
 gi|237500647|gb|ACQ93240.1| two component transcriptional regulator, LuxR family [Tolumonas
           auensis DSM 9187]
          Length = 298

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (60%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           ++  LT RE + L W+S GKT+ EIA IL +S  TVN ++  I +K     R+ A + ++
Sbjct: 235 RELNLTKRESQVLYWLSFGKTNWEIATILEMSPRTVNKHLEQIYKKLNVDNRTAAASISL 294

Query: 242 R 242
           R
Sbjct: 295 R 295


>gi|307151762|ref|YP_003887146.1| LuxR family two component transcriptional regulator [Cyanothece sp.
           PCC 7822]
 gi|306981990|gb|ADN13871.1| two component transcriptional regulator, LuxR family [Cyanothece
           sp. PCC 7822]
          Length = 210

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+E L  I EGK+++EIA  L +S NT+  ++  IM K A   R  A   A+R+ +
Sbjct: 150 LSERELEVLKLIVEGKSNNEIAEELYLSTNTIKTHVRGIMNKLAVDDRVQAAVVALRSGL 209

Query: 246 V 246
           V
Sbjct: 210 V 210


>gi|4928929|gb|AAD33777.1|AF139177_4 putative two component response regulator [Streptomyces lividans]
          Length = 199

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 33/57 (57%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           G +  LT RE+  LT  S+G    EIA  L +SR TV NY+A+ +RK   + R  AI
Sbjct: 134 GAEMPLTTRELGVLTLASQGAPIAEIAARLHLSRGTVRNYMATAVRKVGARNRVDAI 190


>gi|224552975|gb|ACN54736.1| PagR [Pantoea agglomerans]
          Length = 210

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           H  K+  L+ RE + L W+  GKT  E+AVIL I+  TV  ++ ++M+K      + A+
Sbjct: 141 HQKKNVFLSPRECQILKWVGAGKTYAEVAVILSIAERTVKFHMGNVMKKLGVNNATHAV 199


>gi|197122287|ref|YP_002134238.1| LuxR family transcriptional regulator [Anaeromyxobacter sp. K]
 gi|220917070|ref|YP_002492374.1| two component transcriptional regulator, LuxR family
           [Anaeromyxobacter dehalogenans 2CP-1]
 gi|196172136|gb|ACG73109.1| two component transcriptional regulator, LuxR family
           [Anaeromyxobacter sp. K]
 gi|219954924|gb|ACL65308.1| two component transcriptional regulator, LuxR family
           [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 218

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 54/104 (51%), Gaps = 13/104 (12%)

Query: 143 GLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKT 202
           G ++L P+   + R  + E G  A  +A+ ++S          LT RE + L  ++EG++
Sbjct: 124 GGLVLDPE---VARTAMEEAGPAAPGEADPYES----------LTDREKQVLKLVAEGRS 170

Query: 203 SDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + E+A +LGIS  T  ++   +M K     R+  + +A+R  ++
Sbjct: 171 NKEVADVLGISVKTAMSHREHVMEKLGVHNRTELVRFAIRKGVI 214


>gi|325570549|ref|ZP_08146275.1| transcriptional regulatory protein DegU [Enterococcus casseliflavus
           ATCC 12755]
 gi|325156395|gb|EGC68575.1| transcriptional regulatory protein DegU [Enterococcus casseliflavus
           ATCC 12755]
          Length = 202

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 166 AAYQANMFKSYDVHWGKDFELTGR-EVECLTWISEGKTSDEIAVILGISRNTVNNYIASI 224
             Y  N      +   KD  L    E + L  IS+ +T+++IA  L ISR TV N+++SI
Sbjct: 120 TVYHGNKVSPEHLFLEKDMRLLSEIERQVLELISQEQTNEKIAKKLFISRRTVENHVSSI 179

Query: 225 MRKTATKTRSGAIAYAVRNNIV 246
             K   +TR GA+   ++ N++
Sbjct: 180 CNKLNVQTRIGAVREGIKLNLI 201


>gi|289679330|ref|ZP_06500220.1| regulatory protein, LuxR [Pseudomonas syringae pv. syringae FF5]
 gi|330901245|gb|EGH32664.1| regulatory protein, LuxR [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 237

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 36/52 (69%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
           ++F +T RE E   W + GKT +EIAVIL IS+ TV+ +I++++ K   +T+
Sbjct: 173 ENFTITDREKEVYIWTAIGKTCNEIAVILNISKRTVDFHISNVISKLGVRTK 224


>gi|167589289|ref|ZP_02381677.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia ubonensis Bu]
          Length = 229

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 35/56 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT REVE L W ++GKTS EI+ IL IS +TVN ++ + + K     ++ A+  A 
Sbjct: 168 LTDREVEVLKWAADGKTSGEISTILVISVDTVNFHVKNAVSKLKAANKTSAVVRAT 223


>gi|256392814|ref|YP_003114378.1| LuxR family transcriptional regulator [Catenulispora acidiphila DSM
           44928]
 gi|256359040|gb|ACU72537.1| transcriptional regulator, LuxR family [Catenulispora acidiphila
           DSM 44928]
          Length = 525

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REV+ L  ++ G ++ EIA  L ISR TV++++  I  KT T  R+ A  YAVR+ +
Sbjct: 462 LTRREVQVLRLLARGLSNGEIAEQLVISRKTVSHHVEHIYAKTGTANRAMAGLYAVRHGL 521

Query: 246 V 246
           +
Sbjct: 522 M 522


>gi|228932822|ref|ZP_04095692.1| hypothetical protein bthur0009_12960 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228945136|ref|ZP_04107496.1| hypothetical protein bthur0007_13010 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|229010843|ref|ZP_04168040.1| hypothetical protein bmyco0001_12980 [Bacillus mycoides DSM 2048]
 gi|229016795|ref|ZP_04173725.1| hypothetical protein bcere0030_13630 [Bacillus cereus AH1273]
 gi|229023000|ref|ZP_04179517.1| hypothetical protein bcere0029_13450 [Bacillus cereus AH1272]
 gi|229058174|ref|ZP_04196563.1| hypothetical protein bcere0026_12890 [Bacillus cereus AH603]
 gi|229090494|ref|ZP_04221732.1| hypothetical protein bcere0021_13200 [Bacillus cereus Rock3-42]
 gi|229096030|ref|ZP_04227005.1| hypothetical protein bcere0020_12790 [Bacillus cereus Rock3-29]
 gi|229102142|ref|ZP_04232853.1| hypothetical protein bcere0019_13050 [Bacillus cereus Rock3-28]
 gi|229114984|ref|ZP_04244396.1| hypothetical protein bcere0017_12800 [Bacillus cereus Rock1-3]
 gi|229132346|ref|ZP_04261200.1| hypothetical protein bcere0014_12820 [Bacillus cereus BDRD-ST196]
 gi|229160490|ref|ZP_04288485.1| hypothetical protein bcere0009_12820 [Bacillus cereus R309803]
 gi|229166381|ref|ZP_04294138.1| hypothetical protein bcere0007_13540 [Bacillus cereus AH621]
 gi|228617123|gb|EEK74191.1| hypothetical protein bcere0007_13540 [Bacillus cereus AH621]
 gi|228622900|gb|EEK79731.1| hypothetical protein bcere0009_12820 [Bacillus cereus R309803]
 gi|228651052|gb|EEL07033.1| hypothetical protein bcere0014_12820 [Bacillus cereus BDRD-ST196]
 gi|228668496|gb|EEL23926.1| hypothetical protein bcere0017_12800 [Bacillus cereus Rock1-3]
 gi|228681342|gb|EEL35508.1| hypothetical protein bcere0019_13050 [Bacillus cereus Rock3-28]
 gi|228687415|gb|EEL41318.1| hypothetical protein bcere0020_12790 [Bacillus cereus Rock3-29]
 gi|228692844|gb|EEL46565.1| hypothetical protein bcere0021_13200 [Bacillus cereus Rock3-42]
 gi|228720139|gb|EEL71721.1| hypothetical protein bcere0026_12890 [Bacillus cereus AH603]
 gi|228738306|gb|EEL88785.1| hypothetical protein bcere0029_13450 [Bacillus cereus AH1272]
 gi|228744531|gb|EEL94603.1| hypothetical protein bcere0030_13630 [Bacillus cereus AH1273]
 gi|228750517|gb|EEM00346.1| hypothetical protein bmyco0001_12980 [Bacillus mycoides DSM 2048]
 gi|228814580|gb|EEM60841.1| hypothetical protein bthur0007_13010 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228826872|gb|EEM72636.1| hypothetical protein bthur0009_12960 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
          Length = 196

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K     R+ A+ YA R+ 
Sbjct: 134 ELTERESEILLLIAEGKSNQEIADELFIALKTVKTHVSNILNKLNVSDRTQAVIYAFRHQ 193

Query: 245 I 245
           +
Sbjct: 194 L 194


>gi|297489|emb|CAA68561.1| luxR [Aliivibrio fischeri]
          Length = 250

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (59%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +LT RE ECL W  EGK+S +I+ ILG S  TV  ++ +   K  T  R  +I+ A+
Sbjct: 182 DLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAI 238


>gi|158312391|ref|YP_001504899.1| two component LuxR family transcriptional regulator [Frankia sp.
           EAN1pec]
 gi|158107796|gb|ABW09993.1| two component transcriptional regulator, LuxR family [Frankia sp.
           EAN1pec]
          Length = 219

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 37/62 (59%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L  ++EG+++ EIA +L +S  TV  ++  I+ K   + R+ A+ +A R  
Sbjct: 151 QLTDREAEVLRALAEGRSNTEIAAVLNLSVETVRTHVKRILSKLGVRDRTQAVVWAYRAG 210

Query: 245 IV 246
            V
Sbjct: 211 FV 212


>gi|324326299|gb|ADY21559.1| response regulator [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 216

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 37/58 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           LT RE E L  I++G+++ EIA +L I+  TV  ++++I+ K     R+ A  YAV++
Sbjct: 151 LTKREQEVLREIAKGRSNKEIAAVLHITEQTVKTHVSNILAKLEVDDRTQAALYAVKH 208


>gi|239833383|ref|ZP_04681711.1| two component LuxR family transcriptional regulator [Ochrobactrum
           intermedium LMG 3301]
 gi|239821446|gb|EEQ93015.1| two component LuxR family transcriptional regulator [Ochrobactrum
           intermedium LMG 3301]
          Length = 233

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 40/66 (60%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G+   L+ RE E L  I  G+ + EIA  LG+S +TV++Y+ +I +K +  +R+ A   A
Sbjct: 165 GEFIHLSRRETEVLKEIGTGQRNGEIARKLGLSEHTVSDYVKAIYQKLSVSSRAEATREA 224

Query: 241 VRNNIV 246
           +R  +V
Sbjct: 225 IRRGLV 230


>gi|312623477|ref|YP_004025090.1| two component transcriptional regulator, luxr family
           [Caldicellulosiruptor kronotskyensis 2002]
 gi|312203944|gb|ADQ47271.1| two component transcriptional regulator, LuxR family
           [Caldicellulosiruptor kronotskyensis 2002]
          Length = 211

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 165 LAAYQANMFK-SYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           +A Y +++ K +   ++ K   LT RE+E    IS+G ++ EIA +L IS  TV NYI S
Sbjct: 130 IALYISDVLKRTSKQYFEKTQNLTERELEIAKLISQGYSNKEIARMLFISEGTVRNYITS 189

Query: 224 IMRKTATKTRSGAIAY 239
           I++K   K R+    Y
Sbjct: 190 ILQKLNLKNRTQIAVY 205


>gi|33866798|ref|NP_898357.1| transcriptional regulator [Synechococcus sp. WH 8102]
 gi|33639399|emb|CAE08783.1| possible transcriptional regulator [Synechococcus sp. WH 8102]
          Length = 91

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 40/61 (65%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +  L+ RE+E +  ++EG T+ EIA  L IS+ TV+N+++++  KT +K R   + +A+ 
Sbjct: 11  NISLSAREIEIIELVAEGLTNQEIADRLTISKRTVDNHVSNVFTKTGSKNRVALLNWAMD 70

Query: 243 N 243
           N
Sbjct: 71  N 71


>gi|264677605|ref|YP_003277511.1| two component transcriptional regulator, LuxR [Comamonas
           testosteroni CNB-2]
 gi|262208117|gb|ACY32215.1| two component transcriptional regulator, LuxR [Comamonas
           testosteroni CNB-2]
          Length = 195

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L  I++GK + EI   + IS  TV+ ++ +I RK   +TR+ A+ YAV   
Sbjct: 134 KLTDREKEVLRLIAQGKRTHEIGDYMEISALTVSTHVKNIYRKMQVRTRAQAVRYAVLKG 193

Query: 245 IV 246
           I+
Sbjct: 194 II 195


>gi|260437679|ref|ZP_05791495.1| transcriptional regulatory protein DegU [Butyrivibrio crossotus DSM
           2876]
 gi|292809905|gb|EFF69110.1| transcriptional regulatory protein DegU [Butyrivibrio crossotus DSM
           2876]
          Length = 218

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           LT RE+E L  IS+G  + +I+  L I+  TV N+++SI RK     R+ A  +AV+N
Sbjct: 151 LTKREIEVLLLISKGYVNKDISNELKITERTVKNHVSSIFRKINVNDRTQAAVFAVKN 208


>gi|256783866|ref|ZP_05522297.1| two-component system response regulator [Streptomyces lividans
           TK24]
          Length = 194

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 33/57 (57%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           G +  LT RE+  LT  S+G    EIA  L +SR TV NY+A+ +RK   + R  AI
Sbjct: 129 GAEMPLTTRELGVLTLASQGAPIAEIAARLHLSRGTVRNYMATAVRKVGARNRVDAI 185


>gi|312172015|emb|CBX80272.1| Transcriptional activator protein ExpR [Erwinia amylovora ATCC
           BAA-2158]
          Length = 240

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 34/53 (64%)

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           RE+E L W +EGKTS EI++IL IS+NTVN +   + ++     ++   +YA 
Sbjct: 183 RELEILKWTAEGKTSAEISLILSISQNTVNFHQKKMQKRFNAPNKTQIASYAA 235


>gi|298250569|ref|ZP_06974373.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
 gi|297548573|gb|EFH82440.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
          Length = 222

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 36/62 (58%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  ++ G+ S EIA  LGIS  TV +++ SI  K    +R+ A+A  +   
Sbjct: 159 ELTERECEVLEAVARGERSKEIASRLGISLRTVGSHLTSIYSKLGVDSRASAVATGIERG 218

Query: 245 IV 246
           ++
Sbjct: 219 LL 220


>gi|59714108|ref|YP_206883.1| autoinducer-binding transcriptional activator protein LuxR [Vibrio
           fischeri ES114]
 gi|462557|sp|P35327|LUXS_VIBF1 RecName: Full=Transcriptional activator protein luxR
 gi|295436|gb|AAA27542.1| putative [Vibrio fischeri ES114]
 gi|59482356|gb|AAW87995.1| autoinducer-binding transcriptional activator protein LuxR [Vibrio
           fischeri ES114]
          Length = 250

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           D  LT RE ECL W SEGK++ +I+ ILG S  TV  ++ +   K  T  R  +I+ A+
Sbjct: 180 DSILTKREKECLAWASEGKSTWDISKILGCSERTVTFHLTNTQMKLNTTNRCQSISKAI 238


>gi|317129617|ref|YP_004095899.1| LuxR family transcriptional regulator [Bacillus cellulosilyticus
           DSM 2522]
 gi|315474565|gb|ADU31168.1| two component transcriptional regulator, LuxR family [Bacillus
           cellulosilyticus DSM 2522]
          Length = 207

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 36/64 (56%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           K  ELT RE E L  I +GKT+ +IA  L I   TV  +++ I+ K   + R+ A  YA 
Sbjct: 143 KHEELTNREREVLALIGQGKTNKDIAETLHIGIKTVKTHVSHILSKLEVEDRTQAAIYAN 202

Query: 242 RNNI 245
           +N +
Sbjct: 203 KNKL 206


>gi|197337087|ref|YP_002158591.1| transcriptional activator protein LuxR [Vibrio fischeri MJ11]
 gi|197314339|gb|ACH63788.1| transcriptional activator protein LuxR [Vibrio fischeri MJ11]
          Length = 252

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (59%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +LT RE ECL W  EGK+S +I+ ILG S  TV  ++ +   K  T  R  +I+ A+
Sbjct: 184 DLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAI 240


>gi|158339385|ref|YP_001520562.1| two component LuxR family transcriptional regulator [Acaryochloris
           marina MBIC11017]
 gi|158309626|gb|ABW31243.1| two component transcriptional regulator, LuxR family [Acaryochloris
           marina MBIC11017]
          Length = 208

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D +LT RE+E L  +S+G ++ EIA  L IS  TV  +I +I+ K   K R+ A+  A++
Sbjct: 142 DSDLTERELEVLQLLSKGNSNQEIAAALTISEGTVKFHINNILSKLGVKDRTQAVIMALK 201

Query: 243 NNI 245
             +
Sbjct: 202 KGL 204


>gi|462556|sp|P12746|LUXR_VIBFI RecName: Full=Transcriptional activator protein luxR
 gi|5726578|gb|AAD48473.1|AF170104_1 regulatory protein LuxR [Aliivibrio fischeri]
 gi|155231|gb|AAA27540.1| luxR protein [Aliivibrio fischeri]
 gi|59800242|gb|AAX07424.1| LuxR [Expression vector pLuxR-wt]
 gi|59800247|gb|AAX07428.1| LuxR-mut [Expression vector pHTSUB-105]
 gi|60594754|gb|AAX29978.1| LuxR [Cloning vector pHTSUB-106]
          Length = 250

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (59%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +LT RE ECL W  EGK+S +I+ ILG S  TV  ++ +   K  T  R  +I+ A+
Sbjct: 182 DLTKREKECLAWACEGKSSWDISKILGCSERTVTFHLTNAQMKLNTTNRCQSISKAI 238


>gi|239831035|ref|ZP_04679364.1| Transcriptional activator protein solR [Ochrobactrum intermedium
           LMG 3301]
 gi|239823302|gb|EEQ94870.1| Transcriptional activator protein solR [Ochrobactrum intermedium
           LMG 3301]
          Length = 238

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           +  LT RE E L W SEGKT++ I  IL IS  TVN +I++++ K     +  A+A A
Sbjct: 175 EVNLTMREREILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKA 232


>gi|166364716|ref|YP_001656989.1| two-component response regulator [Microcystis aeruginosa NIES-843]
 gi|159030578|emb|CAO88241.1| luxR [Microcystis aeruginosa PCC 7806]
 gi|166087089|dbj|BAG01797.1| two-component response regulator [Microcystis aeruginosa NIES-843]
          Length = 210

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+E L  I EGK++ EIA  L +S NT+  ++  IM K A   R  A   A+R+ I
Sbjct: 150 LSEREMEVLKLIVEGKSNAEIAEQLYLSTNTIKTHVRGIMNKLAVDDRVQAAVIALRSGI 209

Query: 246 V 246
           V
Sbjct: 210 V 210


>gi|289767748|ref|ZP_06527126.1| two-component system response regulator [Streptomyces lividans
           TK24]
 gi|289697947|gb|EFD65376.1| two-component system response regulator [Streptomyces lividans
           TK24]
          Length = 202

