BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780694|ref|YP_003065107.1| probable transcriptional
regulator protein, LuxR family [Candidatus Liberibacter asiaticus str.
psy62]
         (246 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780694|ref|YP_003065107.1| probable transcriptional regulator protein, LuxR family [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040371|gb|ACT57167.1| probable transcriptional regulator protein, LuxR family [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 246

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 246/246 (100%), Positives = 246/246 (100%)

Query: 1   MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASH 60
           MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASH
Sbjct: 1   MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASH 60

Query: 61  FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI 120
           FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI
Sbjct: 61  FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI 120

Query: 121 TPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW 180
           TPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW
Sbjct: 121 TPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW 180

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA
Sbjct: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240

Query: 241 VRNNIV 246
           VRNNIV
Sbjct: 241 VRNNIV 246


>gi|315121859|ref|YP_004062348.1| probable transcriptional regulator protein, LuxR family [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495261|gb|ADR51860.1| probable transcriptional regulator protein, LuxR family [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 246

 Score =  218 bits (555), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 224/246 (91%), Positives = 234/246 (95%)

Query: 1   MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASH 60
           MNFE+QQVNIVLNREDEQRTS VSHLPTRSDLLARMIPLD TVS  MRMYALTEYVGASH
Sbjct: 1   MNFEMQQVNIVLNREDEQRTSIVSHLPTRSDLLARMIPLDRTVSSKMRMYALTEYVGASH 60

Query: 61  FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI 120
           FLLVRWDLFQEQKLDS+VSSDWPFDLVRCM LSEKDKYYNVLQRP ELFCPVFH LPENI
Sbjct: 61  FLLVRWDLFQEQKLDSVVSSDWPFDLVRCMTLSEKDKYYNVLQRPAELFCPVFHILPENI 120

Query: 121 TPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW 180
             P+GMDNRYC+LTFDV RIRIGLMLLFPKGRI+ +DRLWEIGLLAAYQANMFK+Y+VH 
Sbjct: 121 DLPSGMDNRYCALTFDVGRIRIGLMLLFPKGRIVSQDRLWEIGLLAAYQANMFKNYNVHL 180

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           GKDFELTGRE+ECLTWISEGKTSDEIAVILGISRNT+NNYIASIMRKTATKTRSGAIAYA
Sbjct: 181 GKDFELTGREIECLTWISEGKTSDEIAVILGISRNTINNYIASIMRKTATKTRSGAIAYA 240

Query: 241 VRNNIV 246
           VRNNIV
Sbjct: 241 VRNNIV 246


>gi|241203092|ref|YP_002974188.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856982|gb|ACS54649.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 248

 Score =  198 bits (504), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 120/229 (52%), Positives = 155/229 (67%), Gaps = 2/229 (0%)

Query: 20  TSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVS 79
           ++ V  L  R +LL R+  +  T      + ALT+YVGAS++LL R DL QE  LD IVS
Sbjct: 20  SAAVPDLLPRDELLQRLHGVASTGRLQSGLRALTDYVGASYYLLARCDLLQESGLDFIVS 79

Query: 80  SDWPFDLVRCMALS--EKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           SDWPFDLVR +A            L++  ++F P F  LP++   P G   +YCS+TF+V
Sbjct: 80  SDWPFDLVRDIANDLVRGYARSTELEKCMQVFQPNFALLPDSAEVPDGASRQYCSVTFNV 139

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
            R R+ LM LF +G I+  +RL ++GLLA Y A+  +       +DFELT RE+ECL WI
Sbjct: 140 GRSRLALMFLFGEGFILSPERLRDVGLLAGYVASFLRCGGTKVDRDFELTDRELECLFWI 199

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +EGKTSDEIA+ILGISRNT+NNYI S+MRKTATKTRS AIA+AVRNN+V
Sbjct: 200 AEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIAFAVRNNLV 248


>gi|209547914|ref|YP_002279831.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533670|gb|ACI53605.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 248

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 121/229 (52%), Positives = 154/229 (67%), Gaps = 2/229 (0%)

Query: 20  TSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVS 79
           ++ V  L  R  LL R+  +  T      + ALTEYVGASH+LL R DL QE  LD IVS
Sbjct: 20  SAVVPDLLPRDQLLQRLHGVANTGRLQSGLRALTEYVGASHYLLARCDLLQESGLDFIVS 79

Query: 80  SDWPFDLVRCMALS--EKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           SDWPFDLVR +A            L++  ++F P F  +P++   P G   +YCS+TF+V
Sbjct: 80  SDWPFDLVRDIANDLVRGYARSTELEKCMQVFQPNFALMPDSADVPDGASRQYCSVTFNV 139

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
            R R+ LM LF +G I+  +RL ++GLLA Y A+  +       +DFELT RE+ECL WI
Sbjct: 140 GRSRLALMFLFGEGFILSPERLRDVGLLAGYVASFLRCGGTRVDRDFELTDRELECLFWI 199

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +EGKTSDEIA+ILGISRNT+NNYI S+MRKTATKTRS AIA+AVRNN+V
Sbjct: 200 AEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIAFAVRNNLV 248


>gi|190890349|ref|YP_001976891.1| transcriptional regulator protein, LuxR family [Rhizobium etli CIAT
           652]
 gi|190695628|gb|ACE89713.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CIAT 652]
          Length = 248

 Score =  195 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 120/229 (52%), Positives = 154/229 (67%), Gaps = 2/229 (0%)

Query: 20  TSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVS 79
           ++    L  R +L+ R+  +  T      + ALTEYVGASH+LL R DL QE  LD +VS
Sbjct: 20  SAVAPALLPRDELIQRLHSVASTGRLQSGLRALTEYVGASHYLLARCDLIQESGLDFVVS 79

Query: 80  SDWPFDLVRCMALSEK--DKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           SDWPFDLV+ +A            L++  ++F P F  LPE+   P G   +YCSLTF+V
Sbjct: 80  SDWPFDLVKDIANDLVSGYARSTELEKCMQVFQPNFALLPESAAVPEGASRQYCSLTFNV 139

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
            R R+ LM LF +G I+  +RL ++GLLA Y A+  +       +DFELT RE+ECL WI
Sbjct: 140 GRSRLALMFLFGEGFILSPERLRDVGLLAGYVASFLRCGGARVDRDFELTDRELECLFWI 199

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +EGKTSDEIA+ILGISRNT+NNYI S+MRKTATKTRS AIA+AVRNN+V
Sbjct: 200 AEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIAFAVRNNLV 248


>gi|82940562|emb|CAJ44291.1| putative transcription regulator protein MotR, LuxR family
           [Rhizobium leguminosarum bv. viciae]
          Length = 248

 Score =  195 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 121/229 (52%), Positives = 154/229 (67%), Gaps = 2/229 (0%)

Query: 20  TSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVS 79
           ++ V  L  R  LL R+  +  +      + ALT+YVGASH+LL R DL QE  LD IVS
Sbjct: 20  SAVVPDLLPRDKLLQRLHGVTSSGRLQSGLRALTDYVGASHYLLARCDLLQESGLDFIVS 79

Query: 80  SDWPFDLVRCMALS--EKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           SDWPFDLVR +A            L+R  ++F P F  LP++   P G   +YCS+TF+V
Sbjct: 80  SDWPFDLVRDIANDLVRGYARSTELERCMQVFQPNFALLPDSAEVPDGASRQYCSVTFNV 139

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
            R R+ LM LF +G I+  +RL ++GLLA Y A+  +       +DFELT RE+ECL WI
Sbjct: 140 GRSRLALMFLFGEGFILSPERLRDVGLLAGYVASFLRCGGTRVDRDFELTDRELECLFWI 199

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +EGKTSDEIA+ILGISRNT+NNYI S+MRKTATKTRS AIA+AVRNN+V
Sbjct: 200 AEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIAFAVRNNLV 248


>gi|116250468|ref|YP_766306.1| GerE/LuxR family transcriptional regulator [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115255116|emb|CAK06190.1| regulator of flagellar and motility genes, also regulates rem
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 262

 Score =  195 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 121/229 (52%), Positives = 155/229 (67%), Gaps = 2/229 (0%)

Query: 20  TSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVS 79
           ++ V  L  R +LL R+  +  T      + ALT+YVGASH+LL R DL QE  LD IVS
Sbjct: 34  SAVVPDLLPRDELLQRLHGVASTGRLQSGLRALTDYVGASHYLLARCDLLQESGLDFIVS 93

Query: 80  SDWPFDLVRCMALS--EKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           SDWPFDLVR +A            L++  ++F P F  LP++   P G   +YCS+TF+V
Sbjct: 94  SDWPFDLVRDIANDLVRGYARSTELEKCMQVFQPNFALLPDSAEVPDGASRQYCSVTFNV 153

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
            R R+ LM LF +G I+  +RL ++GLLA Y A+  +       +DFELT RE+ECL WI
Sbjct: 154 GRSRLSLMFLFGEGFILSPERLRDVGLLAGYVASFLRCGGTKVDRDFELTDRELECLFWI 213

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +EGKTSDEIA+ILGISRNT+NNYI S+MRKTATKTRS AIA+AVRNN+V
Sbjct: 214 AEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIAFAVRNNLV 262


>gi|262283887|gb|ACY40751.1| VisN [Rhizobium leguminosarum bv. viciae]
          Length = 262

 Score =  195 bits (495), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 121/229 (52%), Positives = 155/229 (67%), Gaps = 2/229 (0%)

Query: 20  TSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVS 79
           ++ V  L  R +LL R+  +  T      + ALT+YVGASH+LL R DL QE  LD IVS
Sbjct: 34  SAVVPDLLPRDELLLRLHGVASTGRLQSGLRALTDYVGASHYLLARCDLLQESGLDFIVS 93

Query: 80  SDWPFDLVRCMALS--EKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           SDWPFDLVR +A            L++  ++F P F  LP++   P G   +YCS+TF+V
Sbjct: 94  SDWPFDLVRDIANDLVRGYARSTELEKCMQVFQPNFALLPDSAEVPDGASRQYCSVTFNV 153

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
            R R+ LM LF +G I+  +RL ++GLLA Y A+  +       +DFELT RE+ECL WI
Sbjct: 154 GRSRLALMFLFGEGFILSPERLRDVGLLAGYVASFLRCGGTKVDRDFELTDRELECLFWI 213

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +EGKTSDEIA+ILGISRNT+NNYI S+MRKTATKTRS AIA+AVRNN+V
Sbjct: 214 AEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIAFAVRNNLV 262


>gi|86356298|ref|YP_468190.1| LuxR family transcriptional regulator [Rhizobium etli CFN 42]
 gi|86280400|gb|ABC89463.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CFN 42]
          Length = 234

 Score =  192 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 121/229 (52%), Positives = 152/229 (66%), Gaps = 2/229 (0%)

Query: 20  TSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVS 79
           +     L  R +L+ R+  +  T      + ALT+YVGASH+LL R DL QE  LD IVS
Sbjct: 6   SVVAPALLPRDELVRRLHGVADTGRLQSGLRALTDYVGASHYLLARCDLIQESGLDFIVS 65

Query: 80  SDWPFDLVRCMALSEK--DKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           SDWPFDLVR +A            L++  ++F P F  LPE    P G   +YCSLTF+V
Sbjct: 66  SDWPFDLVRDIANDLVSTYARSTELEKCMQVFQPNFALLPEGADVPEGASRQYCSLTFNV 125

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
            R R+ LM LF +G I+  +RL ++GLLA Y A+  +       +DFELT RE+ECL WI
Sbjct: 126 GRSRLALMFLFGEGFILSPERLRDVGLLAGYIASFLRCGGAKVDRDFELTDRELECLFWI 185

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +EGKTSDEIA+ILGISRNT+NNYI S+MRKTATKTRS AIA+AVRNN+V
Sbjct: 186 AEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIAFAVRNNLV 234


>gi|227821019|ref|YP_002824989.1| putative LuxR/GerE family transcriptional regulator [Sinorhizobium
           fredii NGR234]
 gi|227340018|gb|ACP24236.1| putative LuxR/GerE family transcriptional regulator [Sinorhizobium
           fredii NGR234]
          Length = 257

 Score =  183 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 55/253 (21%), Positives = 104/253 (41%), Gaps = 20/253 (7%)

Query: 13  NREDEQRTSFVSH--LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQ 70
            R  +  T+ ++   LP   D  + +  L+        M  +T   G   FL+       
Sbjct: 5   ARMQDTMTTGMTDVELPRGGDFASEIAKLETQFDIIRYMRRITHIFGFKTFLICSIPPID 64

Query: 71  EQKLDSI-VSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT-------- 121
            ++L +  V S+ P +L+         ++   ++R  E   P   TL +  +        
Sbjct: 65  MERLSAATVISNMPAELLNKYDSLSMLRFSTGVRRLRETTTPFQITLEDWESEGGTPDSA 124

Query: 122 -------PPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFK 174
                     G+         D    R  ++L+ P+  + +   + E+ ++A +  N   
Sbjct: 125 ADYIVMLRENGIFQANYFPVHDAEGGRGAVILMGPEADLPMTAAM-ELQMIAIHVYNRLA 183

Query: 175 SYDVHW-GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
                W      L+ RE++CL+W + GKTS EIA ILG+S +TVN+Y+  + +K     R
Sbjct: 184 EIGSVWKSSSTTLSEREIQCLSWTAAGKTSAEIAGILGLSEHTVNHYLNHVTKKLDAVNR 243

Query: 234 SGAIAYAVRNNIV 246
           + A+  A++   +
Sbjct: 244 TQAVVKAMKKGYI 256


>gi|15964582|ref|NP_384935.1| putative transcription regulator protein [Sinorhizobium meliloti
           1021]
 gi|307309328|ref|ZP_07588991.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
 gi|307320064|ref|ZP_07599485.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|15073760|emb|CAC45401.1| Putative transcriptional regulator [Sinorhizobium meliloti 1021]
 gi|306894279|gb|EFN25044.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306900197|gb|EFN30815.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
          Length = 277

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 52/239 (21%), Positives = 100/239 (41%), Gaps = 18/239 (7%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI-VSSDWP 83
            LP   D  + +  L+        M  +T+  G   FL+      + ++L +  V S+ P
Sbjct: 39  DLPRGGDFASEIARLETQFDIIRYMRRITQIFGFKTFLICSIPAVEVERLSATTVISNMP 98

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPE---------------NITPPAGMDN 128
            +L+         ++   ++R  E   P    L +                +    G+  
Sbjct: 99  AELLNKYDSLSMLRFSTGVRRLRETTTPFQVMLEDWEREGGKPDSAADYIAMLRENGIFQ 158

Query: 129 RYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW-GKDFELT 187
                  D    R  ++L+ P+  + +   + E+ ++A +  N        W   +  L+
Sbjct: 159 ANYFPVHDAEGGRGAVILMGPEAELPMTAAM-ELQMIAIHVYNRLAEIGSVWKNTNTVLS 217

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE++CL+W + GKTS EIA ILG+S +TVN+Y+  + +K     R+ A+  A++   +
Sbjct: 218 EREIQCLSWTAAGKTSSEIAGILGLSEHTVNHYLNHVTKKLDAVNRTQAVVKAMKKGYI 276


>gi|150395666|ref|YP_001326133.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
 gi|150027181|gb|ABR59298.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
          Length = 286

 Score =  179 bits (454), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 52/239 (21%), Positives = 99/239 (41%), Gaps = 18/239 (7%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI-VSSDWP 83
            LP   D  + +  L+        M  +T+  G   FL+      + ++L +  V S+ P
Sbjct: 48  DLPRGGDFASEIARLETQFDIIRYMRRITQIFGFKTFLICSIPAVEVERLSATTVISNMP 107

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPE---------------NITPPAGMDN 128
            +L+         ++   ++R  E   P    L +                +    G+  
Sbjct: 108 AELLNKYDSLSMLRFSTGVRRLRETTTPFQILLEDWEKEGGKPDAAADYFAMLRENGLLQ 167

Query: 129 RYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW-GKDFELT 187
                  D    R  ++L+ P+  + +   + E+ ++A +  N        W   +  L+
Sbjct: 168 ANYFPVHDAEGGRGAVILMGPEAGLPMTAAM-ELQMIAIHVYNRLAEIGSVWKNTNTVLS 226

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE++CL W + GKTS EIA ILG+S +TVN+Y+  + +K     R+ A+  A++   +
Sbjct: 227 EREIQCLNWTAAGKTSSEIAGILGLSEHTVNHYLNHVTKKLDAVNRTQAVVKAMKKGYI 285


>gi|222084851|ref|YP_002543380.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
 gi|221722299|gb|ACM25455.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
          Length = 245

 Score =  178 bits (453), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 120/248 (48%), Positives = 161/248 (64%), Gaps = 5/248 (2%)

Query: 1   MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASH 60
           M+ +I Q +     + + R +  S   +R  L+ ++  +         +  LT+YVGASH
Sbjct: 1   MDMQISQAS---KGDKDARAAAPSSAMSRDQLILQLTAVAGPAYLQSGLRVLTDYVGASH 57

Query: 61  FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALS--EKDKYYNVLQRPTELFCPVFHTLPE 118
           +LL R DL QE  LD +VSSDWPFDLVR +A            L++   LF PVF  LP+
Sbjct: 58  YLLARCDLIQESGLDFVVSSDWPFDLVRRLASELTNGYGRAGELEKSMSLFQPVFAFLPD 117

Query: 119 NITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDV 178
           ++ PP G+   YC+LTF+V R R  LMLL     ++  +RL ++GLLA Y A+  +S + 
Sbjct: 118 DVEPPEGVSRHYCALTFNVGRTRFSLMLLARDSLLLSPERLRDVGLLAGYFASFTRSVEG 177

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
              +DF+LT RE+ECL WI+EGKTSDEIA+ILGISRNT+NNYI S+MRKTATKTRS AIA
Sbjct: 178 KLERDFDLTERELECLFWIAEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIA 237

Query: 239 YAVRNNIV 246
           +AVRNN+V
Sbjct: 238 FAVRNNLV 245


>gi|150395470|ref|YP_001325937.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
 gi|150026985|gb|ABR59102.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
          Length = 245

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 112/246 (45%), Positives = 156/246 (63%), Gaps = 3/246 (1%)

Query: 3   FEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFL 62
            E+ + + V + E   R  +     +R  L+ R+  L         +  LTEYVGA+H+L
Sbjct: 1   MEMSRSDAVWSSETAARRMY-GRRISREQLIRRLGELASGTGLGNGLAVLTEYVGATHYL 59

Query: 63  LVRWDLFQEQKLDSIVSSDWPFDLVRCMAL--SEKDKYYNVLQRPTELFCPVFHTLPENI 120
           L R D+ Q+  LD +V SDWPFD+VR ++   +  +     L++      PVFH +P++I
Sbjct: 60  LARHDVSQDGGLDFVVCSDWPFDIVRRLSGIIAGLNSKTTELEKCRAQLQPVFHAMPDDI 119

Query: 121 TPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW 180
             P G+   YC++TF +   R  LMLLFP+  I+ +D L ++ +LA Y A+     DV  
Sbjct: 120 GLPRGVSRSYCAVTFSIGPTRFSLMLLFPEDVILSQDALRDVAVLAGYVASHKIKADVRH 179

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
            ++ ELT RE+ECL WI+EGKTSDEIAVILGISRNT+NNYI S+MRKTAT+TRS AIA+A
Sbjct: 180 DRECELTERELECLFWIAEGKTSDEIAVILGISRNTINNYITSVMRKTATRTRSEAIAHA 239

Query: 241 VRNNIV 246
           VRNN+V
Sbjct: 240 VRNNLV 245


>gi|2916781|emb|CAA11948.1| unnamed protein product [Sinorhizobium meliloti]
          Length = 245

 Score =  169 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 110/222 (49%), Positives = 148/222 (66%), Gaps = 2/222 (0%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
            +R  L+ R+  +         + ALTEYVGA+H+LL R D+ Q+  LD +V SDWPFD+
Sbjct: 24  ISREQLIRRLGEVASGAGLGNGLAALTEYVGATHYLLARHDVSQDGGLDFVVCSDWPFDI 83

Query: 87  VRCMAL--SEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           VR ++   +        L++      P FHT+P++I  P G+   YC++TF V R R  L
Sbjct: 84  VRRLSGIIAGLHAKITELEKCLAQLQPAFHTMPDDIGLPRGVSRSYCAVTFSVGRTRFSL 143

