PSIBLAST alignment of GI: 254780694 and protein with PDB id: 3qp5

>gi|327200684|pdb|3QP5|A Chain A, Crystal Structure Of Cvir Bound To Antagonist Chlorolactone (Cl) Length = 265
>gi|327200685|pdb|3QP5|B Chain B, Crystal Structure Of Cvir Bound To Antagonist Chlorolactone (Cl) Length = 265
 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 36/225 (16%), Positives = 74/225 (32%), Gaps = 19/225 (8%)

Query: 37  IPLDCTVSWTMRMYALTEYVGASHFLLVRW---DLFQEQKLDSIVSSDWPFDLVRCMALS 93
             ++        +  +     +   LL      +  Q Q+L+ +++  +P D +      
Sbjct: 32  GHIETENELKAFLDQVLSQAPSERLLLALGRLNNQNQIQRLERVLNVSYPSDWLDQYMKE 91

Query: 94  EKDKYYNVLQRPTELFCPVFHT------------LPENITPPAGMDNRYCSLTFDVARIR 141
              ++  +L+       PV                        GM +             
Sbjct: 92  NYAQHDPILRIHLGQ-GPVMWEERFNRAKGAEEKRFIAEATQNGMGSGITFSAASERNNI 150

Query: 142 IGLMLLFPKGRIILRDRLWEIGLLAAYQAN---MFKSYDVHWGKDFELTGREVECLTWIS 198
             ++ +  +        +  +  L  +         +       +  L+ RE +   W+S
Sbjct: 151 GSILSIAGREPGRNAALVAMLNCLTPHLHQAAIRVANLPPASPSNMPLSQREYDIFHWMS 210

Query: 199 EGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
            GKT+ EIA IL IS  TV  ++A+++RK     R+ AI   +  
Sbjct: 211 RGKTNWEIATILDISERTVKFHVANVIRKLNANNRTHAIVLGMHL 255