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 33/57 (57%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           G +  LT RE+  LT  S+G    EIA  L +SR TV NY+A+ +RK   + R  AI
Sbjct: 137 GAEMPLTTRELGVLTLASQGAPIAEIAARLHLSRGTVRNYMATAVRKVGARNRVDAI 193


>gi|311898779|dbj|BAJ31187.1| putative two-component system response regulator [Kitasatospora
           setae KM-6054]
          Length = 234

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  I+ G ++ EIA  L +S  TV  +I ++  KTA + R+ A+AYA R+ I
Sbjct: 171 LTQREAEVLALIAAGLSNAEIAERLFVSPATVKTHINNLFAKTAVRDRAQAVAYAFRHGI 230


>gi|169796310|ref|YP_001714103.1| putative two-component response regulator protein [Acinetobacter
           baumannii AYE]
 gi|213156954|ref|YP_002318999.1| two component transcriptional regulator, LuxR family [Acinetobacter
           baumannii AB0057]
 gi|215483769|ref|YP_002325994.1| response regulator [Acinetobacter baumannii AB307-0294]
 gi|301344835|ref|ZP_07225576.1| response regulator [Acinetobacter baumannii AB056]
 gi|301513697|ref|ZP_07238934.1| response regulator [Acinetobacter baumannii AB058]
 gi|301596924|ref|ZP_07241932.1| response regulator [Acinetobacter baumannii AB059]
 gi|332851608|ref|ZP_08433557.1| response regulator receiver domain protein [Acinetobacter baumannii
           6013150]
 gi|332866495|ref|ZP_08437037.1| response regulator receiver domain protein [Acinetobacter baumannii
           6013113]
 gi|169149237|emb|CAM87119.1| putative two-component response regulator protein [Acinetobacter
           baumannii AYE]
 gi|213056114|gb|ACJ41016.1| two component transcriptional regulator, LuxR family [Acinetobacter
           baumannii AB0057]
 gi|213988921|gb|ACJ59220.1| response regulator [Acinetobacter baumannii AB307-0294]
 gi|332729836|gb|EGJ61170.1| response regulator receiver domain protein [Acinetobacter baumannii
           6013150]
 gi|332734574|gb|EGJ65683.1| response regulator receiver domain protein [Acinetobacter baumannii
           6013113]
          Length = 319

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 34/55 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           +LT RE E + W+  GKT+ +IA IL +S  TVN ++  +  K   + R+ A+A+
Sbjct: 256 QLTQREAEVMHWLLLGKTNKDIAEILELSPRTVNKHLEHVFEKLCVENRTAAVAH 310


>gi|117620077|ref|YP_855658.1| transcriptional activator protein AhyR/asaR [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117561484|gb|ABK38432.1| transcriptional activator protein AhyR/asaR [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 264

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+E   W +EGK   +IA ILGI+  TV  ++ +++ K    ++S AI++A++  +
Sbjct: 188 LSLRELEVCRWAAEGKQVSDIAQILGITPRTVTFHLNNVVSKLGASSKSQAISWALKQGM 247

Query: 246 V 246
           V
Sbjct: 248 V 248


>gi|315646683|ref|ZP_07899799.1| two-component response regulator yhcZ [Paenibacillus vortex V453]
 gi|315277889|gb|EFU41212.1| two-component response regulator yhcZ [Paenibacillus vortex V453]
          Length = 213

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 35/59 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           LT RE   L  I+ G+++ EIAV L I+  TV  +I  I+ K   + R+ A  YA+RN+
Sbjct: 151 LTKREQHVLEQITMGRSNKEIAVELHITEKTVKTHITHILGKMEVQDRTQAALYAIRNH 209


>gi|222149994|ref|YP_002550951.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
 gi|221736976|gb|ACM37939.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
          Length = 251

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE+ CL    +G+ S+EIA  LG+S +TVN Y+ S   K  +  R  AIA A+R
Sbjct: 190 LSDREIACLQLAGDGRISEEIAENLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIR 246


>gi|317127430|ref|YP_004093712.1| LuxR family transcriptional regulator [Bacillus cellulosilyticus
           DSM 2522]
 gi|315472378|gb|ADU28981.1| two component transcriptional regulator, LuxR family [Bacillus
           cellulosilyticus DSM 2522]
          Length = 211

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 41/64 (64%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  LT RE++ +  I EG+++ EIA+ L +S  TV N+I+ I+ K   + R+    YA++
Sbjct: 148 DPSLTPRELDIIRKIGEGRSNKEIAMQLSLSVGTVKNHISIILDKLELRDRTQIAIYAIK 207

Query: 243 NNIV 246
           +++V
Sbjct: 208 HHVV 211


>gi|70726115|ref|YP_253029.1| hypothetical protein SH1114 [Staphylococcus haemolyticus JCSC1435]
 gi|68446839|dbj|BAE04423.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 207

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 37/62 (59%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +L+ RE+E L  + +GKT+ EIA  L +S  T+  +++ I  K +   R+ A  YA+ N 
Sbjct: 146 KLSKREIEVLAEMVKGKTNKEIANTLFVSEKTIKTHVSHIFNKLSVTDRTQAAIYAIENK 205

Query: 245 IV 246
           +V
Sbjct: 206 LV 207


>gi|9297032|sp|O30919|SOLR2_RALSO RecName: Full=Transcriptional activator protein solR
 gi|2444467|gb|AAC45947.1| SolR [Ralstonia solanacearum]
          Length = 236

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W  EGKT+ EI  IL IS  TVN ++ +++ K A   +  A+  A+   +
Sbjct: 176 LTTREREVLCWTGEGKTAYEIGQILRISERTVNFHVNNVLLKLAATNKVQAVVKAIATGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|260550575|ref|ZP_05824784.1| response regulator [Acinetobacter sp. RUH2624]
 gi|260406286|gb|EEW99769.1| response regulator [Acinetobacter sp. RUH2624]
          Length = 319

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 34/55 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           +LT RE E + W+  GKT+ +IA IL +S  TVN ++  +  K   + R+ A+A+
Sbjct: 256 QLTQREAEVMHWLLLGKTNKDIAEILELSPRTVNKHLEHVFEKLCVENRTAAVAH 310


>gi|219668814|ref|YP_002459249.1| LuxR family transcriptional regulator [Desulfitobacterium hafniense
           DCB-2]
 gi|219539074|gb|ACL20813.1| two component transcriptional regulator, LuxR family
           [Desulfitobacterium hafniense DCB-2]
          Length = 212

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE++ LT++ +G ++ EI   L IS  TV N+++SI RK A + R+ A   AV+  +
Sbjct: 149 LSDRELQILTYVVKGSSNREIGQALFISEKTVKNHLSSIFRKLAVEDRTQAALKAVKLKL 208

Query: 246 V 246
           V
Sbjct: 209 V 209


>gi|76819232|ref|YP_337020.1| ATP-dependent transcriptional regulator LuxR [Burkholderia
           pseudomallei 1710b]
 gi|76583705|gb|ABA53179.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1710b]
          Length = 394

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L W   GKT+ EI+ ILGIS  TV  ++++  RK     R+ A+  A    
Sbjct: 333 DLTARERESLQWAGRGKTAWEISKILGISERTVVFHLSNAARKIGANNRAQAVVIASARG 392

Query: 245 IV 246
           ++
Sbjct: 393 LI 394


>gi|75674825|ref|YP_317246.1| LuxR family transcriptional regulator [Nitrobacter winogradskyi
           Nb-255]
 gi|74419695|gb|ABA03894.1| Transcriptional regulatory protein, LuxR family [Nitrobacter
           winogradskyi Nb-255]
          Length = 241

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 52/95 (54%), Gaps = 8/95 (8%)

Query: 154 ILRDRLWEIGLLAAYQA--NMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILG 211
           ILR +L  I + A  +A    +K   V+      LT RE++ L W++EGK+  EI+VIL 
Sbjct: 152 ILRGQLQLIAMYAFARALGQKYKPAPVN------LTPREMDILQWMAEGKSDWEISVILK 205

Query: 212 ISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +S + V+     +  K     R+  +A A+R+N++
Sbjct: 206 VSEHLVDKIARQLRAKLNATNRTQTVAVALRHNLI 240


>gi|46199289|ref|YP_004956.1| transcriptional regulatory protein [Thermus thermophilus HB27]
 gi|55981321|ref|YP_144618.1| response regulator [Thermus thermophilus HB8]
 gi|46196914|gb|AAS81329.1| transcriptional regulatory protein [Thermus thermophilus HB27]
 gi|55772734|dbj|BAD71175.1| response regulator [Thermus thermophilus HB8]
          Length = 215

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 36/62 (58%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EL+ REV+ L  +++G T+ EIA  L +S  TV N ++ I +K     R+ A  YA+R  
Sbjct: 150 ELSEREVQILRLVAQGYTNQEIAAELQLSEKTVRNRLSEIFQKLHLNNRTQAALYAIREG 209

Query: 245 IV 246
           + 
Sbjct: 210 LA 211


>gi|32141311|ref|NP_733711.1| two-component system response regulator [Streptomyces coelicolor
           A3(2)]
 gi|432994|gb|AAA21390.1| potential response regulator for aerial mycelium production
           [Streptomyces coelicolor A3(2)]
 gi|24413915|emb|CAD55386.1| putative two-component system response regulator [Streptomyces
           coelicolor A3(2)]
          Length = 202

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 33/57 (57%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           G +  LT RE+  LT  S+G    EIA  L +SR TV NY+A+ +RK   + R  AI
Sbjct: 137 GAEMPLTTRELGVLTLASQGAPIAEIAARLHLSRGTVRNYMATAVRKVGARNRVDAI 193


>gi|325277395|ref|ZP_08143015.1| LuxR family transcriptional regulator [Pseudomonas sp. TJI-51]
 gi|324097468|gb|EGB95694.1| LuxR family transcriptional regulator [Pseudomonas sp. TJI-51]
          Length = 242

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 64/151 (42%), Gaps = 16/151 (10%)

Query: 94  EKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRI 153
           EK + Y V++RP        H L   +  P G++    +++   ARI        P+ R+
Sbjct: 101 EKGERYRVVRRPAGAG---VHGLQLPVFGPQGLEG---AMSLGGARIDSS-----PEARL 149

Query: 154 ILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGIS 213
           +L      +   AA+                +L+ RE E L W + G    +IA  LG+S
Sbjct: 150 ML-----AMVATAAFHTARRLLQPPLAASATQLSAREREVLRWTAAGSRQADIAATLGLS 204

Query: 214 RNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
             TV N++ +  R+    T + AI  A+ N 
Sbjct: 205 ERTVENHLRAARRRLGVATTAQAIKIALHNG 235


>gi|260555377|ref|ZP_05827598.1| response regulator [Acinetobacter baumannii ATCC 19606]
 gi|260411919|gb|EEX05216.1| response regulator [Acinetobacter baumannii ATCC 19606]
          Length = 319

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 34/55 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           +LT RE E + W+  GKT+ +IA IL +S  TVN ++  +  K   + R+ A+A+
Sbjct: 256 QLTQREAEVMHWLLLGKTNKDIAEILELSPRTVNKHLEHVFEKLCVENRTAAVAH 310


>gi|254819425|ref|ZP_05224426.1| two-component system response regulator [Mycobacterium
           intracellulare ATCC 13950]
          Length = 218

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (59%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE++ LT I +G ++ EIA  L IS  TV ++I  I  K   + R+ AI YA  N 
Sbjct: 154 ELTTRELDVLTLIGQGLSNTEIAGKLCISGVTVKSHIGRIFGKLDLRDRAAAIVYAYDNG 213

Query: 245 IV 246
           IV
Sbjct: 214 IV 215


>gi|218515979|ref|ZP_03512819.1| probable two-component response regulator protein [Rhizobium etli
           8C-3]
          Length = 209

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (57%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           F LT RE E L WI++GK + +I  ILG+S  TVN ++  I  K   + R+ A   A
Sbjct: 146 FSLTQRESEVLLWIAKGKPNRDIGEILGLSARTVNKHLEQIYVKLGVENRASAAVKA 202


>gi|299770580|ref|YP_003732606.1| response regulator [Acinetobacter sp. DR1]
 gi|298700668|gb|ADI91233.1| response regulator [Acinetobacter sp. DR1]
          Length = 319

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 34/55 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           +LT RE E + W+  GKT+ +IA IL +S  TVN ++  +  K   + R+ A+A+
Sbjct: 256 QLTQREAEVMHWLLLGKTNKDIAEILELSPRTVNKHLEHVFEKLCVENRTAAVAH 310


>gi|238064601|ref|ZP_04609310.1| two-component system response regulator [Micromonospora sp. ATCC
           39149]
 gi|237886412|gb|EEP75240.1| two-component system response regulator [Micromonospora sp. ATCC
           39149]
          Length = 225

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 3/78 (3%)

Query: 169 QANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKT 228
           QA +  S  VH  +   LT RE E +  ++EG ++ +IA  LGIS +     +AS+M K 
Sbjct: 150 QARVELSTPVHPAR---LTARESEAMGLMAEGMSNKQIAGRLGISSHGAKRLVASLMLKL 206

Query: 229 ATKTRSGAIAYAVRNNIV 246
            +  R+ A+  A+++ +V
Sbjct: 207 GSPNRTAAVVNAIKSGLV 224


>gi|184157756|ref|YP_001846095.1| response regulator [Acinetobacter baumannii ACICU]
 gi|332876442|ref|ZP_08444209.1| response regulator receiver domain protein [Acinetobacter baumannii
           6014059]
 gi|183209350|gb|ACC56748.1| Response regulator consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Acinetobacter baumannii
           ACICU]
 gi|322508066|gb|ADX03520.1| Putative two-component response regulator protein [Acinetobacter
           baumannii 1656-2]
 gi|323517648|gb|ADX92029.1| response regulator [Acinetobacter baumannii TCDC-AB0715]
 gi|332735300|gb|EGJ66360.1| response regulator receiver domain protein [Acinetobacter baumannii
           6014059]
          Length = 319

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 34/55 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           +LT RE E + W+  GKT+ +IA IL +S  TVN ++  +  K   + R+ A+A+
Sbjct: 256 QLTQREAEVMHWLLLGKTNKDIAEILELSPRTVNKHLEHVFEKLCVENRTAAVAH 310


>gi|254228707|ref|ZP_04922130.1| transcriptional regulator, LuxR family protein [Vibrio sp. Ex25]
 gi|262396571|ref|YP_003288424.1| transcriptional regulator VpsT [Vibrio sp. Ex25]
 gi|151938654|gb|EDN57489.1| transcriptional regulator, LuxR family protein [Vibrio sp. Ex25]
 gi|262340165|gb|ACY53959.1| transcriptional regulator VpsT [Vibrio sp. Ex25]
          Length = 210

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (63%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + ELT RE++ L  + EG ++ EIA  L IS +T+ +++ +I RK   K R+ A ++A R
Sbjct: 149 EVELTRREIQVLKMLKEGGSNMEIADSLFISEHTIKSHLYNIFRKLEVKNRTQATSWARR 208

Query: 243 N 243
           N
Sbjct: 209 N 209


>gi|111022239|ref|YP_705211.1| response regulator, two-component system [Rhodococcus jostii RHA1]
 gi|110821769|gb|ABG97053.1| response regulator, two-component system [Rhodococcus jostii RHA1]
          Length = 226

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 164 LLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           +LA Y+  +  S D       ELT RE++ L  I  G ++ EI   LGIS  TV +++  
Sbjct: 137 VLATYR-TVAPSSDGGRNHLTELTARELDVLALIGRGHSNSEIGRELGISGVTVKSHVGH 195

Query: 224 IMRKTATKTRSGAIAYAVRNNIV 246
           I  K   + R+ AI YA  + IV
Sbjct: 196 IFLKLDLRDRAAAIVYAFDHGIV 218


>gi|299533172|ref|ZP_07046556.1| two component transcriptional regulator, LuxR family protein
           [Comamonas testosteroni S44]
 gi|298718702|gb|EFI59675.1| two component transcriptional regulator, LuxR family protein
           [Comamonas testosteroni S44]
          Length = 255

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (57%), Gaps = 2/80 (2%)

Query: 168 YQANMFKSYDVHWGKDFE-LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMR 226
           ++AN F    +   K FE LT REVE L  I++GK S E+A  L IS  TV+ +I +I  
Sbjct: 177 FKAN-FHEESIFKHKSFESLTEREVEILKLIAQGKNSLEVASYLQISPLTVSTHIKNIYG 235

Query: 227 KTATKTRSGAIAYAVRNNIV 246
           K   +TR+ A+  A+   I+
Sbjct: 236 KMQVRTRAQAVRCAILIGII 255


>gi|298247251|ref|ZP_06971056.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
 gi|297549910|gb|EFH83776.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
          Length = 222

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 83/192 (43%), Gaps = 14/192 (7%)

Query: 54  EYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVF 113
           E VG +   L    + + Q+ D I+  D    ++  +A +E+      L+RP  L    F
Sbjct: 32  ELVGEAENGLSALQIAESQEPDVILM-DIRMPVLDGIAATER-VLQQALKRPRILLLTTF 89

Query: 114 HTLPENITPP--AGMDN---RYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAY 168
            T PE +     AG      + CS       IR        +G+I+L+       LLA+ 
Sbjct: 90  DT-PELVIEGMRAGASGYLLKDCSAEELCTAIRA-----VARGQILLQAS-SAAQLLASL 142

Query: 169 QANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKT 228
           Q     +  +   +   LT RE+E L  ++ G+++ EIA  L +S  TV  +I  I  K 
Sbjct: 143 QTKPVAAAPLSVAEQLGLTTRELEVLRLVTLGQSNTEIAAALFVSDATVKTHINHIFSKL 202

Query: 229 ATKTRSGAIAYA 240
             + RS AI  A
Sbjct: 203 GARNRSQAIIKA 214


>gi|193077065|gb|ABO11822.2| putative two-component response regulator protein [Acinetobacter
           baumannii ATCC 17978]
          Length = 319

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 34/55 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           +LT RE E + W+  GKT+ +IA IL +S  TVN ++  +  K   + R+ A+A+
Sbjct: 256 QLTQREAEVMHWLLLGKTNKDIAEILELSPRTVNKHLEHVFEKLCVENRTAAVAH 310


>gi|298247435|ref|ZP_06971240.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
 gi|297550094|gb|EFH83960.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
          Length = 234

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 38/64 (59%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + EL+ RE+E L  ++ G+ S EIA  LGIS  TV  ++ SI  K    +R+ A+A A+ 
Sbjct: 169 EGELSERELEVLRKVASGERSKEIAAQLGISLRTVGAHLTSIYTKLGVDSRTSAVAVALE 228

Query: 243 NNIV 246
             ++
Sbjct: 229 RGLL 232


>gi|262225461|ref|YP_003280952.1| pCQ3_103 [Streptomyces sp. W9]
 gi|261597637|gb|ACX85604.1| pCQ3_103 [Streptomyces sp. W9]
          Length = 113

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + +T R+++ L  I+ G T+  IA  LGIS NTV   +ASI RK     R+ A+A A+R
Sbjct: 28  YTVTRRQLDILRLIANGNTTTAIARRLGISYNTVTKQVASIHRKLRVSDRAQAVAVALR 86


>gi|262173265|ref|ZP_06040942.1| transcriptional regulator LuxR family [Vibrio mimicus MB-451]
 gi|261890623|gb|EEY36610.1| transcriptional regulator LuxR family [Vibrio mimicus MB-451]
          Length = 224

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%)