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
           MLLFP+  I+ ++ L +I +LA Y A+     DV   ++ ELT RE+ECL WI+EGKTSD
Sbjct: 144 MLLFPEDVILSQESLRDIAVLAGYVASHKIKADVRHDRECELTERELECLFWIAEGKTSD 203

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIAVILGISRNT+NNYI S+MRKTAT+TRS AIA+AVRNN+V
Sbjct: 204 EIAVILGISRNTINNYITSVMRKTATRTRSEAIAHAVRNNLV 245


>gi|15964400|ref|NP_384753.1| putative transcription regulator protein [Sinorhizobium meliloti
           1021]
 gi|15073577|emb|CAC45219.1| Transcriptional regulator of motility genes, LuxR family
           [Sinorhizobium meliloti 1021]
          Length = 245

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 111/222 (50%), Positives = 148/222 (66%), Gaps = 2/222 (0%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
            +R  L+ R+  +         + ALTEYVGA+H+LL R D+ Q+  LD +V SDWPFD+
Sbjct: 24  ISREQLIRRLGEVASGAGLGNGLAALTEYVGATHYLLARHDVSQDGGLDFVVCSDWPFDI 83

Query: 87  VRCMAL--SEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           VR ++   +        L+R      P FHT+P++I  P G+   YC++TF V R R  L
Sbjct: 84  VRRLSGIIAGLHAKITELERCLAQLQPAFHTMPDDIGLPRGVSRSYCAVTFSVGRTRFSL 143

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
           MLLFP+  I+ ++ L +I +LA Y A+     DV   ++ ELT RE+ECL WI+EGKTSD
Sbjct: 144 MLLFPEDVILSQEALRDIAVLAGYVASHKIKADVRHDRECELTERELECLFWIAEGKTSD 203

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIAVILGISRNT+NNYI S+MRKTAT+TRS AIA+AVRNN+V
Sbjct: 204 EIAVILGISRNTINNYITSVMRKTATRTRSEAIAHAVRNNLV 245


>gi|327188113|gb|EGE55336.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli CNPAF512]
          Length = 245

 Score =  168 bits (427), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 87/233 (37%), Gaps = 17/233 (7%)

Query: 30  SDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLD-SIVSSDWPFDLVR 88
            D +  +  L         M  +TE      F+++         L  + V + WP +L+ 
Sbjct: 13  DDYIKEIAGLKTQFDIFRFMKRVTEAYRCRAFMVLNLPPITSLDLQGNTVITSWPAELLA 72

Query: 89  CMALSEKDKYYNVLQRPTELFCPVF-------HTLPENITPP-------AGMDNRYCSLT 134
                       VL+R      P          +  +  +           M       T
Sbjct: 73  LYDQEGLMVNSPVLRRLRTSARPFSYDMSRQNWSRDDGKSDLVVGLFERFRMTRCAYFPT 132

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-LTGREVEC 193
            + + +R  +     +        + E+  +A +  +          +  + LT RE++C
Sbjct: 133 HEPSGLRGAVSFAGDREP-FSPTEMRELCYIAIHVFDRLAEIRNLDTRVTDALTDREIDC 191

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  ++
Sbjct: 192 LNWTAAGKTSAEIAEILVLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 244


>gi|218508993|ref|ZP_03506871.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli Brasil 5]
          Length = 245

 Score =  168 bits (426), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 87/233 (37%), Gaps = 17/233 (7%)

Query: 30  SDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLD-SIVSSDWPFDLVR 88
            D +  +  L         M  +TE      F+++         L  + V + WP +L+ 
Sbjct: 13  DDYIKEIAGLKTQFDIFRFMKRVTEAYRCRAFMVLNLPPITSLDLQGNTVITSWPAELLA 72

Query: 89  CMALSEKDKYYNVLQRPTELFCPVF-------HTLPENITPP-------AGMDNRYCSLT 134
                       VL+R      P          +  +  +           M       T
Sbjct: 73  LYDQEGLMVNSPVLRRLRTSARPFSYDMSRQNWSRDDGKSDLVVGLFERFRMTRCAYFPT 132

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-LTGREVEC 193
            + + +R  +     +        + E+  +A +  +          +  + LT RE++C
Sbjct: 133 HEPSGLRGAVSFAGDREP-FSPAEMRELCYIAIHVFDRLAEIRNLDTRVTDALTDREIDC 191

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  ++
Sbjct: 192 LNWTAAGKTSAEIAEILVLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 244


>gi|218673534|ref|ZP_03523203.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli GR56]
          Length = 245

 Score =  168 bits (426), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 50/233 (21%), Positives = 87/233 (37%), Gaps = 17/233 (7%)

Query: 30  SDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLD-SIVSSDWPFDLVR 88
            D +  +  L         M  +TE      F+++         L  S V + WP +L+ 
Sbjct: 13  DDYIKEIAGLKTQFDIFRFMKRVTEAYRCRAFMVLNLPPITSLDLQGSTVITSWPAELLA 72

Query: 89  CMALSEKDKYYNVLQRPTELFCPVF-------HTLPENITPP-------AGMDNRYCSLT 134
                       VL+R      P F           +  +           M       T
Sbjct: 73  LYDQEGLMVNSPVLRRLRTSARPFFYDMSRQNWPRDDGKSALVVGLFERFRMTRCAYFPT 132

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-LTGREVEC 193
            + + +R  +     +        + E+  +A +  +          +  + LT RE++C
Sbjct: 133 HEPSGLRGAVSFAGDREP-FSPAEMRELCYIAIHVFDRLAEIRNLDTRITDALTDREIDC 191

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  ++
Sbjct: 192 LNWTAAGKTSAEIAEILALSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 244


>gi|190890568|ref|YP_001977110.1| transcriptional regulator protein, LuxR family [Rhizobium etli CIAT
           652]
 gi|190695847|gb|ACE89932.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli CIAT 652]
          Length = 246

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 47/233 (20%), Positives = 87/233 (37%), Gaps = 17/233 (7%)

Query: 30  SDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLD-SIVSSDWPFDLVR 88
            D +  +  L         M  +TE      F+++         L  + V + WP +L+ 
Sbjct: 14  DDYIKEIAGLKTQFDIFRFMKRMTEAYRCRAFMVLNLPPITSLDLQGNTVITSWPAELLA 73

Query: 89  CMALSEKDKYYNVLQRPTELFCPVF-------HTLPENITPP-------AGMDNRYCSLT 134
                       +L+R      P          +  +  +           M       T
Sbjct: 74  LYDQEGLMVNSPILRRLRTSARPFSYDMSRQNWSRDDGKSDLVVGLFERFRMTRCAYFPT 133

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-LTGREVEC 193
            + + +R  +     +        + E+  +A +  +          +  + LT RE++C
Sbjct: 134 HEPSGLRGAVSFAGDREP-FSPAEMRELCYIAIHVFDRLAEIRNLDTRVTDALTDREIDC 192

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  ++
Sbjct: 193 LNWTAAGKTSAEIAEILVLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 245


>gi|241203295|ref|YP_002974391.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857185|gb|ACS54852.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 244

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 49/233 (21%), Positives = 89/233 (38%), Gaps = 17/233 (7%)

Query: 30  SDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLF-QEQKLDSIVSSDWPFDLVR 88
            D +  +  L         M  +TE   +  F+++            S V + WP +L+ 
Sbjct: 12  DDYVQEIAGLKTQFDIFRFMKRVTEAYRSRAFMVLNLPPITSFDLQGSTVITSWPAELLA 71

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLPEN-ITPPAG-------------MDNRYCSLT 134
                       VL+R      P F+ +    ++   G             M       T
Sbjct: 72  LYDQEGLMVNSPVLRRLRTSARPFFYDMSRQNLSRDDGKSILVASLFERFKMMRCAYFPT 131

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF-ELTGREVEC 193
            + + +R  +     +        + E+  ++ +  +          +    LT RE++C
Sbjct: 132 HEPSGLRGAISFAGDREP-FSPAEMRELCYISIHIFDRLAEIRNLDTRMTDTLTDREIDC 190

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  ++
Sbjct: 191 LNWTAAGKTSAEIAEILTLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 243


>gi|209548111|ref|YP_002280028.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533867|gb|ACI53802.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 244

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 87/233 (37%), Gaps = 17/233 (7%)

Query: 30  SDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLF-QEQKLDSIVSSDWPFDLVR 88
            D +  +  L         +  +TE   +  FL++            S V + WP +L+ 
Sbjct: 12  DDYIKEIAGLKTQFDIFRFLKRVTEAYRSRAFLVLNLPPITSLDIQGSTVITSWPAELLA 71

Query: 89  CMALSEKDKYYNVLQRPTELFCPVF-------HTLPENITPP-------AGMDNRYCSLT 134
                       VL+R      P F        +  +  +           M       T
Sbjct: 72  LYDQEGLLVNSPVLRRLRTSARPFFYDMSRENWSRDDGKSILVASLFERFRMMRGAYFPT 131

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF-ELTGREVEC 193
            + + +R  +     +        + E+  ++ +  +          +    LT RE++C
Sbjct: 132 HEPSGVRGAISFAGDREP-FSPAEMRELCYISIHVYDRLAEIRNLDTRITDTLTDREIDC 190

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  ++
Sbjct: 191 LNWTAAGKTSAEIAEILTLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 243


>gi|116250693|ref|YP_766531.1| LuxR/GerE family transcriptional regulator [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115255341|emb|CAK06416.1| putative LuxR/GerE family transcriptional regulator [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 245

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 49/233 (21%), Positives = 87/233 (37%), Gaps = 17/233 (7%)

Query: 30  SDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLF-QEQKLDSIVSSDWPFDLVR 88
            D +  +  L         M  +TE   +  F+++            S V + WP +L+ 
Sbjct: 13  DDYVQEIAGLKTQFDIFRFMKRVTEAYRSRAFMVLNLPPITSFDLQGSTVITSWPAELLA 72

Query: 89  CMALSEKDKYYNVLQRPTELFCPVF-------HTLPENITPPAG-------MDNRYCSLT 134
                       VL+R      P F        +  +  +           M       T
Sbjct: 73  LYDQEGLMVNSPVLRRLRTSARPFFYDMSRQNWSRDDGKSILVASLFERFKMMRCAYFPT 132

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF-ELTGREVEC 193
            + + +R  +     +        + E+  +A +  +          +    LT RE++C
Sbjct: 133 HEPSGLRGAVSFAGDREP-FSSAEMRELCYIAIHVFDRLAEIRNLDTRMTDTLTDREIDC 191

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  ++
Sbjct: 192 LNWTAAGKTSAEIAEILTLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 244


>gi|218681045|ref|ZP_03528942.1| transcriptional regulator, LuxR family protein [Rhizobium etli CIAT
           894]
          Length = 244

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 49/236 (20%), Positives = 87/236 (36%), Gaps = 17/236 (7%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLF-QEQKLDSIVSSDWPFD 85
           P   D L  +  L         +  +TE   +  F+++            S V + WP +
Sbjct: 9   PEEDDYLKEIAGLKTQFDIFRFLKRVTEAYRSRAFMVLNLPPITSLDIQGSTVITSWPAE 68

Query: 86  LVRCMALSEKDKYYNVLQRPTELFCPVFHTLPE--------------NITPPAGMDNRYC 131
           L+             VL+R      P  + +                 +     M     
Sbjct: 69  LLALYDQEGLLVNSPVLRRLRTSARPFSYDMSRDNWSRDDGKSVLVTALFERFRMMRGAY 128

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF-ELTGRE 190
             T + + +R  +     +        + E+  +A +  +          +    LT RE
Sbjct: 129 FPTHEPSGLRGAVSFSGDRET-FSPAEMRELCYIAVHVYDRLAEIRNLDARITDTLTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++CL W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  ++
Sbjct: 188 IDCLNWTAAGKTSAEIAEILTLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 243


>gi|218463393|ref|ZP_03503484.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli Kim 5]
          Length = 245

 Score =  165 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 50/234 (21%), Positives = 88/234 (37%), Gaps = 19/234 (8%)

Query: 30  SDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLD-SIVSSDWPFDLVR 88
            D +  +  L         +  +TE      F+++         L  S V + WP +L+ 
Sbjct: 13  DDYIKEIAGLKTQFDIFRFLKRVTEAYRCRAFMVLNLPPITSLDLQGSTVLTSWPAELLA 72

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLPEN---------------ITPPAGMDNRYCSL 133
                       VL+R      P F+ +                        M   Y   
Sbjct: 73  LYDQEGLMVDSPVLRRLRTSARPFFYDMSRQSWPRDDGKSALVVGLFERFRMMRCAY-FP 131

Query: 134 TFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-LTGREVE 192
           T + + +R  +     +        + E+  +A +  +          +  + LT RE++
Sbjct: 132 THEASGLRGAVSFAGDREP-FSPAEMRELCYIAIHVFDRLAEIRNLDTRVTDALTEREID 190

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           CL W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  ++
Sbjct: 191 CLNWTAAGKTSAEIAEILSLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 244


>gi|218661906|ref|ZP_03517836.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli IE4771]
          Length = 245

 Score =  165 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 50/234 (21%), Positives = 88/234 (37%), Gaps = 19/234 (8%)

Query: 30  SDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLD-SIVSSDWPFDLVR 88
            D +  +  L         +  +TE      F+++         L  S V + WP +L+ 
Sbjct: 13  DDYIKEIAGLKTQFDIFRFLKRVTEAYRCRAFMVLNLPPITSLDLQGSTVLTSWPAELLA 72

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLPEN---------------ITPPAGMDNRYCSL 133
                       VL+R      P F+ +                        M   Y   
Sbjct: 73  LYDQEGLMVDSPVLRRLRTSARPFFYDMSRQSWPRDDGKSALVVGLFERFRMMRCAY-FP 131

Query: 134 TFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-LTGREVE 192
           T + + +R  +     +        + E+  +A +  +          +  + LT RE++
Sbjct: 132 THEASGLRGAVSFAGDREP-FSPAEMRELCYIAIHVFDRLAEIRNLDTRVTDALTDREID 190

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           CL W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  ++
Sbjct: 191 CLNWTAAGKTSAEIAEILSLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 244


>gi|86356503|ref|YP_468395.1| LuxR family transcriptional regulator [Rhizobium etli CFN 42]
 gi|86280605|gb|ABC89668.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CFN 42]
          Length = 248

 Score =  165 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 49/233 (21%), Positives = 89/233 (38%), Gaps = 17/233 (7%)

Query: 30  SDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLD-SIVSSDWPFDLVR 88
            D +  +  L         +  +TE   +  F+++         L  S V + WP +L+ 
Sbjct: 16  DDYINEIAGLKTQFDIFRFLKRVTEAYRSRAFMVLNLPPTTSLDLQGSTVITSWPAELLA 75

Query: 89  CMALSEKDKYYNVLQRPTELFCPVF-------HTLPENITPP-------AGMDNRYCSLT 134
                       VL+R      P F        +  +  +           M       T
Sbjct: 76  LYDQEALMVNSPVLRRLRTSTRPFFYDMTRETWSRDDGKSVLVTGLFERFRMMRGAYFPT 135

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-LTGREVEC 193
            + + +R  +     +        + E+  +A +  +          +  + LT RE++C
Sbjct: 136 HEASGLRGAVSFAGDREP-FSAAEMRELCYIAIHVFDRLAEIRNLDTRMTDSLTDREIDC 194

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  ++
Sbjct: 195 LNWTAAGKTSAEIAEILALSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLI 247


>gi|307311542|ref|ZP_07591183.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
 gi|307318897|ref|ZP_07598328.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306895311|gb|EFN26066.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306899559|gb|EFN30188.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
          Length = 210

 Score =  165 bits (417), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 108/210 (51%), Positives = 142/210 (67%), Gaps = 2/210 (0%)

Query: 39  LDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMAL--SEKD 96
           +         + ALTEYVGA+H+LL R D+ Q+  LD +V SDWPFD+VR ++   +   
Sbjct: 1   MASGAGLGNGLAALTEYVGATHYLLARHDVSQDGGLDFVVCSDWPFDIVRRLSGIIAGLH 60

Query: 97  KYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILR 156
                L+R      P FHT+P++I  P G+   YC++TF V R R  LMLLFP+  I+ +
Sbjct: 61  AKITELERCLAQLQPAFHTMPDDIGLPRGVSRSYCAVTFSVGRTRFSLMLLFPEDVILSQ 120

Query: 157 DRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNT 216
           + L +I +LA Y A+     DV   ++ ELT RE+ECL WI+EGKTSDEIAVILGISRNT
Sbjct: 121 EALRDIAVLAGYVASHKIKADVRHDRECELTERELECLFWIAEGKTSDEIAVILGISRNT 180

Query: 217 VNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +NNYI S+MRKTAT+TRS AIA+AVRNN+V
Sbjct: 181 INNYITSVMRKTATRTRSEAIAHAVRNNLV 210


>gi|227820843|ref|YP_002824813.1| predicted LuxR family transcriptional regulator [Sinorhizobium
           fredii NGR234]
 gi|227339842|gb|ACP24060.1| predicted LuxR family transcriptional regulator [Sinorhizobium
           fredii NGR234]
          Length = 245

 Score =  164 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 111/225 (49%), Positives = 148/225 (65%), Gaps = 2/225 (0%)

Query: 24  SHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWP 83
           S   +R  L+ R+       S    +  LTEYVGA+H LL R DL Q+  LD ++ SDWP
Sbjct: 21  SRGISREQLIRRLGEAAERSSLANGLAILTEYVGATHHLLARHDLSQDGGLDFVLCSDWP 80

Query: 84  FDLVRCMALS--EKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIR 141
           FD+VR +A      +     L++      P F  LP++I  P G++  YCS+TF+V R R
Sbjct: 81  FDVVRRLASIVIGLNAKTTELEKCLAALQPCFQVLPDDIDLPRGVNRSYCSVTFNVGRSR 140

Query: 142 IGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGK 201
             LMLLFP+  I+ ++ L +I +LA+Y A+      V   +DFELT RE+ECL WI+EGK
Sbjct: 141 FSLMLLFPEDVILSQEGLRDIAVLASYLASFKAGAGVRHDRDFELTEREIECLFWIAEGK 200

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           TS+EIAVILGISRNT+NNYI S+MRKTAT+TRS AIA+AVR+N+V
Sbjct: 201 TSEEIAVILGISRNTINNYITSVMRKTATRTRSEAIAHAVRHNLV 245


>gi|145301148|ref|YP_001143989.1| LuxR family transcriptional regulator [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142853920|gb|ABO92241.1| transcriptional regulator, LuxR family [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 260

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 86/236 (36%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + + R      T     ++   +  +G  +F L+       QK    + ++ P       
Sbjct: 10  EHIDRFTKAKKTSEIQQQLERFSHQMGFDYFRLLIIFPISMQKSHVALFNNCPTSWFEAY 69

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPEN--------------ITPPAGMDNRYCSLTFD 136
           +         V+    +   P+F    +               +    G+ N        
Sbjct: 70  SERHYLTQDPVVFLGLKQTQPIFWNKLDCDSPWLPSASREVMNLAADFGVRNGVSFPLHT 129

Query: 137 VARIRIGLMLLFPK--GRIILRDRLWEIGLLAAYQANMFKSY----DVHWGKDFELTGRE 190
                  L  +  +     ++ + +  +   A+Y  N                 EL+ RE
Sbjct: 130 PQGEHGILSFISKEKSNSDLMFENVPLLSFCASYIFNSALQLIKSRPDLMKHLTELSDRE 189

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGIS  TVN ++  +  KT +K R+ AIA ++ + I+
Sbjct: 190 KECLFWASEGKTSWEIATILGISERTVNFHLNQVTNKTDSKNRNQAIAKSISSGII 245


>gi|220921013|ref|YP_002496314.1| LuxR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219945619|gb|ACL56011.1| transcriptional regulator, LuxR family [Methylobacterium nodulans
           ORS 2060]
          Length = 245

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 44/236 (18%), Positives = 83/236 (35%), Gaps = 21/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKL-DSIVSSDWPFDLVRC 89
           D++ R+       +    +     Y G   F++      Q + L D  +   WP +  + 
Sbjct: 10  DVIGRLQAASSQTALFSELKEAGRYFGYDSFIVTGLPHRQGENLNDCSLLVGWPMEWAKR 69

Query: 90  MALSEKDKYYNVLQRPTELFCPVFHTLP------------ENITPPAGMDNRYCSLTFDV 137
                      V+ +      P                   N +P  G++  +C     +
Sbjct: 70  YTERRYIHVDPVIAQIRRTLDPFMWDEAPYDRSDPGPATVMNESPSFGLNQGFCVPIHRI 129

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWG-------KDFELTGRE 190
                G+         +  D    + L+A Y  +  ++             +    + RE
Sbjct: 130 DGREAGVSF-GASRMDLSDDARAGLHLVAIYAFSAARALSAMPSNPADPERQPPRCSARE 188

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +EC+ W + GKT  EI+ IL +S+ TV  Y+ +  RK     R   IA A+R+ ++
Sbjct: 189 IECMRWAAAGKTGWEISEILSLSQRTVEAYLNNAARKLGVANRVHLIAEAIRHGLI 244


>gi|330831695|ref|YP_004394647.1| LuxR family transcriptional regulator [Aeromonas veronii B565]
 gi|328806831|gb|AEB52030.1| Transcriptional regulator, LuxR family [Aeromonas veronii B565]
          Length = 258

 Score =  159 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 85/236 (36%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + + +      T      +   +  +G  +F L+       QK    + ++ P       
Sbjct: 8   EHIDKFTKATKTSDIQQLLERFSHQMGFDYFRLLIIFPISMQKSHVALFNNCPTTWFDAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPEN--------------ITPPAGMDNRYCSLTFD 136
           + ++      V+    +   P+F    +               +    G+ N        
Sbjct: 68  SENQYLTQDPVVYLGLKQTQPIFWNKLDCDSPWLPSASRDVMNLAADFGVRNGVSFPLHT 127

Query: 137 VARIRIGLMLLFPK--GRIILRDRLWEIGLLAAYQANMFKSYDVHWGK----DFELTGRE 190
                  L  +        ++ + +  +   A+Y  N                 EL+ RE
Sbjct: 128 PQGEHGILSFITKDKSNSDLMFENVPLLSFCASYIFNSALQLIKSRPDMMKYLTELSDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGIS  TVN ++  +  KT +K RS AIA  + + I+
Sbjct: 188 KECLFWASEGKTSWEIATILGISERTVNFHLTQVTNKTDSKNRSQAIAKGITSGII 243


>gi|27376173|ref|NP_767702.1| transcriptional regulator [Bradyrhizobium japonicum USDA 110]
 gi|27349312|dbj|BAC46327.1| transcriptional regulatory protein [Bradyrhizobium japonicum USDA
           110]
          Length = 242

 Score =  158 bits (400), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 40/241 (16%), Positives = 82/241 (34%), Gaps = 15/241 (6%)

Query: 20  TSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVS 79
            S V +     D +  +            + A     G    ++       ++    +++
Sbjct: 1   MSAVDYGREALDFIEGLGVYRKVPDAMNALEAAFGRFGFETIIVTGLPNPDQRFAQMVLA 60

Query: 80  SDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLP-------------ENITPPAGM 126
             WP         +  D++  V++   +   P   +                N      M
Sbjct: 61  KRWPAGWFNLYTQNNYDRFDPVVRLCRQSVNPFEWSEAPYDAELEPSAAEVMNRAGDFRM 120

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSY-DVHWGKDFE 185
              +      +      + L       +       + L+A Y  +  +   +        
Sbjct: 121 SRGFIVPIHGLTGYEAAVSL-GGVHLDLNPRSKPALHLMAMYGFDHIRRLLEPTPYPSTR 179

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E ++W S+GK++ EI  IL I++ T   ++A+  RK     R+ A+A A+R+ I
Sbjct: 180 LTPREREVISWASQGKSAWEIGEILHITQRTAEEHLATAARKLGAVNRTHAVALAIRHKI 239

Query: 246 V 246
           +
Sbjct: 240 I 240


>gi|88797814|ref|ZP_01113402.1| LuxR, transcriptional regulator [Reinekea sp. MED297]
 gi|88779491|gb|EAR10678.1| LuxR, transcriptional regulator [Reinekea sp. MED297]
          Length = 240

 Score =  158 bits (399), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 49/235 (20%), Positives = 86/235 (36%), Gaps = 19/235 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           DLL R+     T      + ++++ V   +FL            D ++  ++P +  R  
Sbjct: 2   DLLERLQQAQSTSELPEILESISQVVEFDYFLFGLALPNSITHSDILMYDNYPGEWRRVY 61

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHT-------------LPENITPPAGMDNRYCSLTFDV 137
             S   K   ++Q     + PV                        +G+   +       
Sbjct: 62  DESGYAKRDPIVQYSISNYMPVTWAQISESPSYSRSDLKIMWEAEASGLKAGFSLPIHGA 121

Query: 138 ARIRIGLMLLF----PKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE--LTGREV 191
                 +         + R+   + +  I +L     +  K   V   K+    LT RE+
Sbjct: 122 VGEFGMISFASNHNTDEQRLKYAEAIPVIQMLVPAIQDAVKRLRVSESKEPPAKLTKREI 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ECLTW +EGK+S EI+ ILG S  T   ++++   K     R  AI+ A+   I+
Sbjct: 182 ECLTWATEGKSSWEISQILGCSERTAIFHLSNAANKLGATNRYQAISKALLCGII 236


>gi|115524334|ref|YP_781245.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           BisA53]
 gi|115518281|gb|ABJ06265.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           BisA53]
          Length = 246

 Score =  157 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 36/229 (15%), Positives = 79/229 (34%), Gaps = 15/229 (6%)

Query: 32  LLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMA 91
            +  +  L    +    +       G    ++      ++     +++  WP +  +   
Sbjct: 17  FVEELSTLTTISAAIDFIEKGFCAYGFETIIVTGIPNHKQSFSQMVMAKRWPDEWFKLYT 76

Query: 92  LSEKDKYYNVLQRPTELFCPVFHTLP-------------ENITPPAGMDNRYCSLTFDVA 138
            +   +   V++   + F P   +                +      M   +      +A
Sbjct: 77  QNNYHRDDPVVRHLRKSFNPFEWSDAPYSRRNEPRAAAVMDRAADFRMSRGFIVPVHGLA 136

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKS-YDVHWGKDFELTGREVECLTWI 197
                + L       +       + L+A Y  +  +S           LT RE E L W 
Sbjct: 137 GYEAAVSL-GGDHIDLNPRSKPALHLMAMYAFDRIRSLVSPANDAPPRLTHRECETLNWT 195

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++GK++ EI  IL I++ T   ++A+  RK     ++ A+A A+R  ++
Sbjct: 196 AQGKSAWEIGEILQIAQRTAEEHLATAARKLGAVNKTHAVAIAIRQKLI 244


>gi|222085036|ref|YP_002543565.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
 gi|221722484|gb|ACM25640.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
          Length = 245

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 52/239 (21%), Positives = 91/239 (38%), Gaps = 16/239 (6%)

Query: 23  VSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLF-QEQKLDSIVSSD 81
           V   P   D +  +  L         M  +T+      F++V        +   + V ++
Sbjct: 7   VGRSPRGEDYIDEIAGLKTQFDVFRFMKRVTDAYRCRAFMVVNLPSLTSFELQSNSVINN 66

Query: 82  WPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPP-------------AGMDN 128
           WP +L+         +   V +R      P  +    N                   M  
Sbjct: 67  WPAELLTVYDQEGLLRNSTVSRRLRVSTLPFVYDTAANTNRDDSKIQLRASLFERFRMAR 126

Query: 129 RYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF-ELT 187
             C  T D + IR  ++L   +      +   ++  +A +  +          +    LT
Sbjct: 127 SICLPTHDASGIRGAVILSGDREA-FTAEETKDLCYIAIHVFDRLAEIRNLDVRIVDTLT 185

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE++CL W + GKTS EIA IL +S +TVN+Y+    +K  T  R+ A+A A+R  ++
Sbjct: 186 DRELDCLNWTAAGKTSAEIAEILTLSEHTVNHYLNRATKKLDTVNRTQAVAKALRVGLI 244


>gi|222149995|ref|YP_002550952.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
 gi|221736977|gb|ACM37940.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
          Length = 248

 Score =  155 bits (392), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 113/232 (48%), Positives = 149/232 (64%), Gaps = 3/232 (1%)

Query: 18  QRTSFVSHLPTRSDLLAR-MIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDS 76
           Q+T+     P   D + R +     +    + M+ LT+Y GASH+LL R+DL QE  LD 
Sbjct: 17  QKTANRPEGPRLRDAMIRQLSSAASSGKLRVAMHILTDYAGASHYLLARYDLIQEHGLDF 76

Query: 77  IVSSDWPFDLVRCMALS--EKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLT 134
           +V++DWPFDL R +A            L++   L    F  LP+++  P G   +YCS+ 
Sbjct: 77  VVTADWPFDLARGVATELSAACSRATELEKCLGLLQAKFVLLPDDLELPLGASRQYCSVM 136

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECL 194
           F+V R R+ L++L P G +I  DRL ++GLLAAY  ++         +DFELT RE+ECL
Sbjct: 137 FNVGRTRLALVMLLPDGFVISPDRLRDVGLLAAYCVSLSTGRSQKADRDFELTERELECL 196

Query: 195 TWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            WI+EGKTSDEIA ILGISRNT+NNYI S+MRKTATKTRS AIAYAVRNN+V
Sbjct: 197 FWIAEGKTSDEIATILGISRNTINNYITSVMRKTATKTRSEAIAYAVRNNLV 248


>gi|59940043|gb|AAX12560.1| LuxR-type transcriptional regulator [Aeromonas sobria]
          Length = 258

 Score =  155 bits (392), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 49/234 (20%), Positives = 82/234 (35%), Gaps = 18/234 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L  +  +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHLTTVTDGDRLAGLIGRFTVDMGYDYYGFTLIIPMSMQRPKVVLFNQCPVSWVQTY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       V+Q   +   P++    +                    G+ N        
Sbjct: 68  TDNNMLACDPVIQLARKQTLPIYWNRLDERASFLQEGTMDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE--LTGREVE 192
            A     L  +  +     +L +    +  +A Y              D    LT RE E
Sbjct: 128 AAGETGILSFITSERASSDLLLESSPILSWMANYIFEAAIRVVRLRDSDQHAALTDRETE 187

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           CL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + + I+
Sbjct: 188 CLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGIL 241


>gi|66277256|gb|AAY44559.1| LuxR-like protein [Aeromonas caviae]
          Length = 260

 Score =  155 bits (392), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 84/239 (35%), Gaps = 20/239 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            + + L  +  +         +   T  +G  ++          Q+   ++ +  P   V
Sbjct: 5   QQLEYLEHLTMVTDESRLAELIGRFTLGMGYDYYRFALILPMSMQRPKVVLFNQCPDSWV 64

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPEN--------------ITPPAGMDNRYCSL 133
           +   L+       ++Q       P++    +               +    G+ N     
Sbjct: 65  QAYTLNNMLACDPIIQLARRQTLPIYWNRLDEKARFLQEGSMDVMGLAAEFGLRNGISFP 124

Query: 134 TFDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMF----KSYDVHWGKDFELT 187
               A     L  +  +     ++ +    +  ++ Y         +           LT
Sbjct: 125 LHGAAGENGILSFITRERASSDLMLESSPILSWMSNYIFEAAIRIVRQSMREDDPQEPLT 184

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 185 ERETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940109|gb|AAX12593.1| LuxR-type transcriptional regulator [Aeromonas sp. AN-46]
          Length = 260

 Score =  154 bits (390), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 84/239 (35%), Gaps = 20/239 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            + + L     +         +   T  +G  ++          Q+   ++ +  P   V
Sbjct: 5   QQLEYLEHFTSVTDGDRLAELIGRFTPGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWV 64

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSL 133
           +    +       ++Q   +   P++    +                    G+ N     
Sbjct: 65  QAYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFP 124

Query: 134 TFDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LT 187
               A     L  +  +     +L +    +  ++ Y             +D +    LT
Sbjct: 125 LHGAAGENGILSFITAERASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALT 184

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 185 DRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940119|gb|AAX12598.1| LuxR-type transcriptional regulator [Aeromonas veronii]
          Length = 258

 Score =  154 bits (390), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 49/234 (20%), Positives = 82/234 (35%), Gaps = 18/234 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAGLIGRFTVDMGYDYYGFTLIIPMSMQRPKVVLFNQCPISWVQTY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       V+Q   +   P++    +                    G+ N        
Sbjct: 68  TDNNMLACDPVIQLARKQTLPIYWNRLDERARFLQEGSMDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE--LTGREVE 192
            A     L  +  +     +L +    +  +A Y              D +  LT RE E
Sbjct: 128 AAGENGILSFITSERASSDLLLESSPILSWMANYIFEAAIRVVRLRDSDQQAALTDRETE 187

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           CL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + + I+
Sbjct: 188 CLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGIL 241


>gi|66736599|gb|AAY54303.1| quorum sensing trancriptional regulator [Aeromonas veronii]
          Length = 258

 Score =  154 bits (390), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 49/234 (20%), Positives = 82/234 (35%), Gaps = 18/234 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAGLIGRFTVDMGYDYYGFTLIIPMSMQRPKVVLFNQCPISWVQTY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       V+Q   +   P++    +                    G+ N        
Sbjct: 68  TDNNMLACDPVIQLARKQTLPIYWNRLDERARFLQEGSMDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE--LTGREVE 192
            A     L  +  +     +L +    +  +A Y              D +  LT RE E
Sbjct: 128 AAGENGILSFITSERASSDLLLESSPILSWMANYIFEAAIRVVRLRDSDQQAALTDRETE 187

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           CL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + + I+
Sbjct: 188 CLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGIL 241


>gi|59940089|gb|AAX12583.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
          Length = 260

 Score =  154 bits (390), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 84/239 (35%), Gaps = 20/239 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            + + L     +         +   T  +G  ++          Q+   ++ +  P   V
Sbjct: 5   QQLEYLEHFTSVTDGDRLAELIGRFTPGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWV 64

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSL 133
           +    +       ++Q   +   P++    +                    G+ N     
Sbjct: 65  QAYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFP 124

Query: 134 TFDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LT 187
               A     L  +  +     +L +    +  ++ Y             +D +    LT
Sbjct: 125 LHGAAGENGILSFITAERASSDLLLESSPVLSWMSNYIFEATIRIVRVSLRDDDPQEALT 184

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 185 DRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|240142370|ref|YP_002966880.1| LuxR type transcriptional regulator [Methylobacterium extorquens
           AM1]
 gi|240012314|gb|ACS43539.1| LuxR type transcriptional regulator [Methylobacterium extorquens
           AM1]
          Length = 242

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 31/234 (13%), Positives = 63/234 (26%), Gaps = 16/234 (6%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
              D +  +            +  +    G  HF++       ++    ++    P    
Sbjct: 8   RALDFVEGLDDCHDHDQVAHSVERILAEFGFEHFVITGLPNPNDRLDQVLLIRRLPAGWF 67

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLP-------------ENITPPAGMDNRYCSLT 134
              A         V +       P                          GM   +    
Sbjct: 68  EHYARHNYMYLDPVFRNCRATTSPFDWGEAPYDPETEPGAIEVMQRATDFGMARGFSVPI 127

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW--GKDFELTGREVE 192
                       +  +   +       + ++A Y     +             LT RE E
Sbjct: 128 HGPEGC-EACFSMSGRNPDLTGRTKPAVHMIAMYAFERARQVGRRPAKPPSNPLTQREQE 186

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            LTW + GK+S + A I+ I+  T   +  +   K     R+ A+  A+++  +
Sbjct: 187 VLTWAALGKSSRDTAEIMQITERTALAHAVNATHKLGAANRTQAVVRAMQSKFI 240


>gi|125973782|ref|YP_001037692.1| two component LuxR family transcriptional regulator [Clostridium
           thermocellum ATCC 27405]
 gi|256004513|ref|ZP_05429492.1| two component transcriptional regulator, LuxR family [Clostridium
           thermocellum DSM 2360]
 gi|281417939|ref|ZP_06248959.1| two component transcriptional regulator, LuxR family [Clostridium
           thermocellum JW20]
 gi|125714007|gb|ABN52499.1| two component transcriptional regulator, LuxR family [Clostridium
           thermocellum ATCC 27405]
 gi|255991518|gb|EEU01621.1| two component transcriptional regulator, LuxR family [Clostridium
           thermocellum DSM 2360]
 gi|281409341|gb|EFB39599.1| two component transcriptional regulator, LuxR family [Clostridium
           thermocellum JW20]
 gi|316940025|gb|ADU74059.1| two component transcriptional regulator, LuxR family [Clostridium
           thermocellum DSM 1313]
          Length = 216

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 35/241 (14%), Positives = 73/241 (30%), Gaps = 27/241 (11%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           + ++ +V+  +       +  +      +A +                    G     L 
Sbjct: 1   MDKIRVVIADDHAMVREGLKQILELEKDIAVVAQASN---------------GEEAVKLA 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
           +        +D  +        +  +                 +   +            
Sbjct: 46  KECQPDVVLMDINMPGMNGLQAIEKIKAENL--------AVKIIVLTIHEDKEYLFKTLQ 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
                Y     D   +   +  +      I  +   E+      + N     +     + 
Sbjct: 98  MGAEGYVLKDADSTVLVEAIRSVNRGESYIQSNMTKEL----VREFNRVTVNEKAKKTEN 153

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE+E L  I++G  + EIA  L IS  TV N++++I +K     R+ A  YA ++N
Sbjct: 154 DLTPRELEVLELIAQGLINKEIAKRLFISEKTVKNHVSNIFKKLNVSDRTQAAIYAYKHN 213

Query: 245 I 245
           I
Sbjct: 214 I 214


>gi|66277284|gb|AAY44573.1| LuxR-like protein [Aeromonas veronii bv. sobria]
          Length = 258

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 49/234 (20%), Positives = 82/234 (35%), Gaps = 18/234 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAGLIGRFTVDMGYDYYGFTLIIPMSMQRPKVVLFNQCPISWVQTY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       V+Q   +   P++    +                    G+ N        
Sbjct: 68  TDNNMLACDPVIQLARKQTLPIYWNRLDERARFLQEGSMDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE--LTGREVE 192
            A     L  +  +     +L +    +  +A Y              D +  LT RE E
Sbjct: 128 AAGENGILSFITSERASSDLLLESSPILSWMANYIFEAAIRVVRLRDSDQQAALTDRETE 187

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           CL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + + I+
Sbjct: 188 CLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGIL 241


>gi|316931698|ref|YP_004106680.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           DX-1]
 gi|315599412|gb|ADU41947.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           DX-1]
          Length = 243

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 37/220 (16%), Positives = 74/220 (33%), Gaps = 16/220 (7%)

Query: 41  CTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYN 100
              +   +  +L    G + +++           +  +++ WP D               
Sbjct: 24  DAPALVSQFESLIASCGFTAYIIAGLPSRNAGLPELTLANGWPRDWFDLYVSENFSAVDP 83

Query: 101 VLQRPTELFCPVFH-------------TLPENITPPAGMDNRYCSLTFDVARIRIGLMLL 147
           V +       P                          G+   YC             + +
Sbjct: 84  VPRHVASTVHPFVWSEAPYDRDRDPAAHRVMTRAAEFGLVEGYCIPLHYDDG--SAAISM 141

Query: 148 FPKGRIILRDRLWEIGLLAAYQANMFKSYD-VHWGKDFELTGREVECLTWISEGKTSDEI 206
             K   +       + L++ Y  +  ++      G+  +LT RE E L W ++GKT+ EI
Sbjct: 142 AGKDPDLSPAARGAMQLVSIYAHSRLRTLGRPKPGRRNKLTARECEILQWAAQGKTAWEI 201

Query: 207 AVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++IL I+  TV  ++    RK     R+ A+A A+   ++
Sbjct: 202 SMILCIAERTVKFHLIEAARKLDAANRTAAVAKALTLGLI 241


>gi|59940145|gb|AAX12611.1| LuxR-type transcriptional regulator [Aeromonas sp. QM 21725]
          Length = 260

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 84/239 (35%), Gaps = 20/239 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            + + L     +         +   T  +G  ++          Q+   ++ +  P   V
Sbjct: 5   QQLEYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWV 64