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           T RE E L W+  GK++ EI+ +L IS  TV  ++ +I RK  T  R+ AIA A+
Sbjct: 163 TDRECELLPWLKLGKSNWEISRLLNISERTVKYHLQNIYRKLETHNRTHAIAKAI 217


>gi|258622070|ref|ZP_05717096.1| conserved hypothetical protein [Vibrio mimicus VM573]
 gi|258585394|gb|EEW10117.1| conserved hypothetical protein [Vibrio mimicus VM573]
          Length = 224

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%)

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           T RE E L W+  GK++ EI+ +L IS  TV  ++ +I RK  T  R+ AIA A+
Sbjct: 163 TDRECELLPWLKLGKSNWEISRLLNISERTVKYHLQNIYRKLETHNRTHAIAKAI 217


>gi|258626786|ref|ZP_05721594.1| conserved hypothetical protein [Vibrio mimicus VM603]
 gi|258580926|gb|EEW05867.1| conserved hypothetical protein [Vibrio mimicus VM603]
          Length = 224

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%)

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           T RE E L W+  GK++ EI+ +L IS  TV  ++ +I RK  T  R+ AIA A+
Sbjct: 163 TDRECELLPWLKLGKSNWEISRLLNISERTVKYHLQNIYRKLETHNRTHAIAKAI 217


>gi|330888767|gb|EGH21428.1| regulatory protein, LuxR [Pseudomonas syringae pv. mori str.
           301020]
          Length = 74

 Score = 47.0 bits (110), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/60 (36%), Positives = 37/60 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L W +EGKT+ +IA+IL +   T++ +IAS ++K     ++ A   A  + +
Sbjct: 14  LTQREIEVLKWSAEGKTAGDIAMILCLKERTIHFHIASAIQKMGVCNKTAAAVQAALSGV 73


>gi|320322629|gb|EFW78722.1| regulatory protein, LuxR [Pseudomonas syringae pv. glycinea str.
           B076]
          Length = 77

 Score = 47.0 bits (110), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/60 (36%), Positives = 37/60 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L W +EGKT+ +IA+IL +   T++ +IAS ++K     ++ A   A  + +
Sbjct: 17  LTQREIEVLKWSAEGKTAGDIAMILCLKERTIHFHIASAIQKMGVCNKTAAAVQAALSGV 76


>gi|262283888|gb|ACY40752.1| VisR [Rhizobium leguminosarum bv. viciae]
          Length = 248

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 98/252 (38%), Gaps = 36/252 (14%)

Query: 11  VLNREDEQRTSFVSHLPTRSDLLARMIPLD---------------CTVSWTMRMYALTEY 55
            ++  ++ RT  V+ + +RSDL  R+I +                  +    R+    E 
Sbjct: 8   TMSSAEQLRTVRVNRISSRSDLFPRLIAMQKLADAQGFAIFRVSGSGLPAKQRLVCELEN 67

Query: 56  VGASH--FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVF 113
            G+S+  F     D + +  LD I  S  P        LS    Y      P + F P  
Sbjct: 68  WGSSNAGFGKAFTDAYGDILLDHIDKSLLP--------LSWAGGYDRAAPGPAD-FSPFM 118

Query: 114 HTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRII--LRDRLWEI-GLLAAYQA 170
             L + I P       +  L F V    +G   +   G  I    D + E+ G       
Sbjct: 119 TRLQDGILP-------FSGLAFPVRLGAVGNGFILFTGDEIDPSSDTIVELHGRCCHIMM 171

Query: 171 NMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTAT 230
           ++    +        L+ RE+ CL    +G+ S+EIA  LG+S +TVN Y+ S   K  +
Sbjct: 172 DLLSLDERRTAAAEALSEREIACLQLAGDGRISEEIADKLGLSVHTVNAYLGSATIKLDS 231

Query: 231 KTRSGAIAYAVR 242
             R  AIA A+R
Sbjct: 232 VNRIQAIAKAIR 243


>gi|222148404|ref|YP_002549361.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
 gi|68449749|gb|AAY97861.1| AvsR [Agrobacterium vitis]
 gi|221735392|gb|ACM36355.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
          Length = 246

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 2/88 (2%)

Query: 161 EIGLLAA-YQANMFKSYD-VHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVN 218
           +I LLA  + A + K  D    G    LT RE E L W + GK+  E AVILGIS  TV 
Sbjct: 153 DIHLLAGKFHAGLVKRCDGTRLGGVPTLTRREQETLRWTAAGKSYWETAVILGISERTVR 212

Query: 219 NYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ++A+   K    + + A+A A++  ++
Sbjct: 213 YFMANARTKLDAVSNTQAVAKALQRGLI 240


>gi|77919001|ref|YP_356816.1| two component signal transduction response regulator [Pelobacter
           carbinolicus DSM 2380]
 gi|77545084|gb|ABA88646.1| transcriptional regulator, LuxR family [Pelobacter carbinolicus DSM
           2380]
          Length = 214

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 38/66 (57%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G +  LT  E++ L  I+EGKT++EIA I  +S  T+  ++  I +K     R  A+A A
Sbjct: 149 GAEHNLTKTEIKVLKHIAEGKTNNEIAQIQFVSIETIKTHVQRIFKKLEVGNRMEAVAVA 208

Query: 241 VRNNIV 246
            + NI+
Sbjct: 209 RKKNII 214


>gi|82940563|emb|CAJ44292.1| putative transcription regulator protein MotS, LuxR family
           [Rhizobium leguminosarum bv. viciae]
          Length = 248

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE+ CL    +G+ S+EIA  LG+S +TVN Y+ S   K  +  R  AIA A+R
Sbjct: 187 LSEREIACLQLAGDGRISEEIADKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIR 243


>gi|295703554|ref|YP_003596629.1| two-component response regulator LiaR [Bacillus megaterium DSM 319]
 gi|294801213|gb|ADF38279.1| two-component response regulator LiaR [Bacillus megaterium DSM 319]
          Length = 208

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 40/61 (65%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE+E L  +++GKT+ EIA  L I+  TV  ++++++ K   + R+ A+ YA ++ 
Sbjct: 146 ELTAREMEILLLMTQGKTNQEIADELFIALKTVKTHVSNLLSKLDVQDRTQAVIYAFKHK 205

Query: 245 I 245
           +
Sbjct: 206 L 206


>gi|290955466|ref|YP_003486648.1| LuxR family transcriptional regulator [Streptomyces scabiei 87.22]
 gi|260644992|emb|CBG68078.1| putative LuxR-family regulator [Streptomyces scabiei 87.22]
          Length = 342

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 39/63 (61%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           + L+ RE+E LT  + G T+  IA  L +S  TV+ ++  ++RKT   +R+ A A AVR+
Sbjct: 263 YGLSPRELEVLTRAATGMTNQAIAQALFLSPRTVHTHVEHLLRKTGAASRAEATALAVRD 322

Query: 244 NIV 246
            ++
Sbjct: 323 GLL 325


>gi|22125626|ref|NP_669049.1| transcriptional activator protein [Yersinia pestis KIM 10]
 gi|45442066|ref|NP_993605.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51596821|ref|YP_071012.1| quorum-sensing transcriptional activator YpeR [Yersinia
           pseudotuberculosis IP 32953]
 gi|108807950|ref|YP_651866.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           Antiqua]
 gi|108812215|ref|YP_647982.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           Nepal516]
 gi|145599154|ref|YP_001163230.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           Pestoides F]
 gi|149365634|ref|ZP_01887669.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           CA88-4125]
 gi|153948985|ref|YP_001400524.1| LuxR family transcriptional regulator [Yersinia pseudotuberculosis
           IP 31758]
 gi|162419359|ref|YP_001606210.1| LuxR family transcriptional regulator [Yersinia pestis Angola]
 gi|165927469|ref|ZP_02223301.1| transcriptional regulator, LuxR family [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165939475|ref|ZP_02228021.1| transcriptional regulator, LuxR family [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166008189|ref|ZP_02229087.1| transcriptional regulator, LuxR family [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166214550|ref|ZP_02240585.1| transcriptional regulator, LuxR family [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167402379|ref|ZP_02307842.1| transcriptional regulator, LuxR family [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167422303|ref|ZP_02314056.1| transcriptional regulator, LuxR family [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167427015|ref|ZP_02318768.1| transcriptional regulator, LuxR family [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167469621|ref|ZP_02334325.1| transcriptional regulator, LuxR family protein [Yersinia pestis
           FV-1]
 gi|170023896|ref|YP_001720401.1| LuxR family transcriptional regulator [Yersinia pseudotuberculosis
           YPIII]
 gi|186895898|ref|YP_001873010.1| LuxR family transcriptional regulator [Yersinia pseudotuberculosis
           PB1/+]
 gi|218929546|ref|YP_002347421.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           CO92]
 gi|229837989|ref|ZP_04458148.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229895186|ref|ZP_04510361.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           Pestoides A]
 gi|229898551|ref|ZP_04513696.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229902547|ref|ZP_04517664.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           Nepal516]
 gi|294504217|ref|YP_003568279.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           Z176003]
 gi|21958535|gb|AAM85300.1|AE013776_9 putative transcriptional activator protein [Yersinia pestis KIM 10]
 gi|6648672|gb|AAF21289.1| transcriptional activator YpeR [Yersinia pestis]
 gi|45436929|gb|AAS62482.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51590103|emb|CAH21738.1| quorum-sensing transcriptional activator YpeR [Yersinia
           pseudotuberculosis IP 32953]
 gi|108775863|gb|ABG18382.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           Nepal516]
 gi|108779863|gb|ABG13921.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           Antiqua]
 gi|115348157|emb|CAL21085.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           CO92]
 gi|145210850|gb|ABP40257.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           Pestoides F]
 gi|149292047|gb|EDM42121.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           CA88-4125]
 gi|152960480|gb|ABS47941.1| transcriptional regulator, LuxR family [Yersinia pseudotuberculosis
           IP 31758]
 gi|162352174|gb|ABX86122.1| transcriptional regulator, LuxR family [Yersinia pestis Angola]
 gi|165912524|gb|EDR31155.1| transcriptional regulator, LuxR family [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165920524|gb|EDR37801.1| transcriptional regulator, LuxR family [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165992571|gb|EDR44872.1| transcriptional regulator, LuxR family [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166204252|gb|EDR48732.1| transcriptional regulator, LuxR family [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166958809|gb|EDR55830.1| transcriptional regulator, LuxR family [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167048212|gb|EDR59620.1| transcriptional regulator, LuxR family [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167053994|gb|EDR63822.1| transcriptional regulator, LuxR family [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169750430|gb|ACA67948.1| transcriptional regulator, LuxR family [Yersinia pseudotuberculosis
           YPIII]
 gi|186698924|gb|ACC89553.1| transcriptional regulator, LuxR family [Yersinia pseudotuberculosis
           PB1/+]
 gi|229679994|gb|EEO76093.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           Nepal516]
 gi|229688099|gb|EEO80170.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229694355|gb|EEO84402.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229701820|gb|EEO89844.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           Pestoides A]
 gi|262362334|gb|ACY59055.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           D106004]
 gi|262366357|gb|ACY62914.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           D182038]
 gi|294354676|gb|ADE65017.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           Z176003]
 gi|320014713|gb|ADV98284.1| quorum-sensing transcriptional activator YpeR [Yersinia pestis
           biovar Medievalis str. Harbin 35]
          Length = 245

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 57/116 (49%), Gaps = 9/116 (7%)

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFEL 186
           D+ +   + +V + +I ++L+F      + D++  +   + ++ N     +    K    
Sbjct: 132 DSIFFDESIEVNKEKIQMLLIF------IHDKMLGLYNKSHHENNTLNKKE---NKREIF 182

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + RE E L W S GKT  EIA+ILGI ++TV  +I +I+RK        AI   + 
Sbjct: 183 SPRENEILYWASVGKTYSEIAIILGIKKSTVKFHIGNIVRKLGVLNAKHAIRLGIE 238


>gi|89894389|ref|YP_517876.1| hypothetical protein DSY1643 [Desulfitobacterium hafniense Y51]
 gi|89333837|dbj|BAE83432.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 214

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE++ LT++ +G ++ EI   L IS  TV N+++SI RK A + R+ A   AV+  +
Sbjct: 151 LSDRELQILTYVVKGSSNREIGQALFISEKTVKNHLSSIFRKLAVEDRTQAALKAVKLKL 210

Query: 246 V 246
           V
Sbjct: 211 V 211


>gi|154685393|ref|YP_001420554.1| YhcZ [Bacillus amyloliquefaciens FZB42]
 gi|154351244|gb|ABS73323.1| YhcZ [Bacillus amyloliquefaciens FZB42]
          Length = 214

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE + L  I++GK++ EIA  L IS  TV  ++++++ K     R+ A  YAV+ N
Sbjct: 148 QLTPREKDVLQEIAKGKSNKEIAAALFISEKTVKTHVSNLLSKLNLSDRTQAALYAVKYN 207

Query: 245 I 245
           +
Sbjct: 208 V 208


>gi|82703532|ref|YP_413098.1| LuxR family transcriptional regulator [Nitrosospira multiformis
           ATCC 25196]
 gi|82411597|gb|ABB75706.1| transcriptional regulator, LuxR family [Nitrosospira multiformis
           ATCC 25196]
          Length = 244

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 37/65 (56%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           K   LT RE ECL W +EGKT  EIA I+ IS  TV  ++ + ++K     R  AI+ A+
Sbjct: 174 KKANLTEREQECLLWAAEGKTGWEIANIVKISERTVTFHLQNAIQKLGVVNRQQAISRAL 233

Query: 242 RNNIV 246
              ++
Sbjct: 234 SMGLI 238


>gi|86747544|ref|YP_484040.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           HaA2]
 gi|86570572|gb|ABD05129.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           HaA2]
          Length = 242

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 45/83 (54%)

Query: 164 LLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIAS 223
           L+  Y  N  +S +    +   LT RE E L+W ++GKT+ EI++IL I+  TV  ++  
Sbjct: 158 LIGVYAHNRLRSLNRPKPQRRLLTSRECEILSWAAQGKTAWEISMILRIAERTVKFHLIE 217

Query: 224 IMRKTATKTRSGAIAYAVRNNIV 246
             RK     R+ A+A A+   ++
Sbjct: 218 ASRKLNAVNRTAAVAKALSLGLI 240


>gi|17228408|ref|NP_484956.1| two-component response regulator [Nostoc sp. PCC 7120]
 gi|17130259|dbj|BAB72870.1| two-component response regulator [Nostoc sp. PCC 7120]
          Length = 225

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G    L+GRE+E L  + EG ++ EIA  L +S NTV  ++  IM K A   R  A   A
Sbjct: 160 GNTANLSGRELEVLKLMVEGLSNPEIAEKLYLSPNTVKTHVRGIMNKLAVDDRVQAAVVA 219

Query: 241 VRNNIV 246
           +R+ +V
Sbjct: 220 LRSGLV 225


>gi|229541561|ref|ZP_04430621.1| two component transcriptional regulator, LuxR family [Bacillus
           coagulans 36D1]
 gi|229325981|gb|EEN91656.1| two component transcriptional regulator, LuxR family [Bacillus
           coagulans 36D1]
          Length = 227

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           LT RE E L  +++GK++  I   L IS  TV N++++I++K   K R+ A+  A++N 
Sbjct: 164 LTPRECEVLQLLADGKSNRAIGDALYISEKTVKNHVSNILQKLKVKDRTQAVVTAIKNG 222


>gi|153007543|ref|YP_001368758.1| autoinducer-binding domain-containing protein [Ochrobactrum
           anthropi ATCC 49188]
 gi|151559431|gb|ABS12929.1| Autoinducer-binding domain protein [Ochrobactrum anthropi ATCC
           49188]
          Length = 235

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           +  LT RE E L W SEGKT++ I  IL IS  TVN +I++++ K     +  A+A A
Sbjct: 172 EVNLTMREREILRWTSEGKTAEIIGTILNISTRTVNFHISNVLTKLVAVNKVQAVAKA 229


>gi|126641440|ref|YP_001084424.1| putative two-component response regulator protein [Acinetobacter
           baumannii ATCC 17978]
          Length = 257

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 34/55 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           +LT RE E + W+  GKT+ +IA IL +S  TVN ++  +  K   + R+ A+A+
Sbjct: 194 QLTQREAEVMHWLLLGKTNKDIAEILELSPRTVNKHLEHVFEKLCVENRTAAVAH 248


>gi|218673112|ref|ZP_03522781.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli GR56]
          Length = 96

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 36/62 (58%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G    L+ RE+ CL    +G+ S+EIA  LG+S +TVN Y+ S   K  +  R  AIA A
Sbjct: 30  GAAEALSEREIACLQLAGDGRISEEIAEKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKA 89

Query: 241 VR 242
           +R
Sbjct: 90  IR 91


>gi|167464395|ref|ZP_02329484.1| Two-component response regulator [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 241

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 36/59 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           LT RE E L  ++EG+++  I   L IS  TV N+++SI++K     R+ A+  A++N 
Sbjct: 179 LTKREAEVLRLMAEGRSNKSIGEYLYISEKTVKNHVSSILQKMEVDDRTQAVIIAIKNG 237


>gi|167032675|ref|YP_001667906.1| two component LuxR family transcriptional regulator [Pseudomonas
           putida GB-1]
 gi|166859163|gb|ABY97570.1| two component transcriptional regulator, LuxR family [Pseudomonas
           putida GB-1]
          Length = 219

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 38/66 (57%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G+   LT R++E L  I  GK++ EIA  LG+S  T+  + + IM++      +G + +A
Sbjct: 150 GERHNLTARQLEILRLIVRGKSTREIATGLGLSIKTIETHRSQIMKRLQIHDVAGLVLFA 209

Query: 241 VRNNIV 246
           VR  I+
Sbjct: 210 VREKII 215


>gi|78778542|ref|YP_396654.1| LuxR family transcriptional regulator [Prochlorococcus marinus str.
           MIT 9312]
 gi|78712041|gb|ABB49218.1| transcriptional regulator, LuxR family [Prochlorococcus marinus
           str. MIT 9312]
          Length = 92

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 40/58 (68%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           L+ RE+E +  +++G T+ EIAV L IS+ TV+N+++++  KT +K R   + +A+ N
Sbjct: 16  LSTREMEIIDLVADGLTNQEIAVKLTISKRTVDNHVSNMFTKTGSKNRVALLNWAMDN 73


>gi|325277459|ref|ZP_08143066.1| LuxR family transcriptional regulator [Pseudomonas sp. TJI-51]
 gi|324097402|gb|EGB95641.1| LuxR family transcriptional regulator [Pseudomonas sp. TJI-51]
          Length = 82

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           LT RE + L W + GK+S EI  IL    +TVN ++++I+RK    TR  A+  A+R
Sbjct: 19  LTPREQQVLLWCAYGKSSWEIGQILACKESTVNFHVSNILRKFDVPTRVAAVIKAIR 75


>gi|116250469|ref|YP_766307.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255117|emb|CAK06191.1| regulator of flagellar and motility genes, also regulates rem
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 248

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 98/252 (38%), Gaps = 36/252 (14%)

Query: 11  VLNREDEQRTSFVSHLPTRSDLLARMIPLD---------------CTVSWTMRMYALTEY 55
            ++  ++ RT  V+ + +RSDL  R+I +                  +    R+    E 
Sbjct: 8   TMSSAEQLRTVRVNRISSRSDLFPRLIAMQKLAEAQGFAIFRVSGSGLPAKQRLVCELEN 67