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSL 133
           +    +       ++Q   +   P++    +                    G+ N     
Sbjct: 65  QAYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFP 124

Query: 134 TFDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LT 187
               A     L  +  +     +L +    +  ++ Y             +D E    LT
Sbjct: 125 LHGAAGENGILSFITAERASSDLLLESSPVLSWMSNYIFQAAIRNVRVSLRDDEPQGALT 184

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 185 DRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940129|gb|AAX12603.1| LuxR-type transcriptional regulator [Aeromonas sp. ABJ]
          Length = 260

 Score =  153 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 85/239 (35%), Gaps = 20/239 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            + + L  ++ +         +   T  +G  ++          Q+   ++ +  P   V
Sbjct: 5   QQLEYLEHLLSVTDGDRLAELIGRFTLGMGYDYYRFALIIPTSMQRPKVVLFNQCPDSWV 64

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSL 133
           +    +       ++Q   +   P++    +                    G+ N     
Sbjct: 65  QAYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFP 124

Query: 134 TFDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LT 187
               A     L  +  +     +L +    +  ++ Y             +D +    LT
Sbjct: 125 LHGAAGENGILSFITAERASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALT 184

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V   I+
Sbjct: 185 DRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSCGIL 243


>gi|59940065|gb|AAX12571.1| LuxR-type transcriptional regulator [Aeromonas veronii]
          Length = 258

 Score =  153 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 49/234 (20%), Positives = 82/234 (35%), Gaps = 18/234 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAGLIGRFTVDMGYDYYGFTLIIPMSMQRPKVVLFNQCPISWVQTY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       V+Q   +   P++    +                    G+ N        
Sbjct: 68  TDNNMLACDPVIQLARKQTLPIYWNRLDERARFLQEGSMDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE--LTGREVE 192
            A     L  +  +     +L +    +  +A Y              D +  LT RE E
Sbjct: 128 AAGENGILSFITSERASSDLLLESSPILSWMANYIFEAAIRVVRLRDSDQQAALTDRETE 187

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           CL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + + I+
Sbjct: 188 CLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGIL 241


>gi|59940071|gb|AAX12574.1| LuxR-type transcriptional regulator [Aeromonas caviae]
 gi|59940073|gb|AAX12575.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. sobria]
 gi|59940077|gb|AAX12577.1| LuxR-type transcriptional regulator [Aeromonas enteropelogenes]
 gi|59940085|gb|AAX12581.1| LuxR-type transcriptional regulator [Aeromonas sp. AE-51]
 gi|59940087|gb|AAX12582.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
 gi|59940099|gb|AAX12588.1| LuxR-type transcriptional regulator [Aeromonas sp. AN-24]
 gi|59940113|gb|AAX12595.1| LuxR-type transcriptional regulator [Aeromonas jandaei]
          Length = 260

 Score =  153 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 84/239 (35%), Gaps = 20/239 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            + + L     +         +   T  +G  ++          Q+   ++ +  P   V
Sbjct: 5   QQLEYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWV 64

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSL 133
           +    +       ++Q   +   P++    +                    G+ N     
Sbjct: 65  QAYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFP 124

Query: 134 TFDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LT 187
               A     L  +  +     +L +    +  ++ Y             +D +    LT
Sbjct: 125 LHGAAGENGILSFITAERASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALT 184

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 185 DRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940081|gb|AAX12579.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. sobria]
 gi|59940101|gb|AAX12589.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
 gi|59940163|gb|AAX12620.1| LuxR-type transcriptional regulator [Aeromonas sp. 26m]
          Length = 260

 Score =  153 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 84/239 (35%), Gaps = 20/239 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            + + L     +         +   T  +G  ++          Q+   ++ +  P   V
Sbjct: 5   QQLEYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWV 64

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSL 133
           +    +       ++Q   +   P++    +                    G+ N     
Sbjct: 65  QAYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFP 124

Query: 134 TFDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LT 187
               A     L  +  +     +L +    +  ++ Y             +D +    LT
Sbjct: 125 LHGAAGENGILSFITAERASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALT 184

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 185 DRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|66277258|gb|AAY44560.1| LuxR-like protein [Aeromonas veronii]
          Length = 258

 Score =  153 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 49/234 (20%), Positives = 82/234 (35%), Gaps = 18/234 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAGLIGRFTVDMGYDYYGFTLIIPMSMQRPKVVLFNQCPISWVQTY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       V+Q   +   P++    +                    G+ N        
Sbjct: 68  TDNNMLACDPVIQLARKQTLPIYWNRLDERARFLQEGSMDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE--LTGREVE 192
            A     L  +  +     +L +    +  +A Y              D +  LT RE E
Sbjct: 128 AAGENGILSFITSERASSDLLLESSPILSWMANYIFEAAIRVVRLRDSDQQAALTDRETE 187

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           CL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + + I+
Sbjct: 188 CLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGIL 241


>gi|59940103|gb|AAX12590.1| LuxR-type transcriptional regulator [Aeromonas sp. AN-30]
 gi|59940105|gb|AAX12591.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
          Length = 260

 Score =  153 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/236 (20%), Positives = 83/236 (35%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    +                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGRE 190
            A     L  +  +     +L +    +  ++ Y             +D +    LT RE
Sbjct: 128 AAGENGILSFITAERASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 188 TECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940151|gb|AAX12614.1| LuxR-type transcriptional regulator [Aeromonas sp. 11m]
          Length = 260

 Score =  153 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/236 (20%), Positives = 83/236 (35%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    +                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGRE 190
            A     L  +  +     +L +    +  ++ Y             +D +    LT RE
Sbjct: 128 AAGENGILSFITAERASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 188 TECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|66277260|gb|AAY44561.1| LuxR-like protein [Aeromonas veronii]
          Length = 258

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 49/234 (20%), Positives = 82/234 (35%), Gaps = 18/234 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAGLIGRFTVDMGYDYYGFTLIIPMSMQRPKVVLFNQCPISWVQTY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       V+Q   +   P++    +                    G+ N        
Sbjct: 68  TDNNMLACDPVIQLARKQTLPIYWNRLDERARFLQEGSMDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE--LTGREVE 192
            A     L  +  +     +L +    +  +A Y              D +  LT RE E
Sbjct: 128 AAGENGILSFITSERASSDLLLESSPILSWMANYIFEAAIRVVRLRDSDQQAALTDRETE 187

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           CL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + + I+
Sbjct: 188 CLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGIL 241


>gi|59940069|gb|AAX12573.1| LuxR-type transcriptional regulator [Aeromonas veronii]
          Length = 260

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 47/238 (19%), Positives = 81/238 (34%), Gaps = 20/238 (8%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           + + L     +         +   T  +G  ++          Q+   ++ +  P   V+
Sbjct: 6   QLEYLEHFTSVTDGNRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQ 65

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLT 134
               +       V++   +   P++    +                    G+ N      
Sbjct: 66  AYTENNMLACDPVIRLARKQTLPIYWNRLDERASFLQEGTMDVMGLAAEFGLRNGISFPL 125

Query: 135 FDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDF----ELTG 188
              A     L  +  +     +L +    +  ++ Y              D      LT 
Sbjct: 126 HGAAGENGILSFITSERASSDLLLESSPILSWMSNYIFEAAIRVVRFSMMDSAGKDPLTE 185

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V   ++
Sbjct: 186 RETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSTGLL 243


>gi|66277254|gb|AAY44558.1| LuxR-like protein [Aeromonas caviae]
          Length = 260

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 47/238 (19%), Positives = 83/238 (34%), Gaps = 20/238 (8%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           + + L     +         +   T  +G  ++          Q+   ++ +  P   V+
Sbjct: 6   QLEYLEHFTLVTDGNRLAEVIGRFTLGMGYDYYRFALILPMSMQRPKVVLFNQCPDSWVQ 65

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLPEN--------------ITPPAGMDNRYCSLT 134
              L+       ++Q       P++    +               +    G+ N      
Sbjct: 66  AYTLNNMLACDPIIQLARRQTLPIYWNRLDEKARFLQEGSMDVMGLAAEFGLRNGISFPL 125

Query: 135 FDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMF----KSYDVHWGKDFELTG 188
              A     L  +  +     ++ +    +  ++ Y         +           LT 
Sbjct: 126 HGAAGENGILSFITRERASSDLMLESSPILSWMSNYIFEAAIRIVRQSMREDDPQEPLTE 185

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 186 RETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940091|gb|AAX12584.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
 gi|59940093|gb|AAX12585.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
          Length = 260

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/236 (20%), Positives = 83/236 (35%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    +                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGRE 190
            A     L  +  +     +L +    +  ++ Y             +D +    LT RE
Sbjct: 128 AAGENGILSFITAERASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 188 TECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940107|gb|AAX12592.1| LuxR-type transcriptional regulator [Aeromonas enteropelogenes]
          Length = 258

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 49/234 (20%), Positives = 82/234 (35%), Gaps = 18/234 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRCAGLIGRFTLDMGYDYYGFTLIIPMSMQRPKVVLFNQCPISWVQTY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       V+Q   +   P++    +                    G+ N        
Sbjct: 68  TDNNMLACDPVIQLARKQTLPIYWNRLDERARFLQEGSMDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE--LTGREVE 192
            A     L  +  +     +L +    +  +A Y              D +  LT RE E
Sbjct: 128 AAGENGILSFITSERASSDLLLESSPILSWMANYIFEAAIRVVRLRDSDQQAALTDRETE 187

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           CL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + + I+
Sbjct: 188 CLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGIL 241


>gi|59940127|gb|AAX12602.1| LuxR-type transcriptional regulator [Aeromonas sp. Manipal A1]
 gi|59940139|gb|AAX12608.1| LuxR-type transcriptional regulator [Aeromonas caviae]
 gi|59940153|gb|AAX12615.1| LuxR-type transcriptional regulator [Aeromonas sp. 12m]
 gi|59940161|gb|AAX12619.1| LuxR-type transcriptional regulator [Aeromonas sp. 19m]
          Length = 260

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/238 (20%), Positives = 84/238 (35%), Gaps = 20/238 (8%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           + + L     +         +   T  +G  ++          Q+   ++ +  P   V+
Sbjct: 6   QLEYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQ 65

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLT 134
               +       ++Q   +   P++    +                    G+ N      
Sbjct: 66  AYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPL 125

Query: 135 FDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTG 188
              A     L  +  +     +L +    +  ++ Y             +D +    LT 
Sbjct: 126 HGAAGENGILSFITAERASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTD 185

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 186 RETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940047|gb|AAX12562.1| LuxR-type transcriptional regulator [Aeromonas jandaei]
 gi|59940057|gb|AAX12567.1| LuxR-type transcriptional regulator [Aeromonas enteropelogenes]
 gi|59940079|gb|AAX12578.1| LuxR-type transcriptional regulator [Aeromonas caviae]
 gi|59940147|gb|AAX12612.1| LuxR-type transcriptional regulator [Aeromonas sp. QM 70363]
          Length = 260

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/238 (20%), Positives = 84/238 (35%), Gaps = 20/238 (8%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           + + L     +         +   T  +G  ++          Q+   ++ +  P   V+
Sbjct: 6   QLEYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQ 65

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLT 134
               +       ++Q   +   P++    +                    G+ N      
Sbjct: 66  AYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPL 125

Query: 135 FDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTG 188
              A     L  +  +     +L +    +  ++ Y             +D +    LT 
Sbjct: 126 HGAAGENGILSFITAERASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTD 185

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 186 RETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|218514308|ref|ZP_03511148.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli 8C-3]
          Length = 254

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 46/231 (19%), Positives = 81/231 (35%), Gaps = 21/231 (9%)

Query: 30  SDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLD-SIVSSDWPFDLVR 88
            D +  +  L         M  +TE      F+++         L  + V + WP +L+ 
Sbjct: 13  DDYIKEIAGLKTQFDIFRFMKRVTEAYRCRAFMVLNLPPITSLDLQGNTVITSWPAELLA 72

Query: 89  CMALSEKDKYYNVLQRPTELFCPVF-------HTLPENITPP-------AGMDNRYCSLT 134
                       VL+R      P          +  +  +           M       T
Sbjct: 73  LYDQEGLMVNSPVLRRLRTSARPFSYDMSRQNWSRDDGKSDLVVGLFERFRMTRCAYFPT 132

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-LTGREVEC 193
            + + +R  +     +        + E+  +A +  +          +  + LT RE++C
Sbjct: 133 HEPSGLRGAVSFAGDREP-FSPTEMRELCYIAIHVFDRLAEIRNLDTRVTDALTDREIDC 191

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           L W + GKTS EIA IL +S +TVN+Y+    +K  T  R+     A R  
Sbjct: 192 LNWTAAGKTSAEIAEILVLSEHTVNHYLNRATKKLDTVNRTQ----ARRQG 238


>gi|59940157|gb|AAX12617.1| LuxR-type transcriptional regulator [Aeromonas sp. 15m]
          Length = 260

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 84/239 (35%), Gaps = 20/239 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            + + L     +         +   T  +G  ++          Q+   ++ +  P   V
Sbjct: 5   QQLEYLEHFTSVTDGDRLAELIGRFTLGMGYEYYRFALIIPMSMQRPKVVLFNQCPDSWV 64

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSL 133
           +    +       ++Q   +   P++    +                    G+ N     
Sbjct: 65  QAYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFP 124

Query: 134 TFDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LT 187
               A     L  +  +     +L +    +  ++ Y             +D +    LT
Sbjct: 125 LHGAAGENGILSFITAERASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALT 184

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 185 DRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|167566108|ref|ZP_02359024.1| probable transcriptional activator of quorum sensing autoinducer
           synthesis transcription regulator protein [Burkholderia
           oklahomensis EO147]
          Length = 236

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 40/233 (17%), Positives = 75/233 (32%), Gaps = 13/233 (5%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
              +DLL  +     +      +   T  +G  +F           K   ++ S++P   
Sbjct: 3   LKLTDLLLSITQKSTSSEIFSSLEKYTRELGFDNFSYGFCHPIPFTKPRIVILSNYPERW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVA 138
               +          +        P   +           +     G+   +     D  
Sbjct: 63  RGRYSELGYVNIDPTVLHGRNSQSPFTWSELPTSDVRSFWDEANAHGLVVGWAKSILDSD 122

Query: 139 RIRIGLMLLFPKGRIILRDRLW---EIGLLAAYQANMFKSY--DVHWGKDFELTGREVEC 193
                L L      +  ++       + LLA     +              +L+ REVE 
Sbjct: 123 GGLGMLTLARSNEELCGKELAAKNLRMCLLADLTHMVLSDAYRKEMTASADKLSAREVEI 182

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W ++GKT+DEI  IL IS +TV  +  + + K     ++ A+A A    ++
Sbjct: 183 LRWHADGKTADEIGRILSISIDTVKFHTKNAVVKLGASNKTAAVARAAIMGLL 235


>gi|66277280|gb|AAY44571.1| LuxR-like protein [Aeromonas caviae]
          Length = 258

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 48/234 (20%), Positives = 81/234 (34%), Gaps = 18/234 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAGLIGRFTVDMGYDYYGFTLIIPMSMQRPKVVLFNQCPISWVQTY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       V+Q   +   P++    +                    G+ N        
Sbjct: 68  TDNNMLACDPVIQLARKQTLPIYWNRLDERARFLQEGSMDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE--LTGREVE 192
                  L  +  +     +L +    +  +A Y              D +  LT RE E
Sbjct: 128 APGENGILSFITSERASSDLLLESSPILSWMANYIFEAAIRVVRLRDSDQQAALTDRETE 187

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           CL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + + I+
Sbjct: 188 CLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGIL 241


>gi|59940143|gb|AAX12610.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. sobria]
          Length = 260

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 47/236 (19%), Positives = 80/236 (33%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGNRLAELIGRFTLGMGYDYYRFALILPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       V++   +   P++    +                    G+ N        
Sbjct: 68  TENNMLACDPVIRLARKQTLPIYWNRLDERASFLQEGTMDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDF----ELTGRE 190
            A     L  +  +     +L +    +  ++ Y              D      LT RE
Sbjct: 128 AAGENGILSFITSERASSDLLLESSPILSWMSNYIFEAAIRVVRFSMMDSAGKDPLTERE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V   ++
Sbjct: 188 TECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSTGLL 243


>gi|66277274|gb|AAY44568.1| LuxR-like protein [Aeromonas sp. CCRC 13880]
          Length = 260

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 48/236 (20%), Positives = 82/236 (34%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    +                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGRE 190
            A     L  +  +     +L +    +  +  Y             +D +    LT RE
Sbjct: 128 AAGENGILSFITAERASSDLLLESSPVLSWMCNYIFEAAIRIVRVSLRDDDPQEALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 188 TECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940149|gb|AAX12613.1| LuxR-type transcriptional regulator [Aeromonas sp. 1m]
          Length = 260

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 49/236 (20%), Positives = 83/236 (35%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    +                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGRE 190
            A     L  +  +     +L +    +  ++ Y             +D E    LT RE
Sbjct: 128 AAGENGILSFITAERASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDEPQEALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 188 TECLVWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940095|gb|AAX12586.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
 gi|59940097|gb|AAX12587.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
 gi|89027173|gb|ABD59317.1| AhyR [Aeromonas hydrophila]
          Length = 260

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 48/236 (20%), Positives = 83/236 (35%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    +                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGRE 190
            A     L  +  +     +L +    +  ++ Y             +D +    LT RE
Sbjct: 128 AAGENGILSFITAERASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 188 TECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|66277270|gb|AAY44566.1| LuxR-like protein [Aeromonas sp. ym3]
          Length = 260

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 48/236 (20%), Positives = 83/236 (35%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    +                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGRE 190
            A     L  +  +     +L +    +  ++ Y             +D +    LT RE
Sbjct: 128 AAGENGILSFITAERASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 188 TECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|320333891|ref|YP_004170602.1| two component LuxR family transcriptional regulator [Deinococcus
           maricopensis DSM 21211]
 gi|319755180|gb|ADV66937.1| two component transcriptional regulator, LuxR family [Deinococcus
           maricopensis DSM 21211]
          Length = 228

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 29/240 (12%), Positives = 64/240 (26%), Gaps = 30/240 (12%)

Query: 7   QVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRW 66
            + ++L  +          L      L  +   +       +   L              
Sbjct: 13  PITLLLVDDHPVVRKGTRDLLEGEPDLKVLGEAENGEDAIQKTRDL-------------- 58

Query: 67  DLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGM 126
                  +D  +      +  + +           +     L    +             
Sbjct: 59  -QPNVILMDVSMPGMNGIEATKRIKAE--------MPHVGVLVLTSYDDDAYVFALLEAG 109

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFEL 186
              Y         +   +  +      +      +           F +       +  L
Sbjct: 110 AAGYLLKNAREDELLGAVRAVAAGESALHPSVARK-------VLERFSTNQTPSPPEETL 162

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + RE+E L   + G+T+ EIA  L IS  TV  ++A+I  K    +R+ A+ Y ++   +
Sbjct: 163 SPRELEVLRIAATGRTNKEIARDLDISPRTVQVHLANIFSKLGVGSRTEAVLYGIKRGWI 222


>gi|13507195|gb|AAK28504.1| MupR [Pseudomonas fluorescens]
          Length = 234

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 48/232 (20%), Positives = 87/232 (37%), Gaps = 17/232 (7%)

Query: 32  LLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMA 91
           +L  ++  +   +W+  ++AL +  G S  L             S + S++         
Sbjct: 1   MLEDILMCETLEAWSKVLFALAKEYGFSSVLFGVKPTISTPFSSSTIISNYSRSWRSIYD 60

Query: 92  LSEKDKYYNVLQRPTELFCPVFHTL----------PENITPPAGMDNRYCSLTFDVARIR 141
            +   +   V+        P+  T                  +G+ +  C          
Sbjct: 61  ANAYYEVDPVVFHCLNSSLPLVWTKENFINKPEQQLYEAASASGVCSGLCMPIHGPRGEF 120

Query: 142 IGLMLLFPKGRIILRDR---LWEIGLLAAYQANMFKSYDVHWGKDFE----LTGREVECL 194
             L  +  +       R   L +  L+  Y    F+       K+ E    LT RE+ECL
Sbjct: 121 GMLNFITDEKSPADVIRSKGLPQFALMRDYLIESFQKIQSAAEKEVEKPPKLTARELECL 180

Query: 195 TWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            W++ GKTS EI+ IL  +  TVN ++ + MRK   ++R  A+   +R+ +V
Sbjct: 181 KWVAAGKTSWEISRILSCAEVTVNYHVTNFMRKFNAESRQHAVISGIRSGLV 232


>gi|212640416|ref|YP_002316936.1| NarL family DNA-binding response regulator [Anoxybacillus
           flavithermus WK1]
 gi|212561896|gb|ACJ34951.1| DNA-binding response regulator, NarL family (REC-HTH domains)
           [Anoxybacillus flavithermus WK1]
          Length = 260

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 39/240 (16%), Positives = 76/240 (31%), Gaps = 14/240 (5%)

Query: 13  NREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQE 71
             E E+ T+  + +    D       +   + +      + E   G     LV       
Sbjct: 26  VSEKERGTTMKTRIVLIDDHKLFREGIKRILDFEQDFEVVAEGSDGDEALALVERYKPDV 85

Query: 72  QKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYC 131
             +D  +      +  R +                 +   +       +         Y 
Sbjct: 86  VIMDINMPHVNGVEATRQLIE--------AYPDTKVIILSIHDDESYVMHALQTGAMGYL 137

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIG-----LLAAYQANMFKSYDVHWGKDFEL 186
               D   +   + ++   G  +       +      L+A       K           L
Sbjct: 138 LKEMDADALIEAVRVVAEGGSYLHPKVTHNLVKEYRRLVAGEGGGKEKQNQDVCRPYHLL 197

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T RE E L  +++GK++  IA  L IS  TV N++++I++K     R+ A+  A++N  V
Sbjct: 198 TRRECEVLQLLADGKSNKGIADALYISEKTVKNHVSNILQKLNVNDRTQAVVVAIKNGWV 257


>gi|159184353|ref|NP_353554.2| LuxR family transcriptional regulator [Agrobacterium tumefaciens
           str. C58]
 gi|159139669|gb|AAK86339.2| transcriptional regulator, LuxR family [Agrobacterium tumefaciens
           str. C58]
          Length = 226

 Score =  152 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 105/223 (47%), Positives = 141/223 (63%), Gaps = 2/223 (0%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFD 85
              R  L   +       +    +  L  Y GASH+LL R DL +E  L  IV+SDWPFD
Sbjct: 4   PLPRDQLAKNVAATAAAGNVAGALDLLVTYAGASHYLLARDDLLEETGLKFIVTSDWPFD 63

Query: 86  LVRC--MALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
           LVR   + L+      + +++   L  P    LP++++ P G+D +Y +L+F V RIR+ 
Sbjct: 64  LVRRLGIELTNSQNRSSEMEKCLSLLQPRLLLLPDDVSVPYGIDRQYSALSFCVGRIRLS 123

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           L+LLFP+  +   +RL EI LL  Y  +   + +    +D +LT RE+ECL WI+EGKTS
Sbjct: 124 LLLLFPEEAVPSPERLREIALLTGYCVSFGIASEAKTVRDIDLTERELECLFWIAEGKTS 183

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           DEIA+ILGISRNT+NNYI S+MRKTATKTRS AIAYAVRNN+V
Sbjct: 184 DEIAMILGISRNTINNYITSVMRKTATKTRSEAIAYAVRNNLV 226


>gi|238917970|ref|YP_002931487.1| two-component system, NarL family, response regulator DegU
           [Eubacterium eligens ATCC 27750]
 gi|238873330|gb|ACR73040.1| two-component system, NarL family, response regulator DegU
           [Eubacterium eligens ATCC 27750]
          Length = 214

 Score =  152 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 39/239 (16%), Positives = 79/239 (33%), Gaps = 30/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           +N++L  + +     +  L      +  +                    G     +    
Sbjct: 3   INVLLADDHKMVREGLKQLLEIDSEIKVVGEAGD---------------GYECLNITNKT 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 LD  + +     ++  M   +             +   + + +   I       
Sbjct: 48  KPNIVLLDLNMPNLDGLQVLSIMKQQKM--------LCKIIVLTIHNEIEYLIKAIDIGC 99

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + Y     +   ++  +  ++     I    +  +              DV   K  ELT
Sbjct: 100 DGYILKDSNFDTLKKAIFSVYAGETYIEPSLMPLL-------NASLAERDVLKDKVSELT 152

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE+E L  I+ G  + EIA  L IS  TV N++++I +K     R+ A  +A++NNI+
Sbjct: 153 RRELEVLKMIASGAFNKEIASTLNISERTVKNHVSNIFKKIGVSDRTQAAVFAIKNNII 211


>gi|325291913|ref|YP_004277777.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
 gi|325059766|gb|ADY63457.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
          Length = 251

 Score =  152 bits (384), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 106/242 (43%), Positives = 148/242 (61%), Gaps = 2/242 (0%)

Query: 7   QVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRW 66
           +V++ + R   +    +     R  L   +       + +  +  L  Y GASH+LL R 
Sbjct: 10  KVDVDIRRLSAKPMEGMGKPLPRDQLAKNVAASAAAGNVSGALDLLVTYAGASHYLLARE 69

Query: 67  DLFQEQKLDSIVSSDWPFDLVRCMALS--EKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
           DL +E  L  I++SDWPFDLVR +           + +++   L  P    LP++++ P 
Sbjct: 70  DLLEETGLKFIITSDWPFDLVRRLGAELANSQNRSSEMEKCLSLLQPRLLVLPDDVSVPF 129

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
           G+D +Y +L+F V RIR+ L+LLFP+  +   DRL EI LL  Y  +   + +    +D 
Sbjct: 130 GIDRQYSALSFCVGRIRLSLLLLFPEHSVPSPDRLREIALLTGYCVSFGIASEAKAVRDI 189

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE+ECL WI+EGKTSDEIA+ILGISRNT+NNYI S+MRKTATKTRS AIAYAVRNN
Sbjct: 190 DLTERELECLFWIAEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIAYAVRNN 249

Query: 245 IV 246
           +V
Sbjct: 250 LV 251


>gi|330828294|ref|YP_004391246.1| LuxR-like protein [Aeromonas veronii B565]
 gi|328803430|gb|AEB48629.1| LuxR-like protein [Aeromonas veronii B565]
          Length = 268

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 47/236 (19%), Positives = 80/236 (33%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 16  EYLEHFTSVTDGNRLAELIGRFTLGMGYDYYRFALILPMSMQRPKVVLFNQCPDSWVQAY 75

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       V++   +   P++    +                    G+ N        
Sbjct: 76  TENNMLACDPVIRLARKQTLPIYWNRLDERASFLQEGTMDVMGLAAEFGLRNGISFPLHG 135

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDF----ELTGRE 190
            A     L  +  +     +L +    +  ++ Y              D      LT RE
Sbjct: 136 AAGENGILSFITSERASSDLLLESSPILSWMSNYIFEAAIRVVRFSMMDSAGKDPLTERE 195

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V   ++
Sbjct: 196 TECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSTGLL 251


>gi|170745593|ref|YP_001776815.1| LuxR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170752150|ref|YP_001783296.1| LuxR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659247|gb|ACB28299.1| transcriptional regulator, LuxR family [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659277|gb|ACB28328.1| transcriptional regulator, LuxR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 248

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 53/236 (22%), Positives = 86/236 (36%), Gaps = 21/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD-LFQEQKLDSIVSSDWPFDLVRC 89
           D++ R+      V     +       G   FL+        E   D  + S WP +  R 
Sbjct: 13  DIVHRLRRASTDVDVYSELRRSGAIFGYDVFLIAGLPRAPHENLYDCSLISGWPPEWGRR 72

Query: 90  MALSEKDKYYNVLQRPTELFCPVFHTLP------------ENITPPAGMDNRYCSLTFDV 137
                      V++       P                          ++  +C     +
Sbjct: 73  YQERRHMHVDPVIRHIRGTTDPFLWQEAVDAQVTPEGMVVMEEARAFSLNEGFCVPFHQI 132

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWG-------KDFELTGRE 190
                G+     +   + +D    + L+A Y  +  K+     G           LTGRE
Sbjct: 133 DGTEAGVSF-GGEQVRLSQDERAALHLVAIYAMSTAKAIARRRGLSEDDGTPPSPLTGRE 191

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W S GK++ EI VIL IS  TV +++ S +RK  + TR+ A+A A+R +I+
Sbjct: 192 AECLKWSSTGKSAWEIGVILSISTRTVEHHLGSAVRKLNSVTRTQAVAEALRRHII 247


>gi|48375112|gb|AAT42219.1| PcoR [Pseudomonas fluorescens]
          Length = 234

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 47/232 (20%), Positives = 87/232 (37%), Gaps = 17/232 (7%)

Query: 32  LLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMA 91
           +L  ++  +   +W+  +++L +  G S  L             S + S++         
Sbjct: 1   MLEEILMCETLDAWSQVLFSLAKDCGFSSVLFGVKPTISTPFSSSTIISNYSKSWRAFYD 60

Query: 92  LSEKDKYYNVLQRPTELFCPVFHTL----------PENITPPAGMDNRYCSLTFDVARIR 141
            +   +   V+        P+  T                  +G+ +  C          
Sbjct: 61  SNACYEVDPVVFHCLNSSLPLVWTKENFINPPELQLYEAASASGVRSGLCMPIHGPRGEF 120

Query: 142 IGLMLLFPKGRIIL---RDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGREVECL 194
             L  +  +           L +  L+  Y    F+       K+FE    LT RE+ECL
Sbjct: 121 GMLNFITDEKSPADLINAQGLPQFALMRDYLIESFQKLQNASEKEFETPPXLTARELECL 180

Query: 195 TWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            W++ GKTS EI+ IL  +  TVN ++ + MRK   ++R  A+   +R+ +V
Sbjct: 181 KWVAAGKTSWEISRILSCAEVTVNYHVTNFMRKFNAESRQHAVISGIRSGLV 232


>gi|66277276|gb|AAY44569.1| LuxR-like protein [Aeromonas sp. CCRC 13881]
          Length = 260

 Score =  151 bits (382), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 48/236 (20%), Positives = 83/236 (35%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    +                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGRE 190
            A     L  +  +     +L +    +  ++ Y             +D +    LT RE
Sbjct: 128 AAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 188 TECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940033|gb|AAX12555.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
          Length = 260

 Score =  151 bits (382), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 47/236 (19%), Positives = 84/236 (35%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L  +  +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHLTTVTDEDRLAELISRFTLGMGYDYYRFAVIIPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    +                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGRE 190
            A     L  +  +     +L +    +  ++ Y             ++ +    LT RE
Sbjct: 128 AAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 188 TECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940049|gb|AAX12563.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. veronii]
          Length = 260

 Score =  151 bits (382), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 47/236 (19%), Positives = 83/236 (35%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    +                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGRE 190
            A     L  +  +     +L +    +  ++ Y             ++ +    LT RE
Sbjct: 128 AAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 188 TECLFWASEGKTSGEIACILGITERTVNYHLNHVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940045|gb|AAX12561.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. sobria]
 gi|59940125|gb|AAX12601.1| LuxR-type transcriptional regulator [Aeromonas salmonicida subsp.
           salmonicida]
 gi|59940159|gb|AAX12618.1| LuxR-type transcriptional regulator [Aeromonas sp. 17m]
          Length = 260

 Score =  151 bits (382), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 84/239 (35%), Gaps = 20/239 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            + + L     +         +   T  +G  ++          Q+   ++ +  P   V
Sbjct: 5   QQLEYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWV 64

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSL 133
           +    +       ++Q   +   P++    +                    G+ N     
Sbjct: 65  QAYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFP 124

Query: 134 TFDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LT 187
               A     L  +  +     +L +    +  ++ Y             ++ +    LT
Sbjct: 125 LHGAAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALT 184

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 185 DRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940133|gb|AAX12605.1| LuxR-type transcriptional regulator [Aeromonas bestiarum]
          Length = 260

 Score =  151 bits (382), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 84/239 (35%), Gaps = 20/239 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            + + L     +         +   T  +G  ++          Q+   ++ +  P   V
Sbjct: 5   QQLEYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWV 64

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSL 133
           +    +       ++Q   +   P++    +                    G+ N     
Sbjct: 65  QAYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFP 124

Query: 134 TFDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LT 187
               A     L  +  +     +L +    +  ++ Y             ++ +    LT
Sbjct: 125 LHGAAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALT 184

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 185 DRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|66277278|gb|AAY44570.1| LuxR-like protein [Aeromonas sp. CCRC 13980]
          Length = 260

 Score =  151 bits (381), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 46/239 (19%), Positives = 83/239 (34%), Gaps = 20/239 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            + +       +         +   T  +G  ++          Q+   ++ +  P   V
Sbjct: 5   QQLEYFEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWV 64

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSL 133
           +    +       ++Q   +   P++    +                    G+ N     
Sbjct: 65  QAYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFP 124

Query: 134 TFDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LT 187
               A     L  +  +     +L +    +  ++ Y             ++ +    LT
Sbjct: 125 LHGAAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALT 184

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 185 DRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940075|gb|AAX12576.1| LuxR-type transcriptional regulator [Aeromonas caviae]
          Length = 260

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 48/238 (20%), Positives = 84/238 (35%), Gaps = 20/238 (8%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           + + L     +         +   T  +G  ++          Q+   ++ +  P   V+
Sbjct: 6   QLEYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQ 65

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLT 134
               +       ++Q   +   P++    E                    G+ N      
Sbjct: 66  AYTANHMLACDPIIQLARKQTLPIYWNRLEGRARFLQEGSLDVMGLAAEFGLRNGISFPL 125

Query: 135 FDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTG 188
              A     L  +  +     +L +    +  ++ Y             ++ +    LT 
Sbjct: 126 HGAAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTD 185

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 186 RETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|117620077|ref|YP_855658.1| transcriptional activator protein AhyR/asaR [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117561484|gb|ABK38432.1| transcriptional activator protein AhyR/asaR [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 264

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 41/237 (17%), Positives = 81/237 (34%), Gaps = 17/237 (7%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               DL+A+        +    +  L+  +G  +F L        Q+ D I+ +  P   
Sbjct: 12  LHALDLIAQFETAADERTIVTLLRELSGRMGFDYFRLALIFPSTIQRPDVIIFNGCPQAW 71

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLP--------------ENITPPAGMDNRYCS 132
           V     S       +++       P+                     +    G+ +    
Sbjct: 72  VDTYTSSGFFAIDPIVKCAMTKSTPILWADVVNDEERCDEQGREMMQLANEYGICDGITL 131

Query: 133 LTFDVARIRIGLMLLF--PKGRIILRDRLWEIGLLAAYQANMFKSYD-VHWGKDFELTGR 189
                      L  +   P+ +      +  I  L+ +                  L+ R
Sbjct: 132 PWHGANGHVGLLSFITSTPRTQQQWLSAVPFISWLSMHIFEAVARVCLAGLSPHDALSLR 191

Query: 190 EVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E+E   W +EGK   +IA ILGI+  TV  ++ +++ K    ++S AI++A++  +V
Sbjct: 192 ELEVCRWAAEGKQVSDIAQILGITPRTVTFHLNNVVSKLGASSKSQAISWALKQGMV 248


>gi|66277272|gb|AAY44567.1| LuxR-like protein [Aeromonas sp. ym4]
          Length = 260

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 47/236 (19%), Positives = 80/236 (33%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    +                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGTLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHW----GKDFELTGRE 190
            A     L  +  +     +L +    +  ++ Y                     LT RE
Sbjct: 128 AAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLLEDDPQDALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 188 TECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940111|gb|AAX12594.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. sobria]
          Length = 260

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 47/236 (19%), Positives = 82/236 (34%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +      +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAELIGRSLPGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    +                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGRE 190
            A     L  +  +     +L +    +  ++ Y             +D +    LT RE
Sbjct: 128 AAGENGILSFITAERASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 188 TECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940123|gb|AAX12600.1| LuxR-type transcriptional regulator [Aeromonas bestiarum]
 gi|59940137|gb|AAX12607.1| LuxR-type transcriptional regulator [Aeromonas bestiarum]
          Length = 260

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 84/239 (35%), Gaps = 20/239 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            + + L     +         +   T  +G  ++          Q+   ++ +  P   V
Sbjct: 5   QQLEYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWV 64

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSL 133
           +    +       ++Q   +   P++    E                    G+ N     
Sbjct: 65  QAYTANHMLACDPIIQLARKQTLPIYWNRLEGRARFLQEGSLDVMGLAAEFGLRNGISFP 124

Query: 134 TFDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LT 187
               A     L  +  +     +L +    +  ++ Y             ++ +    LT
Sbjct: 125 LHGAAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALT 184

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 185 DRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940067|gb|AAX12572.1| LuxR-type transcriptional regulator [Aeromonas veronii]
          Length = 260

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 83/239 (34%), Gaps = 20/239 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            + +       +         +   T  +G  ++          Q+   ++ +  P   V
Sbjct: 5   QQLEYFEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWV 64

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSL 133
           +    +       ++Q   +   P++    E                    G+ N     
Sbjct: 65  QAYTANHMLACDPIIQLARKQTLPIYWNRLEGRARFLQEGSLDVMGLAAEFGLRNGISFP 124

Query: 134 TFDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LT 187
               A     L  +  +     +L +    +  ++ Y             ++ +    LT
Sbjct: 125 LHGAAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALT 184

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 185 DRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|91974882|ref|YP_567541.1| regulatory protein, LuxR [Rhodopseudomonas palustris BisB5]
 gi|91681338|gb|ABE37640.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           BisB5]
          Length = 242

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 68/219 (31%), Gaps = 15/219 (6%)

Query: 41  CTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYN 100
              S   +        G S +++           D  +++ WP                 
Sbjct: 24  DGPSLIRQFETHIASGGFSAYIMAGLPSPGAGLADLTLANGWPRGWFELYVRENYIAVDP 83

Query: 101 VLQRPTELFCPVFHTLP-------------ENITPPAGMDNRYCSLTFDVARIRIGLMLL 147
           V +       P   +                      G+   YC            ++ +
Sbjct: 84  VPRHGATTVQPFEWSEAPYDRKQNRAAHKVMTHATEFGLVRGYCIPLHYDEG--GAVISM 141

Query: 148 FPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIA 207
                 +       + L+  Y  N  +S      +   LT RE E L W + GKT+ EI+
Sbjct: 142 AGDQPDLDPVAKGAMQLIGVYAHNRIRSLHRPKPQRRLLTSRECEILLWAAHGKTAWEIS 201

Query: 208 VILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +IL I+  TV  ++    +K     R+ A+A A+   ++
Sbjct: 202 IILHIAERTVKFHLIEASKKLNAVNRTAAVAKALAFGLI 240


>gi|145300631|ref|YP_001143472.1| transcriptional activator AsaR [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|61218504|sp|P0A3J5|AHYR_AERHY RecName: Full=Transcriptional activator protein AhyR/AsaR
 gi|61218505|sp|P0A3J6|AHYR_AERSA RecName: Full=Transcriptional activator protein AhyR/AsaR
 gi|899145|emb|CAA61654.1| AhyR [Aeromonas hydrophila]
 gi|1519237|gb|AAB70018.1| transcriptional activator [Aeromonas salmonicida]
 gi|142853403|gb|ABO91724.1| transcriptional activator AsaR [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 260

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 47/236 (19%), Positives = 83/236 (35%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    +                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGRE 190
            A     L  +  +     +L +    +  ++ Y             ++ +    LT RE
Sbjct: 128 AAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 188 TECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940135|gb|AAX12606.1| LuxR-type transcriptional regulator [Aeromonas bestiarum]
          Length = 260

 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 47/238 (19%), Positives = 84/238 (35%), Gaps = 20/238 (8%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           + + L     +         +   T  +G  ++          Q+   ++ +  P   V+
Sbjct: 6   QLEYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQ 65

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLT 134
               +       ++Q   +   P++    +                    G+ N      
Sbjct: 66  AYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPL 125

Query: 135 FDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTG 188
              A     L  +  +     +L +    +  ++ Y             ++ +    LT 
Sbjct: 126 HGAAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTD 185

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 186 RETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940117|gb|AAX12597.1| LuxR-type transcriptional regulator [Aeromonas media]
          Length = 260