Query: 56  VGASH--FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVF 113
            G+S+  F     D + +  LD I  S  P        LS    Y      P + F P  
Sbjct: 68  WGSSNAGFGKAFTDAYGDILLDHIDKSLLP--------LSWAGGYDRAAPGPAD-FSPFM 118

Query: 114 HTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRII--LRDRLWEI-GLLAAYQA 170
             L + I P       +  L F V    +G   +   G  I    D + E+ G       
Sbjct: 119 TRLQDGILP-------FSGLAFPVRLGAVGNGFILFTGDEIDPSSDTIVELHGRCCHIMM 171

Query: 171 NMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTAT 230
           ++    +        L+ RE+ CL    +G+ S+EIA  LG+S +TVN Y+ S   K  +
Sbjct: 172 DLLSLDERRTAAAEALSEREIACLQLAGDGRISEEIADKLGLSVHTVNAYLGSATIKLDS 231

Query: 231 KTRSGAIAYAVR 242
             R  AIA A+R
Sbjct: 232 VNRIQAIAKAIR 243


>gi|324997346|ref|ZP_08118458.1| two component transcriptional regulator, LuxR family protein
           [Pseudonocardia sp. P1]
          Length = 222

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 41/62 (66%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EL+GRE+E L  ++ G  + EIA +L ++  TV N++++++ K  T+ R+ A+  A+ + 
Sbjct: 153 ELSGRELEVLRLLAAGYANREIAQVLVLAEGTVKNHVSNVLLKLGTRDRTRAVLRALHHG 212

Query: 245 IV 246
           ++
Sbjct: 213 LL 214


>gi|311069822|ref|YP_003974745.1| two-component response regulator YvqE [Bacillus atrophaeus 1942]
 gi|310870339|gb|ADP33814.1| two-component response regulator [YvqE] responding to cell wall
           stress [Bacillus atrophaeus 1942]
          Length = 211

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++EGKT+ EI   L I+  TV  ++ +I+ K     R+ A  YA RN +
Sbjct: 150 LTKRELEILCLVAEGKTNKEIGEELFITIKTVKTHVTNILSKLEVADRTQAAVYAHRNKL 209

Query: 246 V 246
           V
Sbjct: 210 V 210


>gi|70731557|ref|YP_261298.1| LuxR family DNA-binding response regulator [Pseudomonas fluorescens
           Pf-5]
 gi|68345856|gb|AAY93462.1| DNA-binding response regulator, LuxR family [Pseudomonas
           fluorescens Pf-5]
          Length = 219

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 39/65 (60%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           ++  LT R++E L  I  GK++ EIA+ LG+S  TV  + + IM++      +G + +AV
Sbjct: 151 QNHNLTARQLEILRLIVRGKSTREIALGLGLSIKTVETHRSQIMKRLQIFDVAGLVLFAV 210

Query: 242 RNNIV 246
           R  I+
Sbjct: 211 RERII 215


>gi|121605575|ref|YP_982904.1| response regulator receiver protein [Polaromonas naphthalenivorans
           CJ2]
 gi|120594544|gb|ABM37983.1| transcriptional regulator, LuxR family [Polaromonas
           naphthalenivorans CJ2]
          Length = 262

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 43/80 (53%)

Query: 159 LWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVN 218
           L ++  L   Q    KS  V   + F L+ RE++ + W++ GKT+ EI  IL IS  TV 
Sbjct: 174 LRQVAQLPQQQKPFAKSPRVVQEEIFGLSEREIQIMDWVAMGKTNSEIGSILNISGFTVK 233

Query: 219 NYIASIMRKTATKTRSGAIA 238
           N++  I +K     R+ A++
Sbjct: 234 NHMQRIFQKLNVFNRAQAVS 253


>gi|260777849|ref|ZP_05886742.1| transcriptional activator protein luxR [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260605862|gb|EEX32147.1| transcriptional activator protein luxR [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 240

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT RE++CLTW ++GK++ EIA I+  +  TV  ++++  +K     R  A+  A+
Sbjct: 176 LTNREIQCLTWAADGKSASEIADIVDCTERTVKFHLSNACKKLGATNRCQAVTRAL 231


>gi|297567827|ref|YP_003686798.1| hypothetical protein Mesil_3486 [Meiothermus silvanus DSM 9946]
 gi|296852276|gb|ADH65290.1| hypothetical protein Mesil_3486 [Meiothermus silvanus DSM 9946]
          Length = 206

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 41/75 (54%)

Query: 172 MFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATK 231
           +     V  G   +L+ RE+E L  I+EG ++ EIA  LGIS +TV  +I  ++ K +  
Sbjct: 132 VLGQLSVLSGGQAQLSPRELEVLRLIAEGLSNKEIAQRLGISLSTVKTHIEELLAKLSAS 191

Query: 232 TRSGAIAYAVRNNIV 246
            R+ A   AVR  ++
Sbjct: 192 DRTQAAIKAVRQGLL 206


>gi|289641790|ref|ZP_06473948.1| GAF modulated transcriptional regulator, LuxR family [Frankia
           symbiont of Datisca glomerata]
 gi|289508434|gb|EFD29375.1| GAF modulated transcriptional regulator, LuxR family [Frankia
           symbiont of Datisca glomerata]
          Length = 377

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 38/60 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LTGRE+E LT ++ G T++ IA  L I+  TV +++  I+RK   + R+ AI+  +R  I
Sbjct: 313 LTGRELEVLTLMATGATNNRIAEKLVITNGTVKSHVKRILRKLGAENRAEAISQYLRLTI 372


>gi|224552993|gb|ACN54748.1| PagR [Pantoea agglomerans]
          Length = 210

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 35/63 (55%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H  K+  L+ RE + L W+S GKT  E+++IL I+  TV  ++ ++M+K        A+ 
Sbjct: 141 HQKKNVFLSPRERQILKWVSAGKTYAEVSIILSIAERTVKFHMGNVMKKLGVNNARHAVK 200

Query: 239 YAV 241
             V
Sbjct: 201 LGV 203


>gi|220906417|ref|YP_002481728.1| two component LuxR family transcriptional regulator [Cyanothece sp.
           PCC 7425]
 gi|219863028|gb|ACL43367.1| two component transcriptional regulator, LuxR family [Cyanothece
           sp. PCC 7425]
          Length = 221

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 80/175 (45%), Gaps = 19/175 (10%)

Query: 83  PFDLVRCMALSEKDKY---YNVLQRPTELFCPVFHTLPENITPP------AGMDNRYCSL 133
           P  L+  + + E D Y     V Q+P     PV      N T        +G D  Y S 
Sbjct: 47  PHLLITDIVMPEMDGYDLVRQVRQQPAFRLLPVIFLTGRNKTKERIRGYQSGCDV-YLSK 105

Query: 134 TFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANM--FKSYDVHWGKDFELTGREV 191
            F++  +   +  L  + ++I  D  W I   +  +  M    +Y   WG    LT RE 
Sbjct: 106 PFELEELGAVVRNLLDRMQMIQTD--WHIRTKSQARGEMETLAAYQ-QWG----LTQREQ 158

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E LT +++G ++ +I   L +S  T+  Y++S+++KT    R+  + +A+ ++++
Sbjct: 159 EVLTLLTKGLSNAQIGDRLHLSARTIEKYVSSLLQKTEVHNRAELVRFALEHHLL 213


>gi|53717016|ref|YP_106048.1| ATP-dependent transcription regulator LuxR [Burkholderia mallei
           ATCC 23344]
 gi|67643368|ref|ZP_00442115.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei GB8 horse 4]
 gi|124382942|ref|YP_001025964.1| ATP-dependent transcription regulator LuxR [Burkholderia mallei
           NCTC 10229]
 gi|126445405|ref|YP_001061548.1| ATP-dependent transcriptional regulator LuxR [Burkholderia
           pseudomallei 668]
 gi|126446264|ref|YP_001078053.1| ATP-dependent transcription regulator LuxR [Burkholderia mallei
           NCTC 10247]
 gi|126457742|ref|YP_001074487.1| ATP-dependent transcriptional regulator LuxR [Burkholderia
           pseudomallei 1106a]
 gi|134284195|ref|ZP_01770887.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 305]
 gi|167003599|ref|ZP_02269385.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei PRL-20]
 gi|167741352|ref|ZP_02414126.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 14]
 gi|167818528|ref|ZP_02450208.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 91]
 gi|167826910|ref|ZP_02458381.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 9]
 gi|167848430|ref|ZP_02473938.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei B7210]
 gi|167896980|ref|ZP_02484382.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 7894]
 gi|167905359|ref|ZP_02492564.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei NCTC 13177]
 gi|167921599|ref|ZP_02508690.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei BCC215]
 gi|217423225|ref|ZP_03454727.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 576]
 gi|226194550|ref|ZP_03790147.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pakistan 9]
 gi|237507990|ref|ZP_04520705.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei MSHR346]
 gi|242313995|ref|ZP_04813012.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106b]
 gi|254176241|ref|ZP_04882899.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei ATCC 10399]
 gi|254189375|ref|ZP_04895885.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pasteur 52237]
 gi|254195237|ref|ZP_04901665.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei S13]
 gi|254200901|ref|ZP_04907266.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei FMH]
 gi|254204867|ref|ZP_04911220.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei JHU]
 gi|254262915|ref|ZP_04953780.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1710a]
 gi|254299430|ref|ZP_04966879.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 406e]
 gi|254358982|ref|ZP_04975254.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei 2002721280]
 gi|52422986|gb|AAU46556.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei ATCC 23344]
 gi|126224896|gb|ABN88401.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 668]
 gi|126231510|gb|ABN94923.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106a]
 gi|126239118|gb|ABO02230.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei NCTC 10247]
 gi|134244398|gb|EBA44504.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 305]
 gi|147748513|gb|EDK55588.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei FMH]
 gi|147754453|gb|EDK61517.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei JHU]
 gi|148028169|gb|EDK86129.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei 2002721280]
 gi|156105362|gb|ABU49180.1| BpsR4 [Burkholderia pseudomallei]
 gi|157809517|gb|EDO86687.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 406e]
 gi|157937053|gb|EDO92723.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pasteur 52237]
 gi|160697283|gb|EDP87253.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei ATCC 10399]
 gi|169651984|gb|EDS84677.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei S13]
 gi|217394133|gb|EEC34153.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 576]
 gi|225933378|gb|EEH29368.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pakistan 9]
 gi|235000195|gb|EEP49619.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei MSHR346]
 gi|238524705|gb|EEP88137.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei GB8 horse 4]
 gi|242137234|gb|EES23637.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106b]
 gi|243060902|gb|EES43088.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei PRL-20]
 gi|254213917|gb|EET03302.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1710a]
 gi|261827048|gb|ABM99276.2| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia mallei NCTC 10229]
          Length = 238

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L W   GKT+ EI+ ILGIS  TV  ++++  RK     R+ A+  A    
Sbjct: 177 DLTARERESLQWAGRGKTAWEISKILGISERTVVFHLSNAARKIGANNRAQAVVIASARG 236

Query: 245 IV 246
           ++
Sbjct: 237 LI 238


>gi|322382401|ref|ZP_08056304.1| two-component response regulator-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321153618|gb|EFX45997.1| two-component response regulator-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 230

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 36/59 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           LT RE E L  ++EG+++  I   L IS  TV N+++SI++K     R+ A+  A++N 
Sbjct: 168 LTKREAEVLRLMAEGRSNKSIGEYLYISEKTVKNHVSSILQKMEVDDRTQAVIIAIKNG 226


>gi|218516149|ref|ZP_03512989.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli 8C-3]
          Length = 122

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 37/57 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE+E + W ++GKTS EI  IL +S +TVN Y+ + ++K     R+  +A A+R
Sbjct: 61  LSARELEVVRWTAQGKTSIEIGQILTLSDHTVNAYMTNAIKKLDCVNRTQLVAKAIR 117


>gi|167913657|ref|ZP_02500748.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 112]
          Length = 238

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L W   GKT+ EI+ ILGIS  TV  ++++  RK     R+ A+  A    
Sbjct: 177 DLTARERESLQWAGRGKTAWEISKILGISERTVVFHLSNAARKIGANNRAQAVVIASARG 236

Query: 245 IV 246
           ++
Sbjct: 237 LI 238


>gi|330895505|gb|EGH27816.1| regulatory protein, LuxR [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330981863|gb|EGH79966.1| regulatory protein, LuxR [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 77

 Score = 46.6 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 35/55 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           LT RE+E L W +EGKT+ +IA+IL +   T++ +IAS ++K     ++ A   A
Sbjct: 17  LTQREIEVLKWSAEGKTAGDIAMILCLKERTIHFHIASAIQKMGVCNKTAAAVQA 71


>gi|330873485|gb|EGH07634.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 77

 Score = 46.6 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 35/55 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           LT RE+E L W +EGKT+ +IA+IL +   T++ +IAS ++K     ++ A   A
Sbjct: 17  LTQREIEVLKWSAEGKTAGDIAMILCLKERTIHFHIASAIQKMGVCNKTAAAVQA 71


>gi|330868990|gb|EGH03699.1| regulatory protein, LuxR [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|331011382|gb|EGH91438.1| regulatory protein, LuxR [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 74

 Score = 46.6 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 35/55 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           LT RE+E L W +EGKT+ +IA+IL +   T++ +IAS ++K     ++ A   A
Sbjct: 14  LTQREIEVLKWSAEGKTAGDIAMILCLKERTIHFHIASAIQKMGVCNKTAAAVQA 68


>gi|257482151|ref|ZP_05636192.1| regulatory protein, LuxR [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289625831|ref|ZP_06458785.1| regulatory protein, LuxR [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289647709|ref|ZP_06479052.1| regulatory protein, LuxR [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|330987557|gb|EGH85660.1| regulatory protein, LuxR [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 77

 Score = 46.6 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 35/55 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           LT RE+E L W +EGKT+ +IA+IL +   T++ +IAS ++K     ++ A   A
Sbjct: 17  LTQREIEVLKWSAEGKTAGDIAMILCLKERTIHFHIASAIQKMGVCNKTAAAVQA 71


>gi|207722200|ref|YP_002252637.1| hypothetical solr-related protein [Ralstonia solanacearum MolK2]
 gi|206587375|emb|CAQ17958.1| hypothetical solr-related protein [Ralstonia solanacearum MolK2]
          Length = 459

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W  EGKT+ EI  IL IS  TVN ++ +++ K A   +  A+  A+   +
Sbjct: 399 LTAREREVLCWTGEGKTAYEIGQILRISERTVNFHVNNVLLKLAATNKVQAVVKAIATGL 458

Query: 246 V 246
           +
Sbjct: 459 I 459


>gi|182415168|ref|YP_001820234.1| two component LuxR family transcriptional regulator [Opitutus
           terrae PB90-1]
 gi|177842382|gb|ACB76634.1| two component transcriptional regulator, LuxR family [Opitutus
           terrae PB90-1]
          Length = 238

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 39/66 (59%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G    LT RE E L +++EG  S EIA  L +S  TV N+ A+I+++T  ++ +  + YA
Sbjct: 150 GAGPALTNREREVLRYVAEGLGSKEIADRLALSTRTVENHRANILKRTGLRSVAQLVLYA 209

Query: 241 VRNNIV 246
            R  ++
Sbjct: 210 ARLGLI 215


>gi|241203093|ref|YP_002974189.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856983|gb|ACS54650.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 248

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE+ CL    +G+ S+EIA  LG+S +TVN Y+ S   K  +  R  AIA A+R
Sbjct: 187 LSEREIACLQLAGDGRISEEIADKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIR 243


>gi|115265604|dbj|BAF32866.1| transcriptional regulator of LuxR family [Pseudomonas syringae pv.
           actinidiae]
 gi|330966735|gb|EGH66995.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 77

 Score = 46.6 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 35/55 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           LT RE+E L W +EGKT+ +IA+IL +   T++ +IAS ++K     ++ A   A
Sbjct: 17  LTQREIEVLKWSAEGKTAGDIAMILCLKERTIHFHIASAIQKMGVCNKTAAAVQA 71


>gi|28871776|ref|NP_794395.1| LuxR family transcriptional regulator [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213966768|ref|ZP_03394919.1| transcriptional regulator, LuxR family [Pseudomonas syringae pv.
           tomato T1]
 gi|301383276|ref|ZP_07231694.1| transcriptional regulator, LuxR family protein [Pseudomonas
           syringae pv. tomato Max13]
 gi|302062485|ref|ZP_07254026.1| transcriptional regulator, LuxR family protein [Pseudomonas
           syringae pv. tomato K40]
 gi|302133467|ref|ZP_07259457.1| transcriptional regulator, LuxR family protein [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|28855028|gb|AAO58090.1| transcriptional regulator, LuxR family [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213928618|gb|EEB62162.1| transcriptional regulator, LuxR family [Pseudomonas syringae pv.
           tomato T1]
 gi|331018915|gb|EGH98971.1| transcriptional regulator, LuxR family protein [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 77

 Score = 46.6 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 35/55 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           LT RE+E L W +EGKT+ +IA+IL +   T++ +IAS ++K     ++ A   A
Sbjct: 17  LTQREIEVLKWSAEGKTAGDIAMILCLKERTIHFHIASAIQKMGVCNKTAAAVQA 71


>gi|89056006|ref|YP_511457.1| two component LuxR family transcriptional regulator [Jannaschia sp.
           CCS1]
 gi|88865555|gb|ABD56432.1| two component transcriptional regulator, LuxR family [Jannaschia
           sp. CCS1]
          Length = 214

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 34/61 (55%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +S G    EIA  LGIS  TV N+I SI RK    +   A+A A R+ +
Sbjct: 154 LTNRETEILRSVSRGYKRHEIAAQLGISAGTVGNHITSIYRKLEVSSNIEAVAIASRSGM 213

Query: 246 V 246
           +
Sbjct: 214 L 214


>gi|66047505|ref|YP_237346.1| regulatory protein, LuxR [Pseudomonas syringae pv. syringae B728a]
 gi|289675883|ref|ZP_06496773.1| regulatory protein, LuxR [Pseudomonas syringae pv. syringae FF5]
 gi|302188577|ref|ZP_07265250.1| regulatory protein, LuxR [Pseudomonas syringae pv. syringae 642]
 gi|63258212|gb|AAY39308.1| regulatory protein, LuxR [Pseudomonas syringae pv. syringae B728a]
 gi|330938127|gb|EGH41849.1| regulatory protein, LuxR [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330952935|gb|EGH53195.1| regulatory protein, LuxR [Pseudomonas syringae Cit 7]
 gi|330969528|gb|EGH69594.1| regulatory protein, LuxR [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 77

 Score = 46.6 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 35/55 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           LT RE+E L W +EGKT+ +IA+IL +   T++ +IAS ++K     ++ A   A
Sbjct: 17  LTQREIEVLKWSAEGKTAGDIAMILCLKERTIHFHIASAIQKMGVCNKTAAAVQA 71


>gi|119715674|ref|YP_922639.1| response regulator receiver [Nocardioides sp. JS614]
 gi|119536335|gb|ABL80952.1| response regulator receiver [Nocardioides sp. JS614]
          Length = 213

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             LT RE+E L  +++G  + EIA  L IS NTV N++ +I+ K    +R  A+ YAV+ 
Sbjct: 148 LRLTERELEVLRLVAKGMNNREIAKELFISENTVKNHVRNILEKLQLHSRMEAVMYAVKE 207

Query: 244 NIV 246
            ++
Sbjct: 208 KLL 210


>gi|268610385|ref|ZP_06144112.1| response regulator [Ruminococcus flavefaciens FD-1]
          Length = 208

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 48/89 (53%), Gaps = 5/89 (5%)

Query: 163 GLLAAYQANMFKSY--DV---HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTV 217
           G +  +  N+F+S   DV      K+F LT RE E +  I +G  + EIA  L ++  TV
Sbjct: 120 GGINVFCDNVFRSIKKDVVVQQDAKNFGLTERETEFIRLICDGCDNKEIAAKLFLAEGTV 179

Query: 218 NNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            N I+ ++ K   K R+    +A++NNIV
Sbjct: 180 RNGISRLLEKLELKDRTQLAVFAIKNNIV 208


>gi|262164556|ref|ZP_06032294.1| transcriptional regulator LuxR family [Vibrio mimicus VM223]
 gi|262026936|gb|EEY45603.1| transcriptional regulator LuxR family [Vibrio mimicus VM223]
          Length = 224

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%)

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           T RE E L W+  GK++ EI+ +L IS  TV  ++ +I RK  T  R+ AIA A+
Sbjct: 163 TDRECELLPWLKLGKSNWEISRLLNISERTVKYHLQNIYRKLETHNRTHAIAKAI 217


>gi|206973784|ref|ZP_03234702.1| DNA-binding response regulator, LuxR family [Bacillus cereus
           H3081.97]
 gi|222095860|ref|YP_002529917.1| response regulator [Bacillus cereus Q1]
 gi|206747940|gb|EDZ59329.1| DNA-binding response regulator, LuxR family [Bacillus cereus
           H3081.97]
 gi|221239918|gb|ACM12628.1| response regulator [Bacillus cereus Q1]
          Length = 213

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 37/59 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           LT RE E L  I++G+++ EIA +L I+  TV  ++++++ K     R+ A  YAV++ 
Sbjct: 149 LTKREQEVLREIAKGRSNKEIAAVLHITEQTVKTHVSNVLAKLEVDDRTQAALYAVKHG 207


>gi|149187186|ref|ZP_01865484.1| LuxR, transcriptional regulator [Vibrio shilonii AK1]
 gi|148838722|gb|EDL55661.1| LuxR, transcriptional regulator [Vibrio shilonii AK1]
          Length = 259

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 36/56 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT RE  CL W++EGK+S E+A I+G S  TVN +I +   K    +R+ A++ A+
Sbjct: 185 LTLREQICLAWVAEGKSSWEVAQIIGCSERTVNFHIQNASEKLNAFSRTQAVSKAL 240


>gi|53721347|ref|YP_110332.1| LuxR family transcriptional regulator [Burkholderia pseudomallei
           K96243]
 gi|52211761|emb|CAH37760.1| putative LuxR-family transcriptional regulator [Burkholderia
           pseudomallei K96243]
          Length = 234

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L W   GKT+ EI+ ILGIS  TV  ++++  RK     R+ A+  A    
Sbjct: 173 DLTARERESLQWAGRGKTAWEISKILGISERTVVFHLSNAARKIGANNRAQAVVIASARG 232

Query: 245 IV 246
           ++
Sbjct: 233 LI 234


>gi|269837395|ref|YP_003319623.1| two component transcriptional regulator, LuxR family [Sphaerobacter
           thermophilus DSM 20745]
 gi|269786658|gb|ACZ38801.1| two component transcriptional regulator, LuxR family [Sphaerobacter
           thermophilus DSM 20745]
          Length = 249

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%)

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           K   L+ REVE L  +++G ++ EIA  L I+  TV N++ S++RK     R  A+  AV
Sbjct: 169 KRLPLSVREVEVLDCVAQGLSNKEIAEALFITEQTVKNHMTSVLRKLQVNDRVQAVLCAV 228

Query: 242 RNN 244
           RN 
Sbjct: 229 RNG 231


>gi|228469458|ref|ZP_04054466.1| transcriptional regulator, LuxR family domain protein
           [Porphyromonas uenonis 60-3]
 gi|228309033|gb|EEK17676.1| transcriptional regulator, LuxR family domain protein
           [Porphyromonas uenonis 60-3]
          Length = 201

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 38/66 (57%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
            K   L+ RE E +TW++ G T+ EIA +L +S +TV  +  +I  K    + SG   YA
Sbjct: 128 SKQNPLSQRECEVVTWVARGLTNKEIADVLHLSPHTVVTHRRNIAAKLDIHSPSGLTIYA 187

Query: 241 VRNNIV 246
           + NN++
Sbjct: 188 LMNNLI 193


>gi|170076532|ref|YP_001733171.1| response regulator receiver [Synechococcus sp. PCC 7002]
 gi|169887394|gb|ACB01102.1| Response regulator receiver, LuxR domain [Synechococcus sp. PCC
           7002]
          Length = 231

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 46/81 (56%)

Query: 166 AAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIM 225
           A +Q  M +       +D  LT RE E L  I+ GK++ EIA  L I+ +TV  ++ +I+
Sbjct: 138 AQFQQPMAEMPRSVPAQDNPLTQREGEILALIANGKSNSEIAETLYIAASTVRVHVHAIL 197

Query: 226 RKTATKTRSGAIAYAVRNNIV 246
           +K   + R+ A+  A+R+ ++
Sbjct: 198 QKLEARDRTQAVVIALRHGLI 218


>gi|325266892|ref|ZP_08133563.1| nitrate/nitrite response regulator protein NarL [Kingella
           denitrificans ATCC 33394]
 gi|324981633|gb|EGC17274.1| nitrate/nitrite response regulator protein NarL [Kingella
           denitrificans ATCC 33394]
          Length = 224

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE+E L  +S G ++  IA  L ++ +TV  ++ +I+RK    +R  A  YAV++N
Sbjct: 153 ELTARELEILGHLSAGHSNKIIARHLDLAESTVKVHVQNILRKLELDSRVQAAVYAVQHN 212

Query: 245 I 245
           I
Sbjct: 213 I 213


>gi|291300526|ref|YP_003511804.1| LuxR family two component transcriptional regulator [Stackebrandtia
           nassauensis DSM 44728]
 gi|290569746|gb|ADD42711.1| two component transcriptional regulator, LuxR family
           [Stackebrandtia nassauensis DSM 44728]
          Length = 224

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 37/60 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E LT I+ G+++ EIA  L IS  TV  +I ++  K A + R+ A+ YA R+ +
Sbjct: 161 LTKRESEVLTLIAAGRSNAEIARQLYISEATVKTHINNLFTKAALRDRAQAVTYAYRHGL 220


>gi|170721041|ref|YP_001748729.1| LuxR family transcriptional regulator [Pseudomonas putida W619]
 gi|169759044|gb|ACA72360.1| transcriptional regulator, LuxR family [Pseudomonas putida W619]
          Length = 82

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 39/74 (52%)

Query: 169 QANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKT 228
           +AN  +  D        LT RE + L W + GK+S EI  IL    +TVN ++ +I+RK 
Sbjct: 2   KANTQQIEDSQADTPIRLTPREQQVLLWCAYGKSSWEIGQILQCQESTVNFHVGNILRKF 61

Query: 229 ATKTRSGAIAYAVR 242
              TR  A+  A+R
Sbjct: 62  DVSTRVAAVIKAIR 75


>gi|56421574|ref|YP_148892.1| hypothetical protein GK3039 [Geobacillus kaustophilus HTA426]
 gi|56381416|dbj|BAD77324.1| hypothetical protein [Geobacillus kaustophilus HTA426]
          Length = 391

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 41/66 (62%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G+   L+ RE+E L  +++G ++ E A  L +S  TV +YI+S +RK   K R+ A+A A
Sbjct: 325 GRAESLSPREIEILKLLADGASTLEAACQLYLSEFTVRDYISSALRKLNAKNRTEAVAKA 384

Query: 241 VRNNIV 246
           +R  ++
Sbjct: 385 LRLGLI 390


>gi|238796086|ref|ZP_04639597.1| Transcriptional activator protein echR [Yersinia mollaretii ATCC
           43969]
 gi|238720031|gb|EEQ11836.1| Transcriptional activator protein echR [Yersinia mollaretii ATCC
           43969]
          Length = 240

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
            + RE E + W S GK+  EIA+ILG+   T+ N++  ++RK        AI+ AV 
Sbjct: 173 FSNRENEIIYWASVGKSYQEIALILGVKLTTIKNHMGKVVRKLGVTNAKHAISIAVE 229


>gi|254447404|ref|ZP_05060870.1| two-component system regulatory protein [gamma proteobacterium
           HTCC5015]
 gi|198262747|gb|EDY87026.1| two-component system regulatory protein [gamma proteobacterium
           HTCC5015]
          Length = 213

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 35/57 (61%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           G  ++LT REV  +  +SEG ++ EIA  L +   TV NY++S++ K   + R+ A+
Sbjct: 148 GDAYDLTAREVNIIELMSEGASNKEIAFRLDLKMGTVKNYVSSVLLKLGVRDRTQAV 204


>gi|284801354|ref|YP_003413219.1| hypothetical protein LM5578_1104 [Listeria monocytogenes 08-5578]
 gi|284994496|ref|YP_003416264.1| hypothetical protein LM5923_1058 [Listeria monocytogenes 08-5923]
 gi|284056916|gb|ADB67857.1| hypothetical protein LM5578_1104 [Listeria monocytogenes 08-5578]
 gi|284059963|gb|ADB70902.1| hypothetical protein LM5923_1058 [Listeria monocytogenes 08-5923]
          Length = 212

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 40/62 (64%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA +++
Sbjct: 148 DLTNRENEILLLIAEGKSNQEIADELFITLKTVKTHVSNILSKLGVQDRTQAAIYAFKHD 207

Query: 245 IV 246
           +V
Sbjct: 208 LV 209


>gi|30019588|ref|NP_831219.1| two-component response regulator yvqC [Bacillus cereus ATCC 14579]
 gi|206968465|ref|ZP_03229421.1| DNA-binding response regulator [Bacillus cereus AH1134]
 gi|218232967|ref|YP_002366221.1| DNA-binding response regulator [Bacillus cereus B4264]
 gi|296502111|ref|YP_003663811.1| two-component response regulator yvqC [Bacillus thuringiensis
           BMB171]
 gi|29895132|gb|AAP08420.1| Two-component response regulator yvqC [Bacillus cereus ATCC 14579]
 gi|206737385|gb|EDZ54532.1| DNA-binding response regulator [Bacillus cereus AH1134]
 gi|218160924|gb|ACK60916.1| DNA-binding response regulator [Bacillus cereus B4264]
 gi|296323163|gb|ADH06091.1| two-component response regulator yvqC [Bacillus thuringiensis
           BMB171]
 gi|326939160|gb|AEA15056.1| two-component response regulator yvqC [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 210

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K     R+ A+ YA R+ 
Sbjct: 148 DLTEREFEILLLIAEGKSNQEIADELFIALKTVKTHVSNILNKLNVSDRTQAVIYAFRHQ 207

Query: 245 I 245
           +
Sbjct: 208 L 208


>gi|56965136|ref|YP_176868.1| two-component response regulator [Bacillus clausii KSM-K16]
 gi|56911380|dbj|BAD65907.1| two-component response regulator [Bacillus clausii KSM-K16]
          Length = 209

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 44/80 (55%)

Query: 166 AAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIM 225
           A  Q  M  ++  +      LT RE+E L  +SEGKT+ +I+  L I+  TV  +++ I+
Sbjct: 127 AKVQGQMISAFTANVPLHQALTKRELEILKLMSEGKTNQQISEELYITIKTVKTHVSHIL 186

Query: 226 RKTATKTRSGAIAYAVRNNI 245
            K   + R+ A+ YA++  +
Sbjct: 187 AKLEVEDRTQAVIYALKEKL 206


>gi|298717240|ref|YP_003729882.1| transcriptional activator protein PagR [Pantoea vagans C9-1]
 gi|298361429|gb|ADI78210.1| Transcriptional activator protein PagR [Pantoea vagans C9-1]
          Length = 230

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           L+ RE + L W+S+GKT  EIA+IL I+  TV  ++ ++M+K        AI
Sbjct: 168 LSPRERQILKWVSDGKTYAEIAIILSIAERTVKFHMGNVMKKLGVNNARHAI 219


>gi|167578890|ref|ZP_02371764.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis TXDOH]
 gi|167616988|ref|ZP_02385619.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis Bt4]
 gi|257140903|ref|ZP_05589165.1| ATP-dependent transcription regulator LuxR [Burkholderia
           thailandensis E264]
          Length = 238

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L W   GKT+ EI+ ILGIS  TV  ++++  RK     R+ A+  A    
Sbjct: 177 DLTARERESLQWAGRGKTAWEISKILGISERTVVFHLSNAARKIGANNRAQAVVIASARG 236

Query: 245 IV 246
           ++
Sbjct: 237 LI 238


>gi|302525216|ref|ZP_07277558.1| predicted protein [Streptomyces sp. AA4]
 gi|302434111|gb|EFL05927.1| predicted protein [Streptomyces sp. AA4]
          Length = 511

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LTGREVE L  +++G ++ EIA  L +SR TV+ ++  I  K    TR+ A   A+R  +
Sbjct: 450 LTGREVEVLLQLAQGLSNPEIAAALTVSRKTVSTHLEHIYAKLGVTTRTQAALVAMRRGL 509


>gi|284028795|ref|YP_003378726.1| LuxR family two component transcriptional regulator [Kribbella
           flavida DSM 17836]
 gi|283808088|gb|ADB29927.1| two component transcriptional regulator, LuxR family [Kribbella
           flavida DSM 17836]
          Length = 200

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           D  LT RE++ L   SEG +  +IA  L ++  TV NY+++ MRKT  K+R  A  YA
Sbjct: 137 DNPLTDRELDALRLTSEGYSVADIATRLFLAEGTVRNYLSNAMRKTQAKSRHEAARYA 194


>gi|226304519|ref|YP_002764477.1| NarL family two-component response regulator [Rhodococcus
           erythropolis PR4]
 gi|226183634|dbj|BAH31738.1| putative NarL family two-component response regulator [Rhodococcus
           erythropolis PR4]
          Length = 220

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 43/66 (65%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G D  L+ RE++ +  +S+G  +++IA  L + ++TV ++I++I +K   +TR   + +A
Sbjct: 151 GSDHGLSAREMDVVQLLSQGLGNNDIADSLSLEQSTVKSHISNICKKLQVRTRVQIVIWA 210

Query: 241 VRNNIV 246
            RNN++
Sbjct: 211 YRNNVI 216


>gi|182413538|ref|YP_001818604.1| two component LuxR family transcriptional regulator [Opitutus
           terrae PB90-1]
 gi|177840752|gb|ACB75004.1| two component transcriptional regulator, LuxR family [Opitutus
           terrae PB90-1]
          Length = 301

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           LT RE E L W+++GKT+ EI  ILG +  TV  ++ +++ K   +TR   +A A+R
Sbjct: 237 LTPRETEILFWVAQGKTNAEIGTILGAAPATVKKHVENLLPKLGVETR---LAAALR 290


>gi|256420485|ref|YP_003121138.1| LuxR family transcriptional regulator [Chitinophaga pinensis DSM
           2588]
 gi|256035393|gb|ACU58937.1| two component transcriptional regulator, LuxR family [Chitinophaga
           pinensis DSM 2588]
          Length = 208

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 178 VHWGKDFE-LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           V   K+F  LT RE E L+ ISEG T+ EIA  L IS +TVN++   ++ K   K  +  
Sbjct: 138 VGLQKNFPPLTRREKEVLSLISEGNTNAEIAEKLFISADTVNSHRKKLLAKLEVKNTAML 197

Query: 237 IAYAVRNNIV 246
           I YAV N ++
Sbjct: 198 IKYAVDNKLL 207


>gi|224552996|gb|ACN54750.1| PagR [Pantoea sp. C9-1]
          Length = 210

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           L+ RE + L W+S+GKT  EIA+IL I+  TV  ++ ++M+K        AI
Sbjct: 148 LSPRERQILKWVSDGKTYAEIAIILSIAERTVKFHMGNVMKKLGVNNARHAI 199


>gi|51892061|ref|YP_074752.1| two-component response regulator [Symbiobacterium thermophilum IAM
           14863]
 gi|51855750|dbj|BAD39908.1| two-component response regulator [Symbiobacterium thermophilum IAM
           14863]
          Length = 218

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 36/61 (59%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +L+ RE+E L   S G T  EIA  L ++ +TV N++  I+ K   + RS A+ YA+R  
Sbjct: 150 QLSPREIEVLRLASTGLTYKEIAAKLYVAESTVKNHMRHILEKLHLRNRSEAVGYAIRTG 209

Query: 245 I 245
           +
Sbjct: 210 L 210


>gi|323489447|ref|ZP_08094676.1| two-component response regulator-like protein [Planococcus
           donghaensis MPA1U2]
 gi|323396941|gb|EGA89758.1| two-component response regulator-like protein [Planococcus
           donghaensis MPA1U2]
          Length = 213

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L  +++GK++ EIA  L ++  TV  +I++I  K A + R+ A  YAV++ 
Sbjct: 147 QLTPREQEVLAELTKGKSNREIASALFVTEKTVKTHISNIFIKLAVQDRTQAALYAVKHG 206

Query: 245 I 245
           +
Sbjct: 207 L 207


>gi|229196490|ref|ZP_04323234.1| DNA-binding response regulator [Bacillus cereus m1293]
 gi|228586846|gb|EEK44920.1| DNA-binding response regulator [Bacillus cereus m1293]
          Length = 214

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 37/58 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           LT RE E L  I++G+++ EIA +L I+  TV  ++++++ K     R+ A  YAV++
Sbjct: 149 LTKREQEVLREIAKGRSNKEIAAVLHITEQTVKTHVSNVLAKLEVDDRTQAALYAVKH 206


>gi|311899082|dbj|BAJ31490.1| putative two-component system response regulator [Kitasatospora
           setae KM-6054]
          Length = 215

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 39/65 (60%)

Query: 180 WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
            G+   LT RE E L+ I++G+++ EIA  L +S  TV  ++++I+ K     R+ A  +
Sbjct: 149 QGRGGNLTEREREVLSHIADGRSNREIARTLHLSEKTVKTHVSNILMKLDVADRTQAALW 208

Query: 240 AVRNN 244
           AVRN 
Sbjct: 209 AVRNQ 213


>gi|228951917|ref|ZP_04114015.1| hypothetical protein bthur0006_13310 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228807840|gb|EEM54361.1| hypothetical protein bthur0006_13310 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
          Length = 206

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K     R+ A+ YA R+ 
Sbjct: 144 DLTEREFEILLLIAEGKSNQEIADELFIALKTVKTHVSNILNKLNVSDRTQAVIYAFRHQ 203

Query: 245 I 245
           +
Sbjct: 204 L 204


>gi|319652400|ref|ZP_08006516.1| two-component system response regulator [Bacillus sp. 2_A_57_CT2]
 gi|317395862|gb|EFV76584.1| two-component system response regulator [Bacillus sp. 2_A_57_CT2]
          Length = 210

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 161 EIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNY 220
           E G+ A     + K  D     D  LT RE   L  I EG +++EIA  L IS  TV N 
Sbjct: 126 EEGVAAKVVPQLMKQQDTKE-PDPSLTPRERAILKCIGEGLSNNEIAERLAISTGTVKNN 184