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 46/238 (19%), Positives = 82/238 (34%), Gaps = 20/238 (8%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           + + L     +         +   T  +G  ++          Q+   ++ +  P   V+
Sbjct: 6   QLEYLEHFTLVTDGNRLAELIGRFTLGMGYDYYRFALILPMSMQRPKVVLFNQCPDSWVQ 65

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLPEN--------------ITPPAGMDNRYCSLT 134
              ++       ++Q       P++    +               +    G+ N      
Sbjct: 66  AYTVNNMLACDPIIQLARTQTLPIYWNRLDEKARFLQEGSMDVMGLAAEFGLRNGISFPL 125

Query: 135 FDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMF----KSYDVHWGKDFELTG 188
                    L  +  +     +L +    +  ++ Y         +           LT 
Sbjct: 126 HGATGENGILSFITRERASSDLLLESSPILSWMSNYIFEAAIRIVRQSMREEDPQEALTD 185

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 186 RETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|39933398|ref|NP_945674.1| two-component LuxR family transcriptional regulator
           [Rhodopseudomonas palustris CGA009]
 gi|39647244|emb|CAE25765.1| two-component transcriptional regulator, LuxR family
           [Rhodopseudomonas palustris CGA009]
          Length = 243

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 72/219 (32%), Gaps = 16/219 (7%)

Query: 42  TVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNV 101
             +   R  +L    G + +++           +  +++ WP D               V
Sbjct: 25  APALISRFESLIASCGFTAYIMAGLPSRNAGLPELTLANGWPRDWFDLYVSENFSAVDPV 84

Query: 102 LQRPTELFCPVFH-------------TLPENITPPAGMDNRYCSLTFDVARIRIGLMLLF 148
            +       P                          G+   YC             + + 
Sbjct: 85  PRHGATTVHPFVWSDAPYDRDRDPAAHRVMTRAAEFGLVEGYCIPLHYDDG--SAAISMA 142

Query: 149 PKGRIILRDRLWEIGLLAAYQANMFKSYDVHWG-KDFELTGREVECLTWISEGKTSDEIA 207
            K   +       + L++ Y  +  ++       +   LT RE E L W ++GKT+ EI+
Sbjct: 143 GKDPDLSPAARGAMQLVSIYAHSRLRALSRPKPIRRNRLTPRECEILQWAAQGKTAWEIS 202

Query: 208 VILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           VIL I+  TV  ++    RK     R+ A+A A+   ++
Sbjct: 203 VILCITERTVKFHLIEAARKLDAANRTAAVAKALTLGLI 241


>gi|169797684|ref|YP_001715477.1| autoinducer-binding transcriptional regulator [Acinetobacter
           baumannii AYE]
 gi|213155522|ref|YP_002317567.1| eR transcriptional regulator [Acinetobacter baumannii AB0057]
 gi|215485038|ref|YP_002327279.1| Transcriptional activator protein phzR [Acinetobacter baumannii
           AB307-0294]
 gi|239503083|ref|ZP_04662393.1| Transcriptional activator protein phzR [Acinetobacter baumannii
           AB900]
 gi|301348492|ref|ZP_07229233.1| Transcriptional activator protein phzR [Acinetobacter baumannii
           AB056]
 gi|301513441|ref|ZP_07238678.1| Transcriptional activator protein phzR [Acinetobacter baumannii
           AB058]
 gi|301597204|ref|ZP_07242212.1| Transcriptional activator protein phzR [Acinetobacter baumannii
           AB059]
 gi|332853574|ref|ZP_08434826.1| putative autoinducer-binding transcriptional regulator BmaR5
           [Acinetobacter baumannii 6013150]
 gi|332869309|ref|ZP_08438707.1| putative autoinducer-binding transcriptional regulator BmaR5
           [Acinetobacter baumannii 6013113]
 gi|169150611|emb|CAM88520.1| putative Autoinducer-binding transcriptional regulator (LuxR
           family) [Acinetobacter baumannii AYE]
 gi|193076010|gb|ABO10598.2| eR transcriptional regulator [Acinetobacter baumannii ATCC 17978]
 gi|213054682|gb|ACJ39584.1| eR transcriptional regulator [Acinetobacter baumannii AB0057]
 gi|213987791|gb|ACJ58090.1| Transcriptional activator protein phzR [Acinetobacter baumannii
           AB307-0294]
 gi|323516195|gb|ADX90576.1| autoinducer-binding transcriptional regulator [Acinetobacter
           baumannii TCDC-AB0715]
 gi|332728538|gb|EGJ59911.1| putative autoinducer-binding transcriptional regulator BmaR5
           [Acinetobacter baumannii 6013150]
 gi|332732817|gb|EGJ64032.1| putative autoinducer-binding transcriptional regulator BmaR5
           [Acinetobacter baumannii 6013113]
          Length = 238

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 80/235 (34%), Gaps = 18/235 (7%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           + DLL+  + +         + +    +G  +            +  +I+ +++P    +
Sbjct: 5   QEDLLSAFLVVKNEYQLFEIVKSTASRLGFDYCAYGMQSPLSIAEPKTIMLNNYPEAWQK 64

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHT----------LPENITPPAGMDNRYCSLTFDVA 138
                +  K    +Q       P+  +                   G++  +   + D  
Sbjct: 65  RYVERQYVKIDPTVQHCMVSLQPLVWSSQSAKTQAEKDFWEEARSYGLNVGWAQSSRDFI 124

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-------LTGREV 191
             R  L L     + +             +      S       D E       LT RE 
Sbjct: 125 GTRGMLTLARSNDQ-LSEKEQKAQYTNMYWLTQTVHSSIAKIVNDVEFAKFNLYLTNREK 183

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKTS EIA ILG++  TVN ++++ M+K     +  A   AV   ++
Sbjct: 184 EALRWTAEGKTSAEIAQILGVTERTVNFHLSNSMQKLNVNNKISAAIRAVMLGLL 238


>gi|59940141|gb|AAX12609.1| LuxR-type transcriptional regulator [Aeromonas veronii bv. sobria]
          Length = 260

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 80/239 (33%), Gaps = 20/239 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            + + L               +   T  +G  ++          Q+   ++ +  P   V
Sbjct: 5   QQLEYLEHFNSSADGNRLAELIGRFTLGMGYDYYRFALILPMSMQRPKVVLFNQCPDSWV 64

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSL 133
           +    +       V++   +   P++    +                    G+ N     
Sbjct: 65  QAYTENNMLACDPVIRLARKQTLPIYWNRLDERASFLQEGTMDVMGLAAEFGLRNGISFP 124

Query: 134 TFDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDF----ELT 187
               A     L  +  +     +L +    +  ++ Y              D      LT
Sbjct: 125 LHGAAGENGILSFITSERASSDLLLESSPILSWMSNYIFEAAIRVVRFSMMDSAGKDPLT 184

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V   ++
Sbjct: 185 ERETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKEVSTGLL 243


>gi|184156458|ref|YP_001844797.1| DNA-binding HTH domain-containing protein [Acinetobacter baumannii
           ACICU]
 gi|183208052|gb|ACC55450.1| DNA-binding HTH domain-containing protein [Acinetobacter baumannii
           ACICU]
          Length = 238

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 81/235 (34%), Gaps = 18/235 (7%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           + DLL+  + +         + ++   +G  +            +  +I+ +++P    +
Sbjct: 5   QEDLLSAFLVVKNEYQLFDIVKSIASRLGFDYCAYGMQSPLSIAEPKTIMLNNYPEAWQK 64

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHT----------LPENITPPAGMDNRYCSLTFDVA 138
                +  K    +Q       P+  +                   G++  +   + D  
Sbjct: 65  RYVEQQYVKIDPTVQHCMVSLQPLVWSSQSAKTQAEKDFWEEARSYGLNVGWAQSSRDFI 124

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-------LTGREV 191
             R  L L     + +             +      S       D E       LT RE 
Sbjct: 125 GTRGMLTLARSNDQ-LSEKEQKAQYTNMYWLTQTVHSSIAKIVNDVEFAKFNLYLTNREK 183

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKTS EIA ILG++  TVN ++++ M+K     +  A   AV   ++
Sbjct: 184 EALRWTAEGKTSAEIAQILGVTERTVNFHLSNSMQKLNVNNKISAAIRAVMLGLL 238


>gi|59940115|gb|AAX12596.1| LuxR-type transcriptional regulator [Aeromonas veronii]
          Length = 260

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 48/238 (20%), Positives = 84/238 (35%), Gaps = 20/238 (8%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           + + L     +         +   T  +G  ++          Q+   ++ +  P   V+
Sbjct: 6   QLEYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQ 65

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLT 134
               +       ++Q   +   P++    E                    G+ N      
Sbjct: 66  AYTANHMLACDPIIQLARKQTLPIYWNRLEGRARFLQEGSLDVMGLAAEFGLRNGISFPL 125

Query: 135 FDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTG 188
              A     L  +  +     +L +    +  ++ Y             ++ +    LT 
Sbjct: 126 HGAAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTD 185

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 186 RETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|192288754|ref|YP_001989359.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           TIE-1]
 gi|192282503|gb|ACE98883.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           TIE-1]
          Length = 243

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 72/219 (32%), Gaps = 16/219 (7%)

Query: 42  TVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNV 101
             +   R  +L    G + +++           +  +++ WP D               V
Sbjct: 25  APALISRFESLIASCGFTAYIMAGLPSRNAGLPELTLANGWPRDWFDLYVSENFSAVDPV 84

Query: 102 LQRPTELFCPVFH-------------TLPENITPPAGMDNRYCSLTFDVARIRIGLMLLF 148
            +       P                          G+   YC             + + 
Sbjct: 85  PRHGATTVYPFVWSDAPYDRDRDPAAHRVMTRAAEFGLVEGYCIPLHYDDG--SAAISMA 142

Query: 149 PKGRIILRDRLWEIGLLAAYQANMFKSYDVHWG-KDFELTGREVECLTWISEGKTSDEIA 207
            K   +       + L++ Y  +  ++       +   LT RE E L W ++GKT+ EI+
Sbjct: 143 GKDPDLSPAARGAMQLVSIYAHSRLRALSRPKPIRRNRLTPRECEILQWAAQGKTAWEIS 202

Query: 208 VILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           VIL I+  TV  ++    RK     R+ A+A A+   ++
Sbjct: 203 VILCITERTVKFHLIEAARKLDAANRTAAVAKALTLGLI 241


>gi|59940061|gb|AAX12569.1| LuxR-type transcriptional regulator [Aeromonas encheleia]
 gi|59940121|gb|AAX12599.1| LuxR-type transcriptional regulator [Aeromonas bestiarum]
          Length = 260

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 48/236 (20%), Positives = 83/236 (35%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    E                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLEGRARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGRE 190
            A     L  +  +     +L +    +  ++ Y             ++ +    LT RE
Sbjct: 128 AAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 188 TECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|66277264|gb|AAY44563.1| LuxR-like protein [Aeromonas sp. SF8-170]
          Length = 260

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 47/236 (19%), Positives = 83/236 (35%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    +                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGRE 190
            A     L  +  +     +L +    +  ++ Y             ++ +    LT RE
Sbjct: 128 AAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 188 TECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|186473257|ref|YP_001860599.1| LuxR family transcriptional regulator [Burkholderia phymatum
           STM815]
 gi|184195589|gb|ACC73553.1| transcriptional regulator, LuxR family [Burkholderia phymatum
           STM815]
          Length = 234

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 35/231 (15%), Positives = 73/231 (31%), Gaps = 17/231 (7%)

Query: 33  LARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMAL 92
           ++ ++  +  V+W   +  L +  G    L+        +  D+ + S +     +    
Sbjct: 1   MSPLLEAENDVTWFRELARLADDWGFDRVLVGILPRPGMRLEDAFIRSTYSPTWRQFYNE 60

Query: 93  SEKDKYYNVLQRPTELFCPVFHT----------LPENITPPAGMDNRYCSLTFDVARIRI 142
                    +        P+  +                   G+            +   
Sbjct: 61  QGFAHIDPTVAHCMTKSSPLIWSPDLFDTYPAQTMYEEARAHGLRAGVSLPIHGPRQESG 120

Query: 143 GLMLL----FPKGRIILRDR-LWEIGLLAAYQANMFKSYDVHWGKD--FELTGREVECLT 195
            +  +             D  L  + LL     +  + +     +    +LT RE ECL 
Sbjct: 121 LICFVNDHNPSDDFWRHLDVVLPNLVLLRDLVIDTSQPHLNTHTQALVPKLTPREQECLK 180

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W + GK++ EI+ IL  S   VN ++ +I  K    +R  A   A +  ++
Sbjct: 181 WTARGKSTWEISHILNCSEAVVNFHLKNIRTKFGVNSRRAAAVIATQLGLI 231


>gi|66277282|gb|AAY44572.1| LuxR-like protein [Aeromonas popoffii]
          Length = 260

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 49/236 (20%), Positives = 85/236 (36%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L  +  +      +  +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHLTMVTDEDRLSELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    E                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLEGRARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGRE 190
            A     L  +  +     +L D    +  ++ Y             ++ +    LT RE
Sbjct: 128 AAGENGILSFITAEQASSDLLLDSSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 188 TECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|260557627|ref|ZP_05829841.1| transcriptional activator protein phzR [Acinetobacter baumannii
           ATCC 19606]
 gi|260408800|gb|EEX02104.1| transcriptional activator protein phzR [Acinetobacter baumannii
           ATCC 19606]
          Length = 238

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 80/235 (34%), Gaps = 18/235 (7%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           + DLL+  + +         + +    +G  +            +  +I+ +++P    +
Sbjct: 5   QEDLLSAFLVVKNEYQLFEIVKSTASRLGFDYCAYGMQSPLSIAEPKTIMLNNYPEAWQK 64

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHT----------LPENITPPAGMDNRYCSLTFDVA 138
                +  K    +Q       P+  +                   G++  +   + D  
Sbjct: 65  RYVERQYVKIDPTVQHCMASLQPLVWSSQSAKTQAEKDFWEEARSYGLNVGWAQSSRDFI 124

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-------LTGREV 191
             R  L L     + +             +      S       D E       LT RE 
Sbjct: 125 GTRGMLTLARSNDQ-LSEKEQKAQYTNMYWLTQTVHSSIAKIVNDVEFAKFNLYLTNREK 183

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKTS EIA ILG++  TVN ++++ M+K     +  A   AV   ++
Sbjct: 184 EALRWTAEGKTSAEIAQILGVTERTVNFHLSNSMQKLNVNNKISAAIRAVMLGLL 238


>gi|66277262|gb|AAY44562.1| LuxR-like protein [Aeromonas sp. SF6-7]
          Length = 260

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 75/234 (32%), Gaps = 20/234 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALILPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       V+    +   P++    +                    G+ N        
Sbjct: 68  TDNHMLACDPVIPLARKQTLPIYWNRLDERARFLPEGTMDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDV----HWGKDFELTGRE 190
                  L  +  +     +L +    +  ++ Y                     LT RE
Sbjct: 128 ATGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRMVRFSLMDSDPKDPLTERE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V   
Sbjct: 188 TECLFWASEGKTSSEIACILGITERTVNYHLNHVTRKTGSMNRYQAIAKGVSTG 241


>gi|59940035|gb|AAX12556.1| LuxR-type transcriptional regulator [Aeromonas caviae]
          Length = 260

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 85/239 (35%), Gaps = 20/239 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            + + L  +  +         +   T  +G  ++          Q+   ++ +  P   V
Sbjct: 5   QQLEYLEHLTTVTDEDRLAELISRFTLGMGYDYYRFAVIIPMSMQRRKVVLFNQCPDSWV 64

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSL 133
           +    +       ++Q   +   P++    E                    G+ N     
Sbjct: 65  QAYTANHMLACDPIIQLARKQTLPIYWNRLEGRARFLQEGSLDVMGLAAEFGLRNGISFP 124

Query: 134 TFDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LT 187
               A     L  +  +     +L +    +  ++ Y             ++ +    LT
Sbjct: 125 LHGAAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALT 184

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 185 DRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|88812489|ref|ZP_01127738.1| transcriptional regulator, LuxR family protein [Nitrococcus mobilis
           Nb-231]
 gi|88790275|gb|EAR21393.1| transcriptional regulator, LuxR family protein [Nitrococcus mobilis
           Nb-231]
          Length = 249

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 50/230 (21%), Positives = 72/230 (31%), Gaps = 20/230 (8%)

Query: 37  IPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKD 96
           +  D          AL E  G  HF+          K   +V S  P             
Sbjct: 15  LHADGVEGVQRLCAALGEAYGFDHFIYGASFPTSLIKPAVLVISGHPEAWRDHYQACGYL 74

Query: 97  KYYNVLQRPTELFCPVFHTLPE-------------NITPPAGMDNRYCSLTFDVARIRIG 143
                +Q  T    P+                         G+ +               
Sbjct: 75  AVDPAVQHCTRSIRPLIWQDLMLDPKIDEKPFTVMQEAREFGLVSGVSLSIRGSRGELGV 134

Query: 144 LMLLFPKGRIILRD----RLWEIGLLAAYQAN---MFKSYDVHWGKDFELTGREVECLTW 196
           L     +     R      + ++ LL+AY         +         ELT RE ECL W
Sbjct: 135 LSFSSERTAQQTRSEIDSAIPDLYLLSAYVHEAVGRLVTQGSLPFNRPELTAREHECLLW 194

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            +EGKTS EIA ILGIS  T   ++ +  R+    +R  A+A AV   ++
Sbjct: 195 AAEGKTSWEIARILGISERTAIFHLQNAARRLNASSRQQAVARAVSQGLI 244


>gi|59940063|gb|AAX12570.1| LuxR-type transcriptional regulator [Aeromonas popoffii]
          Length = 260

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 49/236 (20%), Positives = 83/236 (35%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTLVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    E                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLEGRARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGRE 190
            A     L  +  +     +L D    +  ++ Y             ++ +    LT RE
Sbjct: 128 AAGENGILSFITAEQASSDLLLDSSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 188 TECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|332981237|ref|YP_004462678.1| LuxR family two component transcriptional regulator [Mahella
           australiensis 50-1 BON]
 gi|332698915|gb|AEE95856.1| two component transcriptional regulator, LuxR family [Mahella
           australiensis 50-1 BON]
          Length = 217

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 33/241 (13%), Positives = 83/241 (34%), Gaps = 25/241 (10%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           + ++ +++  +       +  + +    +  +           +  ++            
Sbjct: 1   MDKIKVMIADDHPLMRQGLERILSLEPDIDVIAQAANGSEVIEKTKSII----------- 49

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                    +D  +      + ++ +  ++             +   V +     +    
Sbjct: 50  ----PDVILMDINMPVMNGLETIKVLKSNK----CP----SRIIMLTVHNDKQYLLESLK 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
                Y     +V ++   +   +     +  +      +L   QA+    ++V    D 
Sbjct: 98  LGACGYILKDAEVDQLVEAIHKAYRGQLYVQTEMAN--PVLKEDQASPLYGFNVGIRYDD 155

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E L  +++G ++ EIA  L IS  TV N+++SI RK     R+ A  YA+++ 
Sbjct: 156 DLTQREREVLALVAKGLSNGEIAKKLFISEKTVKNHLSSIFRKLNVSDRTQAAVYAIKHG 215

Query: 245 I 245
            
Sbjct: 216 Y 216


>gi|59940037|gb|AAX12557.1| LuxR-type transcriptional regulator [Aeromonas media]
          Length = 260

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 47/239 (19%), Positives = 82/239 (34%), Gaps = 20/239 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            + + L  +  +         M   T  +G   +          Q+   ++ +  P   V
Sbjct: 5   QQLEYLEHLTMVTDESRLAEVMSRFTVGIGYDDYRFAVILPTSMQRRKEVLFNQCPDSWV 64

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPEN--------------ITPPAGMDNRYCSL 133
           +   ++       ++Q       P++    +               +    G+ N     
Sbjct: 65  QAYTVNNMLACDPIIQLARTQTLPIYWNRLDEKARFLQEGSMDVMGLAAEFGLRNGISFP 124

Query: 134 TFDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMF----KSYDVHWGKDFELT 187
                     L  +  +     +L +    +  ++ Y         +           LT
Sbjct: 125 LHGATGESGILSFITRERASSDLLLESSPILSWMSNYIFEAAIRIVRQSMREEDPQEALT 184