Query: 221 IASIMRKTATKTRSGAIAYAVRNNIV 246
            + I+ K   + R+    YA+R+N+V
Sbjct: 185 TSQILTKLDLRDRTQLAIYAIRHNLV 210


>gi|298247591|ref|ZP_06971396.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
 gi|297550250|gb|EFH84116.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
          Length = 230

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
             LT RE + L  +++G+ S EIAV LGI+  TV  Y+ SI  K    +R+ A+A A+
Sbjct: 166 IALTKRERQVLAGVAQGERSKEIAVRLGITERTVRAYLTSIYTKLNVDSRASAVAVAL 223


>gi|162452375|ref|YP_001614742.1| LuxR family transcriptional regulator [Sorangium cellulosum 'So ce
           56']
 gi|161162957|emb|CAN94262.1| transcriptional regulator, LuxR family [Sorangium cellulosum 'So ce
           56']
          Length = 270

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (64%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
           LT RE+E L  +  GKT+ EIAV+L IS+ TV ++IA    K    +R+GA
Sbjct: 209 LTARELEVLRLVGVGKTNREIAVVLHISQKTVQHHIAHAYDKLGIYSRAGA 259


>gi|307824873|ref|ZP_07655096.1| transcriptional regulator, LuxR family [Methylobacter tundripaludum
           SV96]
 gi|307734231|gb|EFO05085.1| transcriptional regulator, LuxR family [Methylobacter tundripaludum
           SV96]
          Length = 236

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           L+ RE+E L W ++GKTS EI+ IL I+  TVN +I +++ K     ++ A   A 
Sbjct: 176 LSNREIEVLRWTADGKTSSEISCILNIAERTVNFHINNVVTKLNAANKTSATIKAA 231


>gi|294632670|ref|ZP_06711229.1| LuxR family two component transcriptional regulator [Streptomyces
           sp. e14]
 gi|292830451|gb|EFF88801.1| LuxR family two component transcriptional regulator [Streptomyces
           sp. e14]
          Length = 201

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LTGR+++ L  +++G  ++ IA  L  SR+TV N I  +M +   + R+ A+A+A+R  +
Sbjct: 141 LTGRQLDVLRLMADGHGNEAIAATLHCSRHTVKNVIYELMGQLQVRNRAHAVAHALRTGL 200

Query: 246 V 246
           +
Sbjct: 201 I 201


>gi|229494594|ref|ZP_04388357.1| two component transcriptional regulator, LuxR family [Rhodococcus
           erythropolis SK121]
 gi|229318956|gb|EEN84814.1| two component transcriptional regulator, LuxR family [Rhodococcus
           erythropolis SK121]
          Length = 220

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 43/66 (65%)

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           G D  L+ RE++ +  +S+G  +++IA  L + ++TV ++I++I +K   +TR   + +A
Sbjct: 151 GSDHGLSAREMDVVQLLSQGLGNNDIADSLSLEQSTVKSHISNICKKLQVRTRVQIVIWA 210

Query: 241 VRNNIV 246
            RNN++
Sbjct: 211 YRNNVI 216


>gi|224552933|gb|ACN54708.1| PagR [Pantoea agglomerans]
          Length = 210

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           H  K+  L+ RE + L W+  GKT  E+AVIL I+  TV  ++ ++M+K      + A+
Sbjct: 141 HQKKNVFLSPRERQILKWVGAGKTYAEVAVILSIAERTVKFHMGNVMKKLGVNNATHAV 199


>gi|195977721|ref|YP_002122965.1| TCS response regulator [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|225868974|ref|YP_002744922.1| response regulatory protein [Streptococcus equi subsp.
           zooepidemicus]
 gi|195974426|gb|ACG61952.1| TCS response regulator [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|225702250|emb|CAX00006.1| response regulatory protein [Streptococcus equi subsp.
           zooepidemicus]
          Length = 198

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           L+ +E+  L  I++GKTS EI+ IL +S  T+ NYI+SI  K     R  AI+ A  N 
Sbjct: 138 LSKQEMNILYLIAQGKTSKEISQILFLSNGTIRNYISSIFNKFGVSNRMEAISLAKENG 196


>gi|332142261|ref|YP_004427999.1| two-component response regulator [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327552283|gb|AEA99001.1| two-component response regulator [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 298

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 34/57 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +T RE E L WIS GKTS EI+ IL +S  T N ++  I +K     ++ A A A+R
Sbjct: 237 ITKRESEVLYWISFGKTSWEISQILDMSPRTANKHLEQIYKKLGVDNKTSAAAIALR 293


>gi|320160955|ref|YP_004174179.1| NarL family two-component response regulator [Anaerolinea
           thermophila UNI-1]
 gi|319994808|dbj|BAJ63579.1| NarL family two-component response regulator [Anaerolinea
           thermophila UNI-1]
          Length = 217

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+E L  ++EGK++ EIA  L IS  TV N+++SI+ K   K R  A+  A    I
Sbjct: 156 LSPREIEVLFLVAEGKSNREIAEQLVISEGTVKNHLSSILSKLGAKDRLQAVIRAREAGI 215

Query: 246 V 246
           +
Sbjct: 216 L 216


>gi|167736315|dbj|BAG07414.1| AHL-dependent transcriptional regulator [Gluconacetobacter
           intermedius]
          Length = 236

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT RE ECLTW ++GK+S E  +I+G+S  TVN +I + + K     R   +  A+
Sbjct: 174 LTPREKECLTWTAKGKSSWETGMIVGVSERTVNFHINNALLKLKCTNRIMGVVRAI 229


>gi|85058263|ref|YP_453965.1| transcriptional activator protein [Sodalis glossinidius str.
           'morsitans']
 gi|84778783|dbj|BAE73560.1| transcriptional activator protein [Sodalis glossinidius str.
           'morsitans']
          Length = 245

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT RE+E L W S GKT  EIA+I+GI+ +TV  +I +++ K        AI  A 
Sbjct: 181 LTSREIEALHWASIGKTYREIAIIMGITESTVKFHIGNLIVKLDVINAKHAIKKAT 236


>gi|325168564|ref|YP_004280354.1| LuxR family transcriptional regulator [Agrobacterium sp. H13-3]
 gi|325064287|gb|ADY67976.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
          Length = 240

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 33/59 (55%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           L+ RE E LTW + G+   EIA  LG+S  T+ N++  I  +    T + AI  A+RN 
Sbjct: 178 LSDREREVLTWTAAGRRQFEIAATLGLSERTIENHLRRIRHRLGVSTTAQAIRIAIRNG 236


>gi|323464084|gb|ADX76237.1| two-component response regulator [Staphylococcus pseudintermedius
           ED99]
          Length = 208

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 37/62 (59%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +L+ RE E L  +++GKT+ EIA  L +S  T+  +++ I  K     R+ A  YA+ N+
Sbjct: 147 KLSKRETEVLKEMAKGKTNKEIAETLFVSEKTIKTHVSHIFSKLEVTDRTQAAIYAMENH 206

Query: 245 IV 246
           +V
Sbjct: 207 LV 208


>gi|311103688|ref|YP_003976541.1| LuxR family transcriptional regulator [Achromobacter xylosoxidans
           A8]
 gi|310758377|gb|ADP13826.1| bacterial regulatory protein, LuxR family protein 2 [Achromobacter
           xylosoxidans A8]
          Length = 83

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ R+  CL W + GKTS E A ILG+S +TVN ++ +   K   + R  A+  A+R  +
Sbjct: 18  LSERQASCLHWAALGKTSWETARILGVSESTVNFHLCNACEKLGVRGRRAAVVAALRLGL 77

Query: 246 V 246
           +
Sbjct: 78  I 78


>gi|270490280|ref|ZP_06207354.1| transcriptional regulator, LuxR family [Yersinia pestis KIM D27]
 gi|270338784|gb|EFA49561.1| transcriptional regulator, LuxR family [Yersinia pestis KIM D27]
          Length = 104

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%)

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           RE E L W S GKT  EIA+ILGI ++TV  +I +I+RK        AI   +
Sbjct: 44  RENEILYWASVGKTYSEIAIILGIKKSTVKFHIGNIVRKLGVLNAKHAIRLGI 96


>gi|261880312|ref|ZP_06006739.1| LuxR family transcriptional regulator [Prevotella bergensis DSM
           17361]
 gi|270333002|gb|EFA43788.1| LuxR family transcriptional regulator [Prevotella bergensis DSM
           17361]
          Length = 197

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 34/62 (54%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EL+GRE+E LT I EG  + EIA  L I   TV  +  +IM K   K+ S    YAV + 
Sbjct: 131 ELSGREIEVLTLIVEGYINKEIAHQLNIGLTTVITHRKNIMDKLGVKSVSALTIYAVMHG 190

Query: 245 IV 246
            V
Sbjct: 191 YV 192


>gi|171914768|ref|ZP_02930238.1| DNA-binding response regulator, LuxR family protein
           [Verrucomicrobium spinosum DSM 4136]
          Length = 212

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 38/64 (59%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D+ L+ RE E L  + +G    EIA  L +S +TV+ Y+  + RK    TR+GA+A A++
Sbjct: 149 DYGLSTRERETLELMVQGFIRKEIADRLNLSLHTVDTYLRGVYRKLEVNTRTGAVAKALK 208

Query: 243 NNIV 246
             +V
Sbjct: 209 EGLV 212


>gi|301385893|ref|ZP_07234311.1| LuxR family regulatory protein [Pseudomonas syringae pv. tomato
           Max13]
 gi|302061837|ref|ZP_07253378.1| LuxR family regulatory protein [Pseudomonas syringae pv. tomato
           K40]
 gi|302130857|ref|ZP_07256847.1| LuxR family regulatory protein [Pseudomonas syringae pv. tomato
           NCPPB 1108]
          Length = 149

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 38/58 (65%), Gaps = 1/58 (1%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRK-TATKTRSGAIAYAV 241
           +L+ REVE L W+++GKT + I  +LG++  TV ++  +IM+K  AT   + A+  A+
Sbjct: 88  KLSTREVEVLKWVADGKTGEVIGKVLGVTERTVTHHTVNIMQKLNATNKTAAAVKAAL 145


>gi|209547915|ref|YP_002279832.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533671|gb|ACI53606.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 248

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ RE+ CL    +G+ S+EIA  LG+S +TVN Y+ S   K  +  R  AIA A+R
Sbjct: 187 LSEREIACLQLAGDGRISEEIADKLGLSVHTVNAYLGSATIKLDSVNRIQAIAKAIR 243


>gi|329851959|ref|ZP_08266640.1| response regulator [Asticcacaulis biprosthecum C19]
 gi|328839808|gb|EGF89381.1| response regulator [Asticcacaulis biprosthecum C19]
          Length = 219

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 39/76 (51%)

Query: 171 NMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTAT 230
           + F++       D  LTGRE E L  ++ G T  E+A  LG++ +TV  Y+  I +K   
Sbjct: 144 DHFRTQAPKADPDVALTGRETETLALLARGLTIAEVARHLGLAHSTVAGYVKLIYQKLNI 203

Query: 231 KTRSGAIAYAVRNNIV 246
            TR  A  +AV+  + 
Sbjct: 204 STRVEATLHAVKRGLA 219


>gi|319781695|ref|YP_004141171.1| LuxR family transcription regulator [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167583|gb|ADV11121.1| regulatory protein LuxR [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 256

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 57/113 (50%), Gaps = 9/113 (7%)

Query: 139 RIRIGLMLLFPKGRIILRDRLWEI-----GLLAAYQANMFKSYDVHWGKDFELTGREVEC 193
           R + GL++       + +D L+E+      L AA      +  D   G+   ++ RE+EC
Sbjct: 147 RGQCGLVVFLGSEMTLQQDALYEVHARCFSLFAAVA--RIRPGDA--GRMRAISKRELEC 202

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L   + G TS+EIA +L +S +T N Y+    +K     R+ A+A A+R  ++
Sbjct: 203 LKLTANGNTSEEIARLLKLSVHTANQYLTQSTQKLNAVNRNQAVAKALRLGLI 255


>gi|269128235|ref|YP_003301605.1| LuxR family two component transcriptional regulator
           [Thermomonospora curvata DSM 43183]
 gi|268313193|gb|ACY99567.1| two component transcriptional regulator, LuxR family
           [Thermomonospora curvata DSM 43183]
          Length = 253

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE+E L  ++ G  + EIA  L IS NTV N++ +I+ K    +R  A+ YAVR  
Sbjct: 189 KLTEREMEVLRLVARGLGNREIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAVREK 248

Query: 245 IV 246
           ++
Sbjct: 249 LL 250


>gi|228938652|ref|ZP_04101257.1| hypothetical protein bthur0008_13160 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228957814|ref|ZP_04119555.1| hypothetical protein bthur0005_13270 [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228971533|ref|ZP_04132157.1| hypothetical protein bthur0003_13110 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228978144|ref|ZP_04138522.1| hypothetical protein bthur0002_13470 [Bacillus thuringiensis Bt407]
 gi|229126854|ref|ZP_04255866.1| hypothetical protein bcere0015_13110 [Bacillus cereus BDRD-Cer4]
 gi|229144139|ref|ZP_04272554.1| hypothetical protein bcere0012_13030 [Bacillus cereus BDRD-ST24]
 gi|229149739|ref|ZP_04277969.1| hypothetical protein bcere0011_12970 [Bacillus cereus m1550]
 gi|229177946|ref|ZP_04305318.1| hypothetical protein bcere0005_13090 [Bacillus cereus 172560W]
 gi|229189620|ref|ZP_04316635.1| hypothetical protein bcere0002_12980 [Bacillus cereus ATCC 10876]
 gi|228593884|gb|EEK51688.1| hypothetical protein bcere0002_12980 [Bacillus cereus ATCC 10876]
 gi|228605434|gb|EEK62883.1| hypothetical protein bcere0005_13090 [Bacillus cereus 172560W]
 gi|228633770|gb|EEK90369.1| hypothetical protein bcere0011_12970 [Bacillus cereus m1550]
 gi|228639358|gb|EEK95773.1| hypothetical protein bcere0012_13030 [Bacillus cereus BDRD-ST24]
 gi|228656794|gb|EEL12620.1| hypothetical protein bcere0015_13110 [Bacillus cereus BDRD-Cer4]
 gi|228781616|gb|EEM29816.1| hypothetical protein bthur0002_13470 [Bacillus thuringiensis Bt407]
 gi|228788192|gb|EEM36147.1| hypothetical protein bthur0003_13110 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228801896|gb|EEM48772.1| hypothetical protein bthur0005_13270 [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228821028|gb|EEM67048.1| hypothetical protein bthur0008_13160 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
          Length = 206

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K     R+ A+ YA R+ 
Sbjct: 144 DLTEREFEILLLIAEGKSNQEIADELFIALKTVKTHVSNILNKLNVSDRTQAVIYAFRHQ 203

Query: 245 I 245
           +
Sbjct: 204 L 204


>gi|312136161|ref|YP_004003499.1| two component transcriptional regulator, luxr family
           [Caldicellulosiruptor owensensis OL]
 gi|311776212|gb|ADQ05699.1| two component transcriptional regulator, LuxR family
           [Caldicellulosiruptor owensensis OL]
          Length = 213

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%)

Query: 173 FKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKT 232
           F+++ ++  K   L+ RE+E    I++G ++ +I+ IL IS  TV NYI+SI+ K   K 
Sbjct: 142 FQNHSINENKLKNLSERELEIARLIAQGYSNKDISKILFISEGTVRNYISSILEKLELKN 201

Query: 233 RSGAIAYAVRN 243
           R+    Y   N
Sbjct: 202 RTQIAVYYFSN 212


>gi|218682848|ref|ZP_03530449.1| transcriptional regulator, LuxR family protein [Rhizobium etli CIAT
           894]
          Length = 230

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE+E + W ++GKTS EI  IL +S +TVN Y+ + ++K     R+  +A A+R  +
Sbjct: 169 LSIRELEVVRWTAQGKTSIEIGQILTLSDHTVNAYMTNAIKKLDCVNRTQLVAKAIRLKL 228

Query: 246 V 246
           +
Sbjct: 229 I 229


>gi|124516028|gb|EAY57537.1| putative two component transcriptional regulator, LuxR family
           [Leptospirillum rubarum]
          Length = 211

 Score = 46.6 bits (109), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 38/64 (59%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  L+ RE E L  +S+G ++ EI  I GIS +TV  +I SI+ K +  TR+ A   A++
Sbjct: 148 DNPLSPRETEILKLLSKGLSNREIGDIAGISLSTVKAHIQSILEKLSASTRADAAVKAIK 207

Query: 243 NNIV 246
             ++
Sbjct: 208 KGLI 211


>gi|297579900|ref|ZP_06941827.1| predicted protein [Vibrio cholerae RC385]
 gi|297535546|gb|EFH74380.1| predicted protein [Vibrio cholerae RC385]
          Length = 224

 Score = 46.6 bits (109), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%)

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           T RE E L W+  GK++ EI+ +L IS  TV  ++ +I RK  T  R+ AIA A+
Sbjct: 163 TDRECELLPWLKLGKSNWEISRLLNISERTVKYHLQNIYRKLETHNRTHAIAKAI 217


>gi|262278733|ref|ZP_06056518.1| response regulator [Acinetobacter calcoaceticus RUH2202]
 gi|262259084|gb|EEY77817.1| response regulator [Acinetobacter calcoaceticus RUH2202]
          Length = 319

 Score = 46.6 bits (109), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 34/55 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           +LT RE E + W+  GKT+ +IA IL +S  TVN ++  +  K   + R+ A+A+
Sbjct: 256 QLTQREAEVMHWLLLGKTNKDIAEILELSPRTVNKHLEHVFEKLCVENRTAAVAH 310


>gi|223934982|ref|ZP_03626901.1| two component transcriptional regulator, LuxR family [bacterium
           Ellin514]
 gi|223896435|gb|EEF62877.1| two component transcriptional regulator, LuxR family [bacterium
           Ellin514]
          Length = 213

 Score = 46.6 bits (109), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 37/58 (63%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           L+ RE E L W+++GK++ +IA ILG+S  TV  ++A I      ++R+ A+  A+ +
Sbjct: 151 LSRREAEVLLWVAQGKSNGDIADILGLSEFTVKRHMAGIFDTLGVQSRNAAMLRALES 208


>gi|167645498|ref|YP_001683161.1| LuxR family transcriptional regulator [Caulobacter sp. K31]
 gi|167347928|gb|ABZ70663.1| transcriptional regulator, LuxR family [Caulobacter sp. K31]
          Length = 137

 Score = 46.6 bits (109), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
              LTG+EV+ L  ++ G+++ EIA  LG+S NTV  +IA +  K A   R+ AI  A
Sbjct: 73  SLGLTGQEVKVLERLAAGQSNKEIAAALGLSPNTVKTHIAHLFEKLAVSRRTQAIGKA 130


>gi|148555438|ref|YP_001263020.1| regulatory protein LuxR [Sphingomonas wittichii RW1]
 gi|148500628|gb|ABQ68882.1| regulatory protein, LuxR [Sphingomonas wittichii RW1]
          Length = 879

 Score = 46.6 bits (109), Expect = 0.004,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 33/58 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           +F L+ RE E +  ++EG  + EIAV LGIS  TV  +   I  K    +RS AIA A
Sbjct: 816 NFTLSPRETEIIALVAEGYITKEIAVRLGISEGTVKTHRKKIHEKLGVASRSQAIARA 873