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 185 DRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|66277268|gb|AAY44565.1| LuxR-like protein [Aeromonas sp. ym2]
          Length = 260

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 46/238 (19%), Positives = 80/238 (33%), Gaps = 20/238 (8%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           + + L     +         +   T  +G  ++          Q+   ++ +  P   V+
Sbjct: 6   QLEYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQ 65

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLT 134
               +       ++Q   +   P++    +                    G+ N      
Sbjct: 66  AYTDNHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGTLDVMGLAAEFGLRNGISFPL 125

Query: 135 FDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHW----GKDFELTG 188
              A     L  +  +     +L +    +  ++ Y                     LT 
Sbjct: 126 HGAAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLLEDDPQDALTD 185

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE ECL W SEGKTS +IA ILGI+  TVN ++  + RKT +  R  AIA  V   I+
Sbjct: 186 RETECLFWASEGKTSGDIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSRGIL 243


>gi|82703532|ref|YP_413098.1| LuxR family transcriptional regulator [Nitrosospira multiformis
           ATCC 25196]
 gi|82411597|gb|ABB75706.1| transcriptional regulator, LuxR family [Nitrosospira multiformis
           ATCC 25196]
          Length = 244

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 43/233 (18%), Positives = 73/233 (31%), Gaps = 18/233 (7%)

Query: 32  LLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMA 91
           L   ++  D           +   +G  HFL          +    + S +P +  +   
Sbjct: 6   LFESLLNCDSVEELHSATTTIARAMGFEHFLYGVQVNTSLTRPYRFILSCYPEEWRKHYD 65

Query: 92  LSEKDKYYNVLQRPTELFCPVFH----------TLPENITPPAGMDNRYCSLTFDVARIR 141
                 +   +        P+            T   N     G+ +             
Sbjct: 66  KEGYANFDPTVSHCARTSIPIIWKKEIFKGRRETRVRNEAKDCGLVSGASFSVHGGRGEA 125

Query: 142 IGLMLLFPKGRIILR----DRLWEIGLLAAYQANMFKSY----DVHWGKDFELTGREVEC 193
             L L   +     +      + +  LL  Y     +           K   LT RE EC
Sbjct: 126 AMLSLATSRESREAQNDILATMAKAQLLTCYLHEAVQRIVLSKGPLPVKKANLTEREQEC 185

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W +EGKT  EIA I+ IS  TV  ++ + ++K     R  AI+ A+   ++
Sbjct: 186 LLWAAEGKTGWEIANIVKISERTVTFHLQNAIQKLGVVNRQQAISRALSMGLI 238


>gi|59940031|gb|AAX12554.1| LuxR-type transcriptional regulator [Aeromonas bestiarum]
          Length = 260

 Score =  148 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 48/236 (20%), Positives = 84/236 (35%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L  +  +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHLTSVTDEDRLAELIGRFTLGMGYDYYRFAVIIPMSMQRRKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    E                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLEGRARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGRE 190
            A     L  +  +     +L +    +  ++ Y             ++ +    LT RE
Sbjct: 128 AAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 188 TECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|59940053|gb|AAX12565.1| LuxR-type transcriptional regulator [Aeromonas schubertii]
          Length = 260

 Score =  148 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 47/236 (19%), Positives = 82/236 (34%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIFPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    E                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLEERARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGRE 190
            A     L  +  +     +L +    +  ++ Y             ++ +    LT RE
Sbjct: 128 AAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDAQEALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W S GKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  + N I+
Sbjct: 188 TECLFWASRGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAMGISNGIL 243


>gi|260598411|ref|YP_003210982.1| DNA-binding transcriptional activator SdiA [Cronobacter turicensis
           z3032]
 gi|260217588|emb|CBA31841.1| Regulatory protein sdiA [Cronobacter turicensis z3032]
          Length = 241

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 40/232 (17%), Positives = 75/232 (32%), Gaps = 14/232 (6%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R ++  R   +  +      +   T+ +   +F L         +    + + +P   + 
Sbjct: 10  RREMTTRFQEIQDSGDIYSLLKTETQNMEYDYFALCVRHPVPFTRPKLTLHTTYPEAWLE 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTL---------PENITPPAGMDNRYCSLTFDVAR 139
                       VL+    L  P+               N     G+            R
Sbjct: 70  HYQAENYFVIDPVLKPANYLIGPLSWNDALFAGAAEELWNAARDHGLVKGVTQCVIAPNR 129

Query: 140 IRIGLMLLF---PKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGK--DFELTGREVECL 194
            +  L +         +   +    +  L           +       + +L+ RE E L
Sbjct: 130 AQGFLSVSGTSPRGHSMPDDELALRLQHLVEQSLVAMMRLEDPAATVLEMKLSKREKEIL 189

Query: 195 TWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 QWTAEGKTSAEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAAIGLI 241


>gi|306021776|gb|ADM80305.1| LuxR [Aeromonas sobria]
          Length = 237

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 48/221 (21%), Positives = 79/221 (35%), Gaps = 18/221 (8%)

Query: 44  SWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQ 103
                +   T  +G  ++          Q+   ++ +  P   V+    +       V+Q
Sbjct: 3   RLAGLIGRFTVDMGYDYYGFTLIIPMSMQRPKVVLFNQCPISWVQTYTDNNMLACDPVIQ 62

Query: 104 RPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFDVARIRIGLMLLFP 149
              +   P++    +                    G+ N         A     L  +  
Sbjct: 63  LARKQTLPIYWNRLDERARFLQEGSMDVMGLAAEFGLRNGISFPLHGAAGENGILSFITS 122

Query: 150 KGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE--LTGREVECLTWISEGKTSDE 205
           +     +L +    +  +A Y              D +  LT RE ECL W SEGKTS E
Sbjct: 123 ERASSDLLLESSPILSWMANYIFEAAIRVVRLRDSDQQAALTDRETECLFWASEGKTSGE 182

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           IA ILGI+  TVN ++  + RKT +  R  AIA  + + I+
Sbjct: 183 IACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGISSGIL 223


>gi|59940083|gb|AAX12580.1| LuxR-type transcriptional regulator [Aeromonas schubertii]
          Length = 260

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 84/239 (35%), Gaps = 20/239 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            + + L     +         +   T  +G  ++          Q+   ++ +  P   V
Sbjct: 5   QQLEYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWV 64

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSL 133
           +    +       ++Q   +   P++    +                    G+ N     
Sbjct: 65  QAYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFP 124

Query: 134 TFDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LT 187
               A     L  +  +     +L +    +  ++ Y             +D +    LT
Sbjct: 125 LHGAAGENGILSFITAERASSDLLLESSPVLSWMSNYIFEAAIRIVRVSLRDDDPQEALT 184

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 185 DRETECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSAIL 243


>gi|332875591|ref|ZP_08443403.1| putative autoinducer-binding transcriptional regulator BmaR5
           [Acinetobacter baumannii 6014059]
 gi|332736164|gb|EGJ67179.1| putative autoinducer-binding transcriptional regulator BmaR5
           [Acinetobacter baumannii 6014059]
          Length = 238

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 80/235 (34%), Gaps = 18/235 (7%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           + DLL+  + +         + +    +G  +            +  +I+ +++P    +
Sbjct: 5   QEDLLSAFLVVKNEYQLFDIVKSTASRLGFDYCAYGMQSPLSIAEPKTIMLNNYPEAWQK 64

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHT----------LPENITPPAGMDNRYCSLTFDVA 138
                +  K    +Q       P+  +                   G++  +   + D  
Sbjct: 65  RYVEGQYVKIDPTVQHCMVSLQPLVWSSQSAKTQAEKDFWEEARSYGLNVGWAQSSRDFI 124

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-------LTGREV 191
             R  L L     + +             +      S       D E       LT RE 
Sbjct: 125 GTRGMLTLARSNDQ-LSEKEQKAQYTNMYWLTQTVHSSIAKIVNDVEFAKFNLYLTNREK 183

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKTS EIA ILG++  TVN ++++ M+K     +  A   AV   ++
Sbjct: 184 EALRWTAEGKTSAEIAQILGVTERTVNFHLSNSMQKLNVNNKISAAIRAVMLGLL 238


>gi|323528655|ref|YP_004230807.1| LuxR family transcriptional regulator [Burkholderia sp. CCGE1001]
 gi|323385657|gb|ADX57747.1| transcriptional regulator, LuxR family [Burkholderia sp. CCGE1001]
          Length = 242

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 37/233 (15%), Positives = 71/233 (30%), Gaps = 17/233 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + +A ++       W   +  L E  G    L+        +  D+ V S +  +  R  
Sbjct: 7   EQMAPLLDAADEAEWFSAVAGLAETWGFDRLLVAMLPRPTIRLEDAYVRSTYAPEWRRTY 66

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLP----------ENITPPAGMDNRYCSLTFDVARI 140
                      +        P+  +                   G+            + 
Sbjct: 67  DEQGLVHIDPTVAHCATRSTPLVWSPEIFTTAPQQSMYEEARAHGLRAGVTLPIHGPNQE 126

Query: 141 RIGLMLLFPKGRIIL-----RDRLWEIGLLAAYQANMFKSYDVHWGKD--FELTGREVEC 193
              +  +                L  + LL     +  + +     +    +LT RE EC
Sbjct: 127 AGMMCFVNDASPTDTFWRHIDVVLPNLVLLRDLVIDTSQRHLNTHAQTLLPKLTPREREC 186

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GK++ EI+ IL  S   VN ++ +I  K    +R  A   A +  ++
Sbjct: 187 LQWTARGKSTWEISHILNCSEAVVNFHMKNIRTKLGVNSRRAAAVIATQLGLI 239


>gi|307727058|ref|YP_003910271.1| LuxR family transcriptional regulator [Burkholderia sp. CCGE1003]
 gi|307587583|gb|ADN60980.1| transcriptional regulator, LuxR family [Burkholderia sp. CCGE1003]
          Length = 242

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 36/233 (15%), Positives = 70/233 (30%), Gaps = 17/233 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + +A ++       W   +  L E  G    L+        +  D+ + S +     R  
Sbjct: 7   EQMAPLLNAADEAEWFSAVAKLAETWGFDRLLIAMLPRPTMRLEDAYIRSTYAPAWRRTY 66

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLP----------ENITPPAGMDNRYCSLTFDVARI 140
                      +        P+  +                   G+            + 
Sbjct: 67  DEQGLVHIDPTVAHCATRSTPLVWSPEIFTTAPQQSMYEEARAHGLRAGVTLPIHGPNQE 126

Query: 141 RIGLMLLFPKGRIIL-----RDRLWEIGLLAAYQANMFKSYDVHWGKD--FELTGREVEC 193
              +  +                L  + LL     +  + +     +    +LT RE EC
Sbjct: 127 AGMMCFVNDASPTDTFWRHIDVVLPNLVLLRDLVIDTSQRHLHTHAQSLLPKLTPREREC 186

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GK++ EI+ IL  S   VN ++ +I  K    +R  A   A +  ++
Sbjct: 187 LQWTARGKSTWEISHILNCSEAVVNFHMKNIRTKLGVNSRRAAAVIATQLGLI 239


>gi|150390890|ref|YP_001320939.1| two component LuxR family transcriptional regulator [Alkaliphilus
           metalliredigens QYMF]
 gi|149950752|gb|ABR49280.1| two component transcriptional regulator, LuxR family [Alkaliphilus
           metalliredigens QYMF]
          Length = 217

 Score =  148 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 36/241 (14%), Positives = 78/241 (32%), Gaps = 27/241 (11%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           ++++ I+L  +       +  +      +  +           ++  +            
Sbjct: 1   MKKIKILLVDDHSLMRQGLKQIIELEKDMEVIGQAGDGEEALEKVKQVC----------- 49

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                    LD  +       ++R +   +        +    +                
Sbjct: 50  ----PDVILLDINMPKLNGIQVLRRLKDMD--------KTTKVIMLTFHEDREYLFETIN 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
              N Y     +   +   +  +      I      ++      + N    +     ++ 
Sbjct: 98  LGANGYVLKDAESDSLIKAIRDVAMGESYIHPSLASQL----VKEFNRRDDHHDKEPREG 153

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE E LT I+EG+ + EIA  L IS  TV N++++I +K     R+ A  YA ++N
Sbjct: 154 KLTKREYEVLTLIAEGQNNKEIASNLFISEKTVKNHVSNIFKKIHVNDRTQAAIYAYKHN 213

Query: 245 I 245
           I
Sbjct: 214 I 214


>gi|59940059|gb|AAX12568.1| LuxR-type transcriptional regulator [Aeromonas allosaccharophila]
          Length = 260

 Score =  148 bits (373), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 84/239 (35%), Gaps = 20/239 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            + + L     +         +   T  +G  ++          Q+   ++ +  P   V
Sbjct: 5   QQLEYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWV 64

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSL 133
           +    +       ++Q   +   P++    +                    G+ N     
Sbjct: 65  QAYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFP 124

Query: 134 TFDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LT 187
               A     L  +  +     +L +    +  ++ Y             +D +    LT
Sbjct: 125 LHGAAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLRDDDPQEALT 184

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE ECL W SEGKTS EIA ILGI+  TV  ++  + RKT + TR  AIA  V + I+
Sbjct: 185 DRETECLFWASEGKTSSEIACILGITERTVIYHLNQVTRKTGSMTRYQAIAKGVSSGIL 243


>gi|194015561|ref|ZP_03054177.1| transcriptional regulatory protein DegU (Protease production
           enhancerprotein) [Bacillus pumilus ATCC 7061]
 gi|194012965|gb|EDW22531.1| transcriptional regulatory protein DegU (Protease production
           enhancerprotein) [Bacillus pumilus ATCC 7061]
          Length = 229

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 35/249 (14%), Positives = 74/249 (29%), Gaps = 30/249 (12%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           + +VNIV+  + +     V  +         +   D                G     +V
Sbjct: 1   MTKVNIVIIDDHQLFREGVKRILDFEPTFEVVAEGDD---------------GDEAARIV 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                    +D  + +    +  + +                 +   +            
Sbjct: 46  EHYHPDVVIMDINMPNVNGVEATKQLVEL--------YPESKVIILSIHDDENYVTHALK 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILR-------DRLWEIGLLAAYQANMFKSYD 177
                Y     D   +   + ++   G  +         +    +           + Y 
Sbjct: 98  TGARGYLLKEMDADTLIEAVKVVADGGSYLHPKVTHNLVNEFRRLATSGVSAHPQHEVYP 157

Query: 178 VHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
                   LT RE E L  +++GK++  I   L IS  TV N++++I++K     R+ A+
Sbjct: 158 EIRRPLHILTRRECEVLQMLADGKSNRGIGESLFISEKTVKNHVSNILQKMNVNNRTQAV 217

Query: 238 AYAVRNNIV 246
             A++N  V
Sbjct: 218 VVAIKNGWV 226


>gi|293611186|ref|ZP_06693484.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826437|gb|EFF84804.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 238

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 41/234 (17%), Positives = 83/234 (35%), Gaps = 16/234 (6%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           + DLL+  + +         + +    +G  +            +  +I+ +++P    +
Sbjct: 5   QEDLLSEFLIVKNEYQLFEIVKSTASKLGFDYCAYGMQSPLSIAEPKTIMLNNYPEAWQK 64

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHT----------LPENITPPAGMDNRYCSLTFDVA 138
                   K    +Q       P+  +                   G++  +   + D  
Sbjct: 65  RYLEQHYVKIDPTVQHCMVSLQPLVWSSQSAKTQEEKDFWEEARSYGLNVGWAQSSRDFI 124

Query: 139 RIRIGLMLLFPKGRIILRDRLWE---IGLLAAYQANMFKSYDVH---WGKDFELTGREVE 192
             R  L L     ++  +++  +   +  L+    +              +  LT RE E
Sbjct: 125 GTRGMLTLARSSDQLSEKEQKAQYTNMYWLSQTVHSSIAKVVNEMEFAQFNLYLTNREKE 184

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            L W +EGKTS EIA ILG++  TVN ++ + M+K     +  A   AV   ++
Sbjct: 185 ALRWTAEGKTSAEIAQILGVTERTVNFHLGNSMQKLNVNNKISAAIRAVMLGLL 238


>gi|156933489|ref|YP_001437405.1| DNA-binding transcriptional activator SdiA [Cronobacter sakazakii
           ATCC BAA-894]
 gi|156531743|gb|ABU76569.1| hypothetical protein ESA_01307 [Cronobacter sakazakii ATCC BAA-894]
          Length = 241

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 45/232 (19%), Positives = 80/232 (34%), Gaps = 14/232 (6%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R ++  R   +  +      +   T+ +   +F L         +    + + +P   + 
Sbjct: 10  RREMTTRFQEIQDSSDIYSLLKTETQNMEYDYFALCVRHPVPFTRPKLTLHTTYPEAWLE 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTL---------PENITPPAGMDNRYCSLTFDVAR 139
                       VL+    L  P+               N     G+            R
Sbjct: 70  HYQAENYYVIDPVLKPANYLVGPLSWNDALFAGAAEELWNAARDHGLVKGVTQCVIAPNR 129

Query: 140 IRIGLMLLF--PKGRIILRD--RLWEIGLLAAYQANMFK-SYDVHWGKDFELTGREVECL 194
            +  L +    P+G  +  D   L    L+      M +         + +L+ RE E L
Sbjct: 130 AQGFLSVSGTSPRGHSMADDELALRLQHLVEQSLVTMMRLEDPAATVLEMKLSKREKEIL 189

Query: 195 TWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 QWTAEGKTSAEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAAIGLI 241


>gi|66277266|gb|AAY44564.1| LuxR-like protein [Aeromonas sp. ym1]
          Length = 260

 Score =  148 bits (373), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 77/234 (32%), Gaps = 20/234 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALILPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       V++   +   P++    +                    G+ N        
Sbjct: 68  TDNHMLACDPVIRLARKQTLPIYWNRLDERARFLQEGTLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDV----HWGKDFELTGRE 190
            A     L  +  +     +L +    +  ++ Y                     LT RE
Sbjct: 128 AAGENGILSFITSERASSDLLLESSPILSWMSNYIFEAAIRMVRFSLMDNDPKDPLTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V   
Sbjct: 188 TECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYHAIAKGVSTG 241


>gi|325124101|gb|ADY83624.1| probable transcriptional activator of quorum sensing autoinducer
           synthesis transcription regulator protein [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 238

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 41/234 (17%), Positives = 84/234 (35%), Gaps = 16/234 (6%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           + DLL+  + +         + +    +G  +            +  +I+ +++P    +
Sbjct: 5   QEDLLSEFLIVKNEYQLFEIVKSTASKLGFDYCAYGMQSPLSIAEPKTIMLNNYPEAWQK 64

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHT----------LPENITPPAGMDNRYCSLTFDVA 138
                +  K    +Q       P+  +                   G++  +   + D  
Sbjct: 65  RYMEQQYVKIDPTVQHCMVSLQPLVWSSQFAKTQEEKDFWEEARSYGLNVGWAQSSRDFI 124

Query: 139 RIRIGLMLLFPKGRIILRDRLWE---IGLLAAYQANMFKSYDVH---WGKDFELTGREVE 192
             R  L L     ++  +++  +   +  L+    +              +  LT RE E
Sbjct: 125 GTRGMLTLARSNDQLSEKEQKAQYTNMYWLSQTVHSSIAKVVNEVEFAQFNLYLTNREKE 184

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            L W +EGKTS EIA ILG++  TVN ++ + M+K     +  A   AV   ++
Sbjct: 185 ALRWTAEGKTSAEIAQILGVTERTVNFHLGNSMQKLNVNNKISAAIRAVMLGLL 238


>gi|86747544|ref|YP_484040.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           HaA2]
 gi|86570572|gb|ABD05129.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           HaA2]
          Length = 242

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 73/219 (33%), Gaps = 15/219 (6%)

Query: 41  CTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYN 100
              S   +  +     G S +++           +  +++ WP                 
Sbjct: 24  DAPSLVRQFESHIASAGFSAYIMAALPAPGAGLAELTLANGWPRGWFELYVGRNYMAVDP 83

Query: 101 VLQRPTELFCPVFHTLP-------------ENITPPAGMDNRYCSLTFDVARIRIGLMLL 147
           V +       P   +                      G+   YC            ++ +
Sbjct: 84  VPRHGAATVQPFEWSDAPYDRKRDRAAHQVMTDAAEFGLVRGYCIPLHYDDG--GAMISM 141