>gi|87123539|ref|ZP_01079390.1| response regulator like protein [Synechococcus sp. RS9917]
 gi|86169259|gb|EAQ70515.1| response regulator like protein [Synechococcus sp. RS9917]
          Length = 231

 Score = 46.6 bits (109), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 47/78 (60%), Gaps = 4/78 (5%)

Query: 169 QANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKT 228
           +AN+ +  D    +   L+ R++E L  ++EG ++ EIA  L I+ NTV ++++ IM++ 
Sbjct: 157 EANVMEPSD----QGVVLSERQLEILALVAEGLSNREIATQLQITANTVRDHLSEIMQRL 212

Query: 229 ATKTRSGAIAYAVRNNIV 246
               R+ A++ A+R  ++
Sbjct: 213 GVGNRASAVSSALRLRLI 230


>gi|77458474|ref|YP_347979.1| LuxR family transcriptional regulator [Pseudomonas fluorescens
           Pf0-1]
 gi|77382477|gb|ABA73990.1| putative transcriptional regulator, LuxR family [Pseudomonas
           fluorescens Pf0-1]
          Length = 239

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 67/155 (43%), Gaps = 24/155 (15%)

Query: 94  EKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFD----VARIRIGLMLLFP 149
           +  + Y +++ P+    P  H L   +  P G++    SL  +     AR+R+ L +L  
Sbjct: 101 QSGELYRLVRVPS---GPGVHGLQIPVFGPQGLEG-AMSLGGEQIDASARVRLALGMLAS 156

Query: 150 KGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVI 209
                 R RL E  L            D   GK   L+ RE E L W++ G+   +IA  
Sbjct: 157 VAFFSAR-RLLEAPL------------DETAGK---LSTREREVLAWVAAGRRQADIAAT 200

Query: 210 LGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           LG+S  TV N++ S  R     T + AI  A+R  
Sbjct: 201 LGLSGRTVENHLRSARRHLGVATTAQAIKIAIRKG 235


>gi|225872367|ref|YP_002753822.1| two-component system response regulator [Acidobacterium capsulatum
           ATCC 51196]
 gi|225794530|gb|ACO34620.1| two-component system response regulator [Acidobacterium capsulatum
           ATCC 51196]
          Length = 214

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  ++EGK++ E A +LG S  TV     ++MRK   +  S  + YAVRN++
Sbjct: 152 LTPREGEVLQLLAEGKSTKEAASVLGTSTFTVETQRKNVMRKLRLRNVSDLVRYAVRNHM 211

Query: 246 V 246
           +
Sbjct: 212 I 212


>gi|148554913|ref|YP_001262495.1| regulatory protein LuxR [Sphingomonas wittichii RW1]
 gi|148500103|gb|ABQ68357.1| regulatory protein, LuxR [Sphingomonas wittichii RW1]
          Length = 278

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           LT  EV CL W++ GKT DEIA I+G +R T+  ++ +   K     RS A+
Sbjct: 202 LTRLEVNCLRWVARGKTDDEIATIMGRARPTIRFHLQNAAIKLGAANRSQAV 253


>gi|317492389|ref|ZP_07950818.1| luxR family bacterial regulatory protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316919728|gb|EFV41058.1| luxR family bacterial regulatory protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 215

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 43/76 (56%)

Query: 165 LAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASI 224
           +A+Y  +    Y  H  +   LT RE E L  +  G ++ EIA +L IS NTV  ++ ++
Sbjct: 134 VASYLISQSSHYRYHSPEATGLTQREKEILNKLRAGASNTEIAKLLFISENTVKTHLYNL 193

Query: 225 MRKTATKTRSGAIAYA 240
            +K + K R+ A+++A
Sbjct: 194 FKKISVKNRTQAVSWA 209


>gi|228990549|ref|ZP_04150514.1| hypothetical protein bpmyx0001_13110 [Bacillus pseudomycoides DSM
           12442]
 gi|228996650|ref|ZP_04156289.1| hypothetical protein bmyco0003_12370 [Bacillus mycoides Rock3-17]
 gi|229004298|ref|ZP_04162099.1| hypothetical protein bmyco0002_12630 [Bacillus mycoides Rock1-4]
 gi|228757159|gb|EEM06403.1| hypothetical protein bmyco0002_12630 [Bacillus mycoides Rock1-4]
 gi|228763282|gb|EEM12190.1| hypothetical protein bmyco0003_12370 [Bacillus mycoides Rock3-17]
 gi|228769075|gb|EEM17673.1| hypothetical protein bpmyx0001_13110 [Bacillus pseudomycoides DSM
           12442]
          Length = 210

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K     R+ A+ YA R+ 
Sbjct: 148 DLTEREFEILLLIAEGKSNQEIADELFIALKTVKTHVSNILNKLNVSDRTQAVIYAFRHQ 207

Query: 245 I 245
           +
Sbjct: 208 L 208


>gi|224552912|gb|ACN54694.1| PagR [Pantoea agglomerans]
 gi|224552930|gb|ACN54706.1| PagR [Pantoea agglomerans]
 gi|224552963|gb|ACN54728.1| PagR [Pantoea agglomerans]
 gi|224552966|gb|ACN54730.1| PagR [Pantoea agglomerans]
          Length = 210

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           H  K+  L+ RE + L W+  GKT  E+AVIL I+  TV  ++ ++M+K      + A+
Sbjct: 141 HQKKNVFLSPRERQILKWVGAGKTYAEVAVILSIAERTVKFHMGNVMKKLGVNNATHAV 199


>gi|166798330|gb|ABY89693.1| transcriptional regulator [Mesorhizobium loti]
          Length = 243

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 34/61 (55%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE ECL W + GK+  EI+ ILGIS +T   ++ +   K     R  A+A A+R   
Sbjct: 182 LTPRERECLQWAAVGKSEWEISQILGISEHTSEKHLLNAKSKLGAVNRVQAVAEAIRRGY 241

Query: 246 V 246
           +
Sbjct: 242 I 242


>gi|89097699|ref|ZP_01170587.1| YhcZ [Bacillus sp. NRRL B-14911]
 gi|89087558|gb|EAR66671.1| YhcZ [Bacillus sp. NRRL B-14911]
          Length = 211

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 38/62 (61%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE++ L  I++GK++ EIA  L I+  TV  ++++++ K     R+ A   AVR  
Sbjct: 150 ELTKRELDVLKEIAKGKSNKEIAASLFITEKTVKTHVSNLLSKLEISDRTQAALLAVREK 209

Query: 245 IV 246
           +V
Sbjct: 210 LV 211


>gi|125973782|ref|YP_001037692.1| two component LuxR family transcriptional regulator [Clostridium
           thermocellum ATCC 27405]
 gi|256004513|ref|ZP_05429492.1| two component transcriptional regulator, LuxR family [Clostridium
           thermocellum DSM 2360]
 gi|281417939|ref|ZP_06248959.1| two component transcriptional regulator, LuxR family [Clostridium
           thermocellum JW20]
 gi|125714007|gb|ABN52499.1| two component transcriptional regulator, LuxR family [Clostridium
           thermocellum ATCC 27405]
 gi|255991518|gb|EEU01621.1| two component transcriptional regulator, LuxR family [Clostridium
           thermocellum DSM 2360]
 gi|281409341|gb|EFB39599.1| two component transcriptional regulator, LuxR family [Clostridium
           thermocellum JW20]
 gi|316940025|gb|ADU74059.1| two component transcriptional regulator, LuxR family [Clostridium
           thermocellum DSM 1313]
          Length = 216

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE+E L  I++G  + EIA  L IS  TV N++++I +K     R+ A  YA ++N
Sbjct: 154 DLTPRELEVLELIAQGLINKEIAKRLFISEKTVKNHVSNIFKKLNVSDRTQAAIYAYKHN 213

Query: 245 I 245
           I
Sbjct: 214 I 214


>gi|284034369|ref|YP_003384300.1| LuxR family transcriptional regulator [Kribbella flavida DSM 17836]
 gi|283813662|gb|ADB35501.1| transcriptional regulator, LuxR family [Kribbella flavida DSM
           17836]
          Length = 199

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (58%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           D  LT RE E L  ++ G T+ EIA  L +S  TV NY++ I+ KT  ++R  AI  A
Sbjct: 136 DNPLTDRECEVLRQVTTGATAQEIARTLSLSAGTVRNYLSRILTKTGARSRIEAIRKA 193


>gi|171058317|ref|YP_001790666.1| two component LuxR family transcriptional regulator [Leptothrix
           cholodnii SP-6]
 gi|170775762|gb|ACB33901.1| two component transcriptional regulator, LuxR family [Leptothrix
           cholodnii SP-6]
          Length = 236

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 34/61 (55%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LTGRE + L  + +G  + EI  +L IS NTVN Y+  + RK    +R+ A   A R  +
Sbjct: 175 LTGREEDVLRMMGKGHKAAEIGRLLAISVNTVNGYVREVYRKLGISSRAEAAIEATRRGL 234

Query: 246 V 246
           +
Sbjct: 235 L 235


>gi|157370075|ref|YP_001478064.1| LuxR family transcriptional regulator [Serratia proteamaculans 568]
 gi|157321839|gb|ABV40936.1| transcriptional regulator, LuxR family [Serratia proteamaculans
           568]
          Length = 238

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (73%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRK 227
           LT RE + L W SEGKTS+E A+++G+S  TVN +I + ++K
Sbjct: 178 LTLREKDILRWCSEGKTSEETALLMGLSERTVNFHIGNSIKK 219


>gi|21311443|gb|AAM46724.1|AF452135_9 LuxR2 [Aliivibrio salmonicida]
          Length = 223

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (57%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +LT RE ECL W  EGK+  EI+ ILG S  TV  ++A+   K     R  +I+ A+
Sbjct: 158 KLTKREKECLIWSCEGKSRWEISKILGCSERTVTFHLANSQLKLGANNRCQSISKAI 214


>gi|319785576|ref|YP_004145052.1| Autoinducer-binding domain protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317171464|gb|ADV15002.1| Autoinducer-binding domain protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 243

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 85/197 (43%), Gaps = 29/197 (14%)

Query: 72  QKLDSIVSSDWPFD-LVRCMALSEKDKYYNVLQRPTELFCPV-FHTLPENITPPAGMDNR 129
           Q+   ++  DWP + L R +A +  D +  V+    +L  P  +H   + I     +D  
Sbjct: 53  QQKQHVLLCDWPGEWLERYVARNYVD-HDPVVSHMKQLQAPFQWHEASQGIR----IDKS 107

Query: 130 YCSLTFDVARIRIGLMLLFP----KGRIILRDRLWEIGLLAAY---QANMFKSYDVHWGK 182
              +  D    ++   L FP     G+I++     E   L+A    Q ++  +Y V  G+
Sbjct: 108 SGEVMGDAGAFKLRDGLAFPLITLDGQIVMVSLGGEAVELSAAEFGQVSLVSTYAV--GR 165

Query: 183 DFEL-------------TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTA 229
             +L             T RE ECL W + GK+  EI+ ILGIS +T   ++ +   K  
Sbjct: 166 AMQLHTMANRTIDHIVLTPRERECLQWAAVGKSEWEISQILGISEHTSEKHLLNAKSKLG 225

Query: 230 TKTRSGAIAYAVRNNIV 246
              R  A+A A+R   +
Sbjct: 226 AVNRVQAVAEAIRRGYI 242


>gi|300689864|ref|YP_003750859.1| transcriptional activator protein solR [Ralstonia solanacearum
           PSI07]
 gi|299076924|emb|CBJ49537.1| Transcriptional activator protein solR [Ralstonia solanacearum
           PSI07]
          Length = 236

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           LT RE E L W  EGKT+ EI  IL IS  TVN ++ +++ K A   +  A+  A+
Sbjct: 176 LTAREREVLCWTGEGKTAYEIGQILRISERTVNFHVNNVLLKLAATNKVQAVVKAI 231


>gi|224552939|gb|ACN54712.1| PagR [Pantoea agglomerans pv. gypsophilae]
 gi|224552942|gb|ACN54714.1| PagR [Pantoea agglomerans pv. gypsophilae]
          Length = 210

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           H  K+  L+ RE + L W+  GKT  E+AVIL I+  TV  ++ ++M+K      + A+
Sbjct: 141 HQKKNVFLSPRERQILKWVGAGKTYAEVAVILSIAERTVKFHMGNVMKKLGVNNATHAV 199


>gi|167564970|ref|ZP_02357886.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia oklahomensis EO147]
 gi|167572172|ref|ZP_02365046.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia oklahomensis C6786]
          Length = 238

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L W   GKT+ EI+ ILGIS  TV  ++++  RK     R+ A+  A    
Sbjct: 177 DLTARERESLQWAGRGKTAWEISKILGISERTVVFHLSNAARKIGANNRAQAVVIASARG 236

Query: 245 IV 246
           ++
Sbjct: 237 LI 238


>gi|134101943|ref|YP_001107604.1| two-component response regulator [Saccharopolyspora erythraea NRRL
           2338]
 gi|133914566|emb|CAM04679.1| two-component response regulator [Saccharopolyspora erythraea NRRL
           2338]
          Length = 156

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REV+ L  +++G + +EIA  L  S  T+ N +   M++   + R+ A+AYA+R  I
Sbjct: 96  LTSREVDVLHGVADGLSLEEIAQKLAYSERTIKNILYQFMKRLGLRNRAHAVAYAIRLGI 155

Query: 246 V 246
           +
Sbjct: 156 I 156


>gi|299065227|emb|CBJ36393.1| Transcriptional activator protein solR [Ralstonia solanacearum
           CMR15]
          Length = 236

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W  EGKT+ EI  IL IS  TVN ++ +++ K A   +  A+  A+   +
Sbjct: 176 LTAREREVLCWTGEGKTAYEIGQILRISERTVNFHVNNVLLKLAATNKVQAVVKAIAIGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|237801455|ref|ZP_04589916.1| regulatory protein, LuxR [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331024314|gb|EGI04371.1| regulatory protein, LuxR [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 77

 Score = 46.2 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 34/55 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           LT RE+E L W +EGKT+  IA+IL +   T++ +IAS ++K     ++ A   A
Sbjct: 17  LTQREIEVLKWSAEGKTAGAIAIILCLKERTIHFHIASAIQKMGVCNKTAAAVRA 71


>gi|224552903|gb|ACN54688.1| PagR [Pantoea agglomerans]
 gi|224552906|gb|ACN54690.1| PagR [Pantoea agglomerans]
          Length = 210

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           H  K+  L+ RE + L W+  GKT  E+AVIL I+  TV  ++ ++M+K      + A+
Sbjct: 141 HQKKNVFLSPRERQILKWVGAGKTYAEVAVILSIAERTVKFHMGNVMKKLGVNNATHAV 199


>gi|261420594|ref|YP_003254276.1| LuxR family transcriptional regulator [Geobacillus sp. Y412MC61]
 gi|319768265|ref|YP_004133766.1| LuxR family transcriptional regulator [Geobacillus sp. Y412MC52]
 gi|261377051|gb|ACX79794.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. Y412MC61]
 gi|317113131|gb|ADU95623.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. Y412MC52]
          Length = 224

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           LT RE E L  +++GK++  I   L IS  TV N+++SI++K +   R+ A+  A++N 
Sbjct: 161 LTRRECEVLQLLADGKSNRAIGEALYISEKTVKNHVSSILQKLSVNDRTQAVVVAIKNG 219


>gi|224552945|gb|ACN54716.1| PagR [Pantoea agglomerans]
          Length = 210

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           H  K+  L+ RE + L W+  GKT  E+AVIL I+  TV  ++ ++M+K      + A+
Sbjct: 141 HQKKNVFLSPRERQILKWVGAGKTYAEVAVILSIAERTVKFHMGNVMKKLGVNNATHAV 199


>gi|163735012|ref|ZP_02142449.1| two-component response regulator, putative [Roseobacter litoralis
           Och 149]
 gi|161391794|gb|EDQ16126.1| two-component response regulator, putative [Roseobacter litoralis
           Och 149]
          Length = 303

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 33/59 (55%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           F LT RE E L W+S GK + +IA IL +S  T+N ++  + +K     R+ A   A R
Sbjct: 240 FGLTPREAEVLYWLSLGKPNRDIAQILSLSSRTINKHLEQVFQKMGVDNRTAAAVAADR 298


>gi|5162957|gb|AAD40485.1|AF079973_1 luxR homolog YpsR [Yersinia pseudotuberculosis]
          Length = 245

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 32/57 (56%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
            + RE E L W S GKT  EIA+ILGI ++TV  +I +I+RK        AI   + 
Sbjct: 182 FSPRENEILYWASVGKTYSEIAIILGIKKSTVKFHIGNIVRKLGVLNAKHAIRLGIE 238


>gi|83716463|ref|YP_440275.1| ATP-dependent transcription regulator LuxR [Burkholderia
           thailandensis E264]
 gi|83650288|gb|ABC34352.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia thailandensis E264]
          Length = 425

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L W   GKT+ EI+ ILGIS  TV  ++++  RK     R+ A+  A    
Sbjct: 364 DLTARERESLQWAGRGKTAWEISKILGISERTVVFHLSNAARKIGANNRAQAVVIASARG 423

Query: 245 IV 246
           ++
Sbjct: 424 LI 425


>gi|126433549|ref|YP_001069240.1| response regulator receiver protein [Mycobacterium sp. JLS]
 gi|126233349|gb|ABN96749.1| response regulator receiver protein [Mycobacterium sp. JLS]
          Length = 207

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE++ L  I+EG  + EIA  L  S+ TV N +  +  +   + RS A+AYAVR  +
Sbjct: 147 LTDREIKVLRLIAEGHDTSEIAQQLCYSQRTVKNVLHDVTTRLQLRNRSHAVAYAVREGL 206

Query: 246 V 246
           +
Sbjct: 207 I 207


>gi|332162143|ref|YP_004298720.1| quorum-sensing transcriptional activator [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|1723596|sp|P54295|YENR_YEREN RecName: Full=Transcriptional activator protein yenR
 gi|773400|emb|CAA53694.1| yenR [Yersinia enterocolitica]
 gi|318606195|emb|CBY27693.1| quorum-sensing transcriptional activator YpeR [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325666373|gb|ADZ43017.1| quorum-sensing transcriptional activator [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330864049|emb|CBX74127.1| transcriptional activator protein yenR [Yersinia enterocolitica
           W22703]
          Length = 244

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 164 LLAAYQANMFKSYDVHWGKDFEL-TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIA 222
           +L  YQ+N  K+ + +   + ++ + RE E L W S GKT  EI++ILGI R+TV  +I 
Sbjct: 158 MLGLYQSNSDKNENRNTQIERDIFSPRENEILYWASVGKTYAEISIILGIKRSTVKFHIG 217

Query: 223 SIMRKTATKTRSGAIAYAV 241
           +++RK        AI   +
Sbjct: 218 NVVRKLGVLNAKHAIRLGI 236


>gi|224552948|gb|ACN54718.1| PagR [Pantoea agglomerans]
          Length = 210

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           H  K+  L+ RE + L W+  GKT  E+AVIL I+  TV  ++ ++M+K      + A+
Sbjct: 141 HQKKNVFLSPRERQILKWVGAGKTYAEVAVILSIAERTVKFHMGNVMKKLGVNNATHAV 199


>gi|159044364|ref|YP_001533158.1| putative transcriptional regulator [Dinoroseobacter shibae DFL 12]
 gi|157912124|gb|ABV93557.1| putative transcriptional regulator [Dinoroseobacter shibae DFL 12]
          Length = 265

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +  L+ RE E L W++ GK+   IA ILG+S +TV+  +  I RK     R+ AI  A+ 
Sbjct: 194 EIALSARETEVLGWMARGKSKTVIADILGLSPHTVDTLVRRIFRKLEVFDRTAAILKAIN 253

Query: 243 NNIV 246
             +V
Sbjct: 254 LGLV 257


>gi|22298266|ref|NP_681513.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
 gi|22294445|dbj|BAC08275.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
          Length = 209

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 37/64 (57%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D+ L+ RE++ L  + EG ++ EIA  L +S NTV  ++  I+ K A   R  A   A+R
Sbjct: 146 DYHLSQRELDVLKLMVEGYSNPEIAGKLFLSPNTVKTHVRGILNKLAVDDRVQAAVVALR 205

Query: 243 NNIV 246
           N +V
Sbjct: 206 NGLV 209


>gi|257867775|ref|ZP_05647428.1| regulatory protein [Enterococcus casseliflavus EC30]
 gi|257874102|ref|ZP_05653755.1| regulatory protein [Enterococcus casseliflavus EC10]
 gi|257801858|gb|EEV30761.1| regulatory protein [Enterococcus casseliflavus EC30]
 gi|257808266|gb|EEV37088.1| regulatory protein [Enterococcus casseliflavus EC10]
          Length = 209

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA ++ 
Sbjct: 147 DLTNREQEVLLLIAEGKSNQEIADALFITLKTVKTHVSNILSKLEVEDRTQATIYAFKHG 206

Query: 245 IV 246
           ++
Sbjct: 207 LI 208


>gi|224552981|gb|ACN54740.1| PagR [Pantoea agglomerans]
          Length = 210

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           H  K+  L+ RE + L W+  GKT  E+AVIL I+  TV  ++ ++M+K      + A+
Sbjct: 141 HQKKNVFLSPRERQILKWVGAGKTYAEVAVILSIAERTVKFHMGNVMKKLGVNNATHAV 199


>gi|17548004|ref|NP_521406.1| transcriptional activator SOLR transcription regulator protein
           [Ralstonia solanacearum GMI1000]
 gi|20140008|sp|P58590|SOLR1_RALSO RecName: Full=Transcriptional activator protein solR
 gi|17430310|emb|CAD17075.1| transcriptional activator solr. transcription regulator protein
           [Ralstonia solanacearum GMI1000]
          Length = 236

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L W  EGKT+ EI  IL IS  TVN ++ +++ K A   +  A+  A+   +
Sbjct: 176 LTAREREVLCWTGEGKTAYEIGQILRISERTVNFHVNNVLLKLAATNKVQAVVKAIAIGL 235

Query: 246 V 246
           +
Sbjct: 236 I 236


>gi|296268221|ref|YP_003650853.1| LuxR family two component transcriptional regulator [Thermobispora
           bispora DSM 43833]
 gi|296091008|gb|ADG86960.1| two component transcriptional regulator, LuxR family [Thermobispora
           bispora DSM 43833]
          Length = 206

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +  LT RE E L  I+ G+++ EIA  L ++  TV  ++++++ K   + R+ A  YAVR
Sbjct: 143 EIALTAREREVLRLIAAGRSNREIARELSVAEKTVKTHVSNVLMKLGVQDRTQAALYAVR 202

Query: 243 NNIV 246
             +V
Sbjct: 203 RGLV 206


>gi|291007045|ref|ZP_06565018.1| two-component response regulator [Saccharopolyspora erythraea NRRL
           2338]
          Length = 175

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REV+ L  +++G + +EIA  L  S  T+ N +   M++   + R+ A+AYA+R  I
Sbjct: 115 LTSREVDVLHGVADGLSLEEIAQKLAYSERTIKNILYQFMKRLGLRNRAHAVAYAIRLGI 174

Query: 246 V 246
           +
Sbjct: 175 I 175


>gi|196229624|ref|ZP_03128488.1| two component transcriptional regulator, LuxR family
           [Chthoniobacter flavus Ellin428]
 gi|196225950|gb|EDY20456.1| two component transcriptional regulator, LuxR family
           [Chthoniobacter flavus Ellin428]
          Length = 213

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           L GREVE L  +++G    EI   LGIS +TVN++I  I  K   ++RS A+A
Sbjct: 154 LAGREVEVLGLLAQGYLYKEIGESLGISTHTVNSHIRRIYEKLHVRSRSQAVA 206


>gi|333029774|ref|ZP_08457835.1| transcriptional regulator, LuxR family [Bacteroides coprosuis DSM
           18011]
 gi|332740371|gb|EGJ70853.1| transcriptional regulator, LuxR family [Bacteroides coprosuis DSM
           18011]
          Length = 206

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 167 AYQANMFKSYD-VHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIM 225
           A++ N  K+ + ++  +  EL+ RE++ ++ I+ GKT+ EIA  L IS+ TV  +  +I 
Sbjct: 121 AHEPNHSKNMEAINAHQVHELSPREIDVISLIAVGKTNKEIAKKLSISQTTVITHRKNIT 180

Query: 226 RKTATKTRSGAIAYAVRN 243
            K   K+ SG   YAV N
Sbjct: 181 DKLGIKSVSGLTIYAVIN 198


>gi|302521432|ref|ZP_07273774.1| two-component system response regulator [Streptomyces sp. SPB78]
 gi|302430327|gb|EFL02143.1| two-component system response regulator [Streptomyces sp. SPB78]
          Length = 264

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I
Sbjct: 201 LTDREMEVLKLVATGMNNKDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKI 260

Query: 246 V 246
           +
Sbjct: 261 L 261


>gi|229916670|ref|YP_002885316.1| two component transcriptional regulator, LuxR family
           [Exiguobacterium sp. AT1b]
 gi|229468099|gb|ACQ69871.1| two component transcriptional regulator, LuxR family
           [Exiguobacterium sp. AT1b]
          Length = 230

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 39/57 (68%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           L+ REVE L  +++G+++ +I+ +L IS  TV N+++S++RK     R+ A+  A+R
Sbjct: 168 LSRREVEVLHLLADGRSNRDISDMLFISEKTVKNHVSSVLRKMDVNDRTQAVVDAIR 224


>gi|320106060|ref|YP_004181650.1| two component LuxR family transcriptional regulator [Terriglobus
           saanensis SP1PR4]
 gi|319924581|gb|ADV81656.1| two component transcriptional regulator, LuxR family [Terriglobus
           saanensis SP1PR4]
          Length = 207

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 39/62 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I++G+++ EIA  L I+  TV  +++S++ K   + R+ A  YA++  
Sbjct: 143 ELTPRESEVLICITQGRSNREIAEQLRIAEKTVRIHVSSVLDKMGARDRTQATIYALQRG 202

Query: 245 IV 246
           +V
Sbjct: 203 LV 204


>gi|158333709|ref|YP_001514881.1| two-component LuxR family transcriptional regulator [Acaryochloris
           marina MBIC11017]
 gi|158303950|gb|ABW25567.1| two-component transcriptional regulator, LuxR family [Acaryochloris
           marina MBIC11017]
          Length = 209

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 35/56 (62%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           ELT RE E L  I+EG+++ EIA  L IS  TV N++ SI+++   + R+ A   A
Sbjct: 148 ELTPRETEVLALIAEGQSNREIAEALYISERTVKNHVNSILKRLNVRDRTQAAILA 203


>gi|254777627|ref|ZP_05219143.1| hypothetical protein MaviaA2_23561 [Mycobacterium avium subsp.
           avium ATCC 25291]
          Length = 218

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (59%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE++ LT I +G ++ EIA  L IS  TV ++I  I  K   + R+ AI YA  N 
Sbjct: 154 ELTTRELDVLTLIGKGLSNSEIADELCISGVTVKSHIGRIFGKLDLRDRAAAIVYAYDNG 213

Query: 245 IV 246
           IV
Sbjct: 214 IV 215


>gi|284991375|ref|YP_003409929.1| two component LuxR family transcriptional regulator
           [Geodermatophilus obscurus DSM 43160]
 gi|284064620|gb|ADB75558.1| two component transcriptional regulator, LuxR family
           [Geodermatophilus obscurus DSM 43160]
          Length = 219

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E +  I+EG +S EIA +L IS  TV  + A+I++K   + R+    YA+R  +
Sbjct: 157 LTAREAEVVKLIAEGCSSREIAALLVISTKTVERHRANILQKLDMRDRTQLTRYAIRTGL 216

Query: 246 V 246
           +
Sbjct: 217 L 217


>gi|229087841|ref|ZP_04219955.1| Two-component response regulator [Bacillus cereus Rock3-44]
 gi|228695477|gb|EEL48348.1| Two-component response regulator [Bacillus cereus Rock3-44]
          Length = 189

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 34/61 (55%)

Query: 180 WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           W +   L+ RE E L    EGKT++EIA  L +S  TV NYI+ ++ K   K R  AI  
Sbjct: 123 WQEQNPLSDREKEVLLLAKEGKTANEIAKALYLSPGTVRNYISEVLTKLDAKNRIEAITI 182

Query: 240 A 240
           A
Sbjct: 183 A 183


>gi|224552951|gb|ACN54720.1| PagR [Pantoea agglomerans]
 gi|224552954|gb|ACN54722.1| PagR [Pantoea agglomerans]
 gi|224552957|gb|ACN54724.1| PagR [Pantoea agglomerans]
 gi|224552960|gb|ACN54726.1| PagR [Pantoea agglomerans]
          Length = 210

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           H  K+  L+ RE + L W+  GKT  E+AVIL I+  TV  ++ ++M+K      + A+
Sbjct: 141 HQKKNVFLSPRERQILKWVGAGKTYAEVAVILSIAERTVKFHMGNVMKKLGVNNATHAV 199


>gi|224552936|gb|ACN54710.1| PagR [Pantoea agglomerans]
          Length = 210

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           H  K+  L+ RE + L W+  GKT  E+AVIL I+  TV  ++ ++M+K      + A+
Sbjct: 141 HQKKNVFLSPRERQILKWVGAGKTYAEVAVILSIAERTVKFHMGNVMKKLGVNNATHAV 199


>gi|254410670|ref|ZP_05024449.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
 gi|196182876|gb|EDX77861.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
          Length = 216

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 38/63 (60%)

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             LT RE + L  ++ G ++ EI   L +S  T+  Y++S++RKT T  R+  + +A+ N
Sbjct: 153 LHLTQREQQVLDLLTTGLSNSEIGNKLHLSPRTIEKYVSSLLRKTETSNRAEIVRFALEN 212

Query: 244 NIV 246
           ++V
Sbjct: 213 HLV 215


>gi|224552978|gb|ACN54738.1| PagR [Pantoea agglomerans]
          Length = 210

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           H  K+  L+ RE + L W+  GKT  E+AVIL I+  TV  ++ ++M+K      + A+
Sbjct: 141 HQKKNVFLSPRERQILKWVXAGKTYAEVAVILSIAERTVKFHMGNVMKKLGVNNATHAV 199


>gi|218528264|ref|YP_002419080.1| LuxR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218520567|gb|ACK81152.1| transcriptional regulator, LuxR family [Methylobacterium
           chloromethanicum CM4]
          Length = 500

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 35/61 (57%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE + L  I +G T  EIA  LG+S +TV N++AS+ RK     RS  + +A    
Sbjct: 425 KLTRRERDLLLGICKGATDSEIAAELGLSLSTVRNHLASLYRKIGVNRRSAVVVWARERG 484

Query: 245 I 245
           I
Sbjct: 485 I 485


>gi|26990830|ref|NP_746255.1| LuxR family transcriptional regulator [Pseudomonas putida KT2440]
 gi|148546967|ref|YP_001267069.1| LuxR family transcriptional regulator [Pseudomonas putida F1]
 gi|24985838|gb|AAN69719.1|AE016608_5 transcriptional regulator, LuxR family [Pseudomonas putida KT2440]
 gi|148511025|gb|ABQ77885.1| regulatory protein, LuxR [Pseudomonas putida F1]
 gi|313498014|gb|ADR59380.1| LuxR family transcriptional regulator [Pseudomonas putida BIRD-1]
          Length = 82

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           LT RE + L W + GK+S EI  IL    +TVN ++++I+RK    TR  A+  A+R
Sbjct: 19  LTPREQQVLLWCAYGKSSWEIGQILECKESTVNFHVSNILRKFEVPTRVAAVIKAIR 75


>gi|314934012|ref|ZP_07841377.1| DNA-binding response regulator VraR [Staphylococcus caprae C87]
 gi|313654162|gb|EFS17919.1| DNA-binding response regulator VraR [Staphylococcus caprae C87]
          Length = 207

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 36/62 (58%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +L+ REVE L  + +GKT+ EIA  L +S  T+  +++ I  K     R+ A  YA+ N 
Sbjct: 146 KLSKREVEVLREMVKGKTNKEIAQTLFVSEKTIKTHVSHIFNKLQVTDRTQAAIYAMENK 205

Query: 245 IV 246
           ++
Sbjct: 206 LI 207


>gi|254822986|ref|ZP_05227987.1| hypothetical protein MintA_23864 [Mycobacterium intracellulare ATCC
           13950]
          Length = 518

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 33/61 (54%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT REVE L  ++ G ++ EIA  L IS  T  N++     K     R GA  YA+R+ +
Sbjct: 453 LTPREVEVLCLVARGASNKEIAASLVISEKTARNHVERTYAKIGVSNRIGASMYALRHGL 512

Query: 246 V 246
           V
Sbjct: 513 V 513


>gi|240140620|ref|YP_002965100.1| putative transcriptional regulator, PAS domain S-box
           [Methylobacterium extorquens AM1]
 gi|240010597|gb|ACS41823.1| putative transcriptional regulator, PAS domain S-box
           [Methylobacterium extorquens AM1]
          Length = 500

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 35/61 (57%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE + L  I +G T  EIA  LG+S +TV N++AS+ RK     RS  + +A    
Sbjct: 425 KLTRRERDLLLGICKGATDSEIAAELGLSLSTVRNHLASLYRKIGVNRRSAVVVWARERG 484

Query: 245 I 245
           I
Sbjct: 485 I 485


>gi|13471875|ref|NP_103442.1| hypothetical protein mll1989 [Mesorhizobium loti MAFF303099]
 gi|14022619|dbj|BAB49228.1| mll1989 [Mesorhizobium loti MAFF303099]
          Length = 525

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           +T RE+E L  I+ G T+ E+A  L IS  T +++I S+  K    TR+ A  YAV + +
Sbjct: 458 MTPREIEVLRLIATGLTAKEVARKLDISPKTADHHIESVYSKIGVTTRAAAALYAVEHGL 517

Query: 246 V 246
           V
Sbjct: 518 V 518


>gi|220933015|ref|YP_002509923.1| two component transcriptional regulator, LuxR family
           [Halothermothrix orenii H 168]
 gi|219994325|gb|ACL70928.1| two component transcriptional regulator, LuxR family
           [Halothermothrix orenii H 168]
          Length = 211

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EL+ RE E L  +++G ++ +IA  L IS  TV N++++I+RK +   R+ A+  A++  
Sbjct: 147 ELSSREQEVLELLAQGMSNKQIAQELFISEKTVKNHVSNILRKLSVNDRTQAVIVALKRG 206

Query: 245 IV 246
           +V
Sbjct: 207 LV 208


>gi|318056754|ref|ZP_07975477.1| two-component system response regulator [Streptomyces sp. SA3_actG]
 gi|318078616|ref|ZP_07985948.1| two-component system response regulator [Streptomyces sp. SA3_actF]
 gi|333024919|ref|ZP_08452983.1| putative two-component system response regulator [Streptomyces sp.
           Tu6071]
 gi|332744771|gb|EGJ75212.1| putative two-component system response regulator [Streptomyces sp.
           Tu6071]
          Length = 250

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (60%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I
Sbjct: 187 LTDREMEVLKLVATGMNNKDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKI 246

Query: 246 V 246
           +
Sbjct: 247 L 247


>gi|196040971|ref|ZP_03108268.1| DNA-binding response regulator [Bacillus cereus NVH0597-99]
 gi|196028139|gb|EDX66749.1| DNA-binding response regulator [Bacillus cereus NVH0597-99]
          Length = 71

 Score = 46.2 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 34/61 (55%)

Query: 180 WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
           W +   L+ RE E L    EGKT++EIA  L +S  TV NYI+ ++ K   K R  AI  
Sbjct: 5   WQEQNPLSDREKEVLLLAKEGKTANEIAKALYLSPGTVRNYISEVLTKLDAKNRIEAITI 64

Query: 240 A 240
           A
Sbjct: 65  A 65


>gi|325474944|gb|EGC78130.1| hypothetical protein HMPREF9353_00977 [Treponema denticola F0402]
          Length = 140

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 38/64 (59%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +F L+ +E+E +  +SEG ++ +IA   G+S  T+ N I+ I  KT    R+   A+A +
Sbjct: 77  EFGLSQKEIEIIRLVSEGLSNKQIAYKQGLSEGTIKNNISVIFDKTFVSDRTQLAAFAFK 136

Query: 243 NNIV 246
           N IV
Sbjct: 137 NGIV 140


>gi|254563130|ref|YP_003070225.1| transcriptional regulator, PAS domain S-box [Methylobacterium
           extorquens DM4]
 gi|254270408|emb|CAX26408.1| putative transcriptional regulator, PAS domain S-box
           [Methylobacterium extorquens DM4]
          Length = 500

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 35/61 (57%)

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE + L  I +G T  EIA  LG+S +TV N++AS+ RK     RS  + +A    
Sbjct: 425 KLTRRERDLLLGICKGATDSEIAAELGLSLSTVRNHLASLYRKIGVNRRSAVVVWARERG 484

Query: 245 I 245
           I
Sbjct: 485 I 485


>gi|251787751|ref|YP_003002472.1| LuxR family transcriptional regulator [Dickeya zeae Ech1591]
 gi|247536372|gb|ACT04993.1| transcriptional regulator, LuxR family [Dickeya zeae Ech1591]
          Length = 250

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
            + RE E L W S GKT  EIA+ILGI+ +TV  +I ++++K        AI   V  N+
Sbjct: 180 FSQRENEILYWASMGKTYQEIALILGITTSTVKFHIGNVVKKLGVLNAKHAIRLGVEMNL 239

Query: 246 V 246
           +
Sbjct: 240 I 240


>gi|118465118|ref|YP_884392.1| two-component system response regulator [Mycobacterium avium 104]
 gi|118166405|gb|ABK67302.1| two-component system response regulator [Mycobacterium avium 104]
          Length = 218

 Score = 46.2 bits (108), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 37/68 (54%)

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
           H     ELT RE + LT I +G ++ EIA  L IS  TV ++I  I  K   + R+ AI 
Sbjct: 148 HGAAIAELTTRERDVLTLIGKGLSNSEIADELCISGVTVKSHIGRIFGKLDLRDRAAAIV 207

Query: 239 YAVRNNIV 246
           YA  N IV
Sbjct: 208 YAYDNGIV 215


>gi|329935276|ref|ZP_08285242.1| two-component system response regulator [Streptomyces
           griseoaurantiacus M045]
 gi|329305099|gb|EGG48958.1| two-component system response regulator [Streptomyces
           griseoaurantiacus M045]