Query: 148 FPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIA 207
             +   +       + L+  Y  N  +S +    +   LT RE E L+W ++GKT+ EI+
Sbjct: 142 AGEAPDLDPTAKGAMQLIGVYAHNRLRSLNRPKPQRRLLTSRECEILSWAAQGKTAWEIS 201

Query: 208 VILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +IL I+  TV  ++    RK     R+ A+A A+   ++
Sbjct: 202 MILRIAERTVKFHLIEASRKLNAVNRTAAVAKALSLGLI 240


>gi|218658162|ref|ZP_03514092.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli IE4771]
          Length = 144

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 84/144 (58%), Positives = 107/144 (74%)

Query: 103 QRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEI 162
           ++  ++F P F  LPE+   P G   +YCSLTF+V R R+ LM LF +G I+  +RL ++
Sbjct: 1   EKCMQVFQPNFALLPESAAVPEGASRQYCSLTFNVGRSRLALMFLFGEGFILSPERLRDV 60

Query: 163 GLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIA 222
           GLLA Y A+  +       +DFELT RE+ECL WI+EGKTSDEIA+ILGISRNT+NNYI 
Sbjct: 61  GLLAGYVASFLRCGGARVDRDFELTDRELECLFWIAEGKTSDEIAMILGISRNTINNYIT 120

Query: 223 SIMRKTATKTRSGAIAYAVRNNIV 246
           S+MRKTATKTRS AIA+AVRNN+V
Sbjct: 121 SVMRKTATKTRSEAIAFAVRNNLV 144


>gi|163758447|ref|ZP_02165535.1| putative LuxR/GerE family transcriptional regulator [Hoeflea
           phototrophica DFL-43]
 gi|162284736|gb|EDQ35019.1| putative LuxR/GerE family transcriptional regulator [Hoeflea
           phototrophica DFL-43]
          Length = 245

 Score =  146 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 48/235 (20%), Positives = 91/235 (38%), Gaps = 17/235 (7%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV-RWDLFQEQKLDSIVSSDWPFDL 86
               +  R+            +  +T++   ++F +    D       DSI+ +  P DL
Sbjct: 11  RFEPMRQRLNNCTTQFDLLRLLREVTQFHQYTYFFIASGCDGATRSLADSIIITSAPSDL 70

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTL--------------PENITPPAGMDNRYCS 132
           VR    +   +   +++       P+   L               ++ +    +D  + +
Sbjct: 71  VRRYDETGLMERSPLMRALGGRGTPLQCRLDETITAFTTEQQAALDDFSAEFNIDCCFIT 130

Query: 133 LTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGK-DFELTGREV 191
             +        +  L  + + +       + ++++      +       K D  LT RE 
Sbjct: 131 PVYHRDHGPAAVCFLGKRNQ-MSFSEAANLAMISSLAHQKLRRVSAQPSKADSPLTERER 189

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ECL W S GKTS EIA IL +S +TVN+Y+ +  RK     R+ A+A A+R   +
Sbjct: 190 ECLVWTSSGKTSVEIARILSLSEHTVNHYLNNAARKLDAVNRTQAVALAIRQGFI 244


>gi|220920328|ref|YP_002495629.1| LuxR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219944934|gb|ACL55326.1| transcriptional regulator, LuxR family [Methylobacterium nodulans
           ORS 2060]
          Length = 246

 Score =  146 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 38/229 (16%), Positives = 82/229 (35%), Gaps = 17/229 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
            L+  +  +        R++   ++VG + F + R     ++   +++ + WP D +   
Sbjct: 14  ALIDALDEVRDPFEAQTRIFEHIQHVGFTSFTITRLPRPSDRLGPNMLFNMWPKDWLTHY 73

Query: 91  ALSEKDKYYNVLQRPTELFCPVFH-------------TLPENITPPAGMDNRYCSLTFDV 137
                 ++  V+++      P                    +     G+   +C    D 
Sbjct: 74  DRVGHYRFDPVVRQCYRTTEPFAWSEVPFDADQPDRARRVMDEAAAFGLGFGFCIPVHDA 133

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE---LTGREVECL 194
              + G+ L   +   +       + +L  Y             +      L+ RE + L
Sbjct: 134 LGFQGGVSLAG-ERIDLSPKIRRGLHMLGLYAWGAATRTTEDRRRSEPGRLLSARERDVL 192

Query: 195 TWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           +W + G+T +EIA ILG+S  TV  ++ S   K   +  +  +  A+R 
Sbjct: 193 SWAAMGRTREEIATILGVSHETVATHLKSARIKIGARNTTQTVVEALRK 241


>gi|295700193|ref|YP_003608086.1| LuxR family transcriptional regulator [Burkholderia sp. CCGE1002]
 gi|295439406|gb|ADG18575.1| transcriptional regulator, LuxR family [Burkholderia sp. CCGE1002]
          Length = 234

 Score =  146 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 37/231 (16%), Positives = 69/231 (29%), Gaps = 17/231 (7%)

Query: 33  LARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMAL 92
           +A ++       W   +  L E  G    L+        +  D+ + S +     +    
Sbjct: 1   MAPLLNAADEAEWFGVITGLAETWGFDRILVAMLPRPTMRLEDAYLRSTYAPAWRQTYDE 60

Query: 93  SEKDKYYNVLQRPTELFCPVFHTL----------PENITPPAGMDNRYCSLTFDVARIRI 142
                    +        P+  T                   G+            +   
Sbjct: 61  QGMVHIDPTVAHCLSRSAPLIWTPEIFATPAQQSLYEEARSYGLGAGVTLPIHGPNQEAG 120

Query: 143 GLMLLFPKGRIILR-----DRLWEIGLLAAYQANMFKSYDVHWGKD--FELTGREVECLT 195
            +  +                L  + LL     +  K +     +    +LT RE ECL 
Sbjct: 121 MMCFVNDDKPADGFRRHVNAALPNLVLLRDLVIDTSKQHLDSHAQSLMPKLTPRERECLK 180

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W + GK++ EI+ IL  S   VN ++ +I  K    +R  A   A +  ++
Sbjct: 181 WTARGKSTWEISHILSCSEAVVNFHMKNIRAKFGVNSRRAAAVIAAQLGLI 231


>gi|222147695|ref|YP_002548652.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
 gi|221734683|gb|ACM35646.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
          Length = 230

 Score =  146 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 54/230 (23%), Positives = 90/230 (39%), Gaps = 17/230 (7%)

Query: 33  LARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQE-QKLDSIVSSDWPFDLVRCMA 91
           +  +            M  LT++ GA  F+++            S V ++WP D +    
Sbjct: 1   MRELSGYKTQFDVFRLMKRLTDFFGAKGFMVMNVPSAGAKTLTGSSVITNWPADFLSEYD 60

Query: 92  LSEKDKYYNVLQRPTELFCPVFHT--------------LPENITPPAGMDNRYCSLTFDV 137
           ++       +  R      PV                 L  ++    GM    C    D 
Sbjct: 61  MASLLSSSPMFNRLRNTSIPVVFDVHVVARERDPKTVELATDLFLRFGMPRGACFPVHDA 120

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-LTGREVECLTW 196
              R  + +   +        +  +  LA +  N          +  E LT RE+ECLTW
Sbjct: 121 HGNRGAVNICG-EMPAFSFVDMVLLQYLAGHVFNRLAEIRELDARVTETLTEREIECLTW 179

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            + GKTS EIA I+G+S +T+N+Y+    RK  T  R+ A+A A+R +++
Sbjct: 180 TAAGKTSVEIAEIMGLSEHTINHYLNRATRKLDTVNRTQAVAKALRLSLI 229


>gi|229541561|ref|ZP_04430621.1| two component transcriptional regulator, LuxR family [Bacillus
           coagulans 36D1]
 gi|229325981|gb|EEN91656.1| two component transcriptional regulator, LuxR family [Bacillus
           coagulans 36D1]
          Length = 227

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 32/232 (13%), Positives = 71/232 (30%), Gaps = 19/232 (8%)

Query: 21  SFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSS 80
           + +       + + R++  + T              G     ++         +D  +  
Sbjct: 6   AIIDDHQLFREGVKRILEFEKTFEVVAEGE-----DGEEALDIIEKYHPDVVLMDINMPH 60

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARI 140
               +  R +                 +   +                 Y     D   +
Sbjct: 61  QNGVEATRKLIE--------AYPETKIIILSIHDDESYVTHALKSGATGYLLKEMDSDAL 112

Query: 141 RIGLMLLFPKGRIILRDRLWEIGLLAAYQANMF------KSYDVHWGKDFELTGREVECL 194
              + ++   G  +       +       +N +      +           LT RE E L
Sbjct: 113 IEAVKVVAEGGSYLHPKITHNLVEEFRKLSNRYTPGGTYQQPPAVVPPLHLLTPRECEVL 172

Query: 195 TWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
             +++GK++  I   L IS  TV N++++I++K   K R+ A+  A++N  V
Sbjct: 173 QLLADGKSNRAIGDALYISEKTVKNHVSNILQKLKVKDRTQAVVTAIKNGWV 224


>gi|46370360|gb|AAS89968.1| transcriptional regulator [Agrobacterium vitis]
          Length = 230

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 54/230 (23%), Positives = 90/230 (39%), Gaps = 17/230 (7%)

Query: 33  LARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQE-QKLDSIVSSDWPFDLVRCMA 91
           +  +            M  LT++ GA  F+++            S V ++WP D +    
Sbjct: 1   MRELSGYKTQFDVFRLMKRLTDFFGAKGFMVMNVPSAGAKTLTGSSVITNWPADFLSEYD 60

Query: 92  LSEKDKYYNVLQRPTELFCPVFHT--------------LPENITPPAGMDNRYCSLTFDV 137
           ++       +  R      PV                 L  ++    GM    C    D 
Sbjct: 61  MASLLSSSPMFNRLRNTSIPVVFDIHVVARERDPKTVELATDLFLRFGMPRGACFPVHDA 120

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-LTGREVECLTW 196
              R  + +   +        +  +  LA +  N          +  E LT RE+ECLTW
Sbjct: 121 HGNRGAVNICG-EMPAFSFVDMVLLHYLAGHVFNRLAEIRELDARVTETLTEREIECLTW 179

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            + GKTS EIA I+G+S +T+N+Y+    RK  T  R+ A+A A+R +++
Sbjct: 180 TAAGKTSVEIAEIMGLSEHTINHYLNRATRKLDTVNRTQAVAKALRLSLI 229


>gi|325292093|ref|YP_004277957.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
 gi|325059946|gb|ADY63637.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
          Length = 246

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 47/245 (19%), Positives = 95/245 (38%), Gaps = 17/245 (6%)

Query: 18  QRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDL-FQEQKLDS 76
           Q+T   +      D +  +  L+        +  LTE  G   F+++        +    
Sbjct: 2   QKTETAAVQSIGVDCVREIAGLNTQFDIFRFLKRLTEAWGFKAFMVLDLSAEMASELSQC 61

Query: 77  IVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPP------------- 123
            + + WP +L++        +   V+ +  +   P   +L   ++               
Sbjct: 62  TIITSWPAELLQRYDEEGMLQRSLVMAQLKKSTTPFSVSLDFLVSGDENAPKKPVIGLFE 121

Query: 124 -AGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGK 182
              M N       D+  +R  +         +   +L E+  ++++             +
Sbjct: 122 RFDMINSVWFPVHDITTMRGAVSF-SGNKTTLPTSQLAELFYISSHIFARLSEIRRLDLR 180

Query: 183 DFE-LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
             E L  RE++CL W + GKTS EIA I+ +S +T+N+Y+    +K  T  R+ A+A A+
Sbjct: 181 VPETLNEREIDCLNWTAAGKTSAEIAEIMMLSEHTINHYLNRATKKLDTVNRTQAVAKAL 240

Query: 242 RNNIV 246
           R  ++
Sbjct: 241 RVGLI 245


>gi|59940131|gb|AAX12604.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
          Length = 260

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 46/239 (19%), Positives = 82/239 (34%), Gaps = 20/239 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            + + L     +         +   T  +G  ++          Q+   ++ +  P   V
Sbjct: 5   QQLEYLEHFTTVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWV 64

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSL 133
           +    +       ++Q   +   P +    +                     + +     
Sbjct: 65  QAYTANHMLACDPIIQLARKQTLPNYWNRLDERARFLPEGSPDVMGLAAEFRLRHGISFP 124

Query: 134 TFDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LT 187
               A     L  +  +     +L +    +  ++ Y             ++ E    LT
Sbjct: 125 LHGAAGENRILSFITAERASSDLLLESSPILSWMSNYIFQAAIRIVRVSLREDEPQEALT 184

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 185 DRETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 243


>gi|299771984|ref|YP_003734010.1| Transcriptional activator protein phzR [Acinetobacter sp. DR1]
 gi|284158686|gb|ADB80058.1| AqsR [Acinetobacter sp. DR1]
 gi|298702072|gb|ADI92637.1| Transcriptional activator protein [Acinetobacter sp. DR1]
          Length = 238

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 41/234 (17%), Positives = 85/234 (36%), Gaps = 16/234 (6%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           + DLL+  + +         + +    +G  +            +  +I+ +++P    +
Sbjct: 5   QEDLLSASLMVKNEYQLFEVVKSTASKLGFDYCAYGMQSPLSIAEPKTIMLNNYPEAWQK 64

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHT----------LPENITPPAGMDNRYCSLTFDVA 138
                +  +    +Q       P+  +                   G++  +   + D  
Sbjct: 65  RYVKQQYVRVDPTVQHCMLSLQPLVWSSQSANTQSQKDFWEEARSYGLNVGWAQSSRDFI 124

Query: 139 RIRIGLMLLFPKGRIILRDRLWE---IGLLAAYQANMFKSYDVH---WGKDFELTGREVE 192
             R  L L     +++ +++  +   +  L+    +              +  LT RE E
Sbjct: 125 GTRGMLTLARSTDQLLEKEQKAQYTNMFWLSQTVHSSIAKIVNETEFAQFNLYLTNREKE 184

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            L W +EGKTS EIA ILG++  TVN ++ + M+K     +  A   AV   I+
Sbjct: 185 VLRWTAEGKTSAEIAQILGVTERTVNFHLCNSMQKLNVNNKISAAIRAVMLGIL 238


>gi|126652487|ref|ZP_01724659.1| DegU [Bacillus sp. B14905]
 gi|169826725|ref|YP_001696883.1| transcriptional regulatory protein degU [Lysinibacillus sphaericus
           C3-41]
 gi|126590758|gb|EAZ84873.1| DegU [Bacillus sp. B14905]
 gi|168991213|gb|ACA38753.1| Transcriptional regulatory protein degU (Protease production
           enhancer protein) [Lysinibacillus sphaericus C3-41]
          Length = 224

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 33/229 (14%), Positives = 68/229 (29%), Gaps = 17/229 (7%)

Query: 22  FVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSD 81
            V       + + R++  + T              G     L   +      +D  +   
Sbjct: 6   IVDDHQLFREGVKRILDFEDTFDVVAE-----GDDGTDVVTLYAENEPDVVLMDINMPGK 60

Query: 82  WPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIR 141
              +    +                 +   +                 Y     D   I 
Sbjct: 61  NGVEATSELINE--------FPDAKVIMLSIHDDETYVTHALKSGALGYMLKEMDADEIV 112

Query: 142 IGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYD---VHWGKDFEL-TGREVECLTWI 197
             + ++   G  +       +       +      +       + F L T RE E L  +
Sbjct: 113 EAIKVVANGGSYLHPKVTKNLVAEFKRLSEHENKGNFHQTEIRRPFHLLTKRECEVLQLL 172

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++G+++  I   L IS  TV N+++SI++K     R+ A+  A++N  V
Sbjct: 173 TDGQSNRTIGETLFISEKTVKNHVSSILQKMNVNDRTQAVVTAIKNGWV 221


>gi|157693950|ref|YP_001488412.1| response regulator DegU [Bacillus pumilus SAFR-032]
 gi|157682708|gb|ABV63852.1| response regulator DegU [Bacillus pumilus SAFR-032]
          Length = 229

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 35/249 (14%), Positives = 74/249 (29%), Gaps = 30/249 (12%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           + +VNIV+  + +     V  +         +   D                G     +V
Sbjct: 1   MTKVNIVIIDDHQLFREGVKRILDFEPTFEVVAEGDD---------------GDEAARIV 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                    +D  + +    +  + +                 +   +            
Sbjct: 46  EHYHPDVVIMDINMPNVNGVEATKQLVEL--------YPESKVIILSIHDDENYVTHALK 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILR-------DRLWEIGLLAAYQANMFKSYD 177
                Y     D   +   + ++   G  +         +    +           + Y 
Sbjct: 98  TGARGYLLKEMDADTLIEAVKVVADGGSYLHPKVTHNLVNEFRRLATSGVSAHPQHEVYP 157

Query: 178 VHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
                   LT RE E L  +++GK++  I   L IS  TV N++++I++K     R+ A+
Sbjct: 158 EIRRPLHILTRRECEVLQMLADGKSNRGIGESLFISEKTVKNHVSNILQKMNVNDRTQAV 217

Query: 238 AYAVRNNIV 246
             A++N  V
Sbjct: 218 VVAIKNGWV 226


>gi|220933015|ref|YP_002509923.1| two component transcriptional regulator, LuxR family
           [Halothermothrix orenii H 168]
 gi|219994325|gb|ACL70928.1| two component transcriptional regulator, LuxR family
           [Halothermothrix orenii H 168]
          Length = 211

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 30/242 (12%), Positives = 77/242 (31%), Gaps = 34/242 (14%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           ++   +++  + +     +  L    + +  +      +     +          HF   
Sbjct: 1   MKPTKVLVADDHDLVREGICKLLELYEDIKVVGEAGDGLETVKGVR--------DHF--- 49

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                    LD  +        ++ +           ++        +            
Sbjct: 50  ----PDLVLLDLNMPRMGGITAIKKIKE-----ISPGIKVL---ILTIHDEEEYVYEVIR 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
                Y         ++  +  +    ++  R    E+           +       +  
Sbjct: 98  SGAEGYIQKDVKPEELKRAIDKVIKGDKVFPRSTENEV-----------REVVNEKYEVC 146

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EL+ RE E L  +++G ++ +IA  L IS  TV N++++I+RK +   R+ A+  A++  
Sbjct: 147 ELSSREQEVLELLAQGMSNKQIAQELFISEKTVKNHVSNILRKLSVNDRTQAVIVALKRG 206

Query: 245 IV 246
           +V
Sbjct: 207 LV 208


>gi|115358865|ref|YP_776003.1| LuxR family transcriptional regulator [Burkholderia ambifaria AMMD]
 gi|13508495|gb|AAK27306.1| AHL receptor [Burkholderia ambifaria]
 gi|115284153|gb|ABI89669.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           AMMD]
          Length = 239

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 77/235 (32%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       R+ A ++ +G  +            K    + + +P   
Sbjct: 3   LRWQDAYQQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFNTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI--------TPPAGMDNRYCSLTFDVA 138
           +         +  + ++        +     + I            G+       +   A
Sbjct: 63  MARYQAQNYIEIDSTVRDGAMSTNMIVWPDVDRIDPCPLWQDARDYGLSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       L+    + F    +       LT RE 
Sbjct: 122 RGAFGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMLPKLSPESSVTLTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLRWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAIGAGLI 236


>gi|117618881|ref|YP_855090.1| transcriptional activator protein AhyR [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117560288|gb|ABK37236.1| transcriptional activator protein AhyR [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 261

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 83/237 (35%), Gaps = 21/237 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    +                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGL-MLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGR 189
            A     +   +  +     +L +    +  ++ Y             ++ +    LT R
Sbjct: 128 AAGENGIILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDR 187

Query: 190 EVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 188 ETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 244


>gi|187918993|ref|YP_001888024.1| LuxR family transcriptional regulator [Burkholderia phytofirmans
           PsJN]
 gi|187717431|gb|ACD18654.1| transcriptional regulator, LuxR family [Burkholderia phytofirmans
           PsJN]
          Length = 234

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 37/231 (16%), Positives = 70/231 (30%), Gaps = 17/231 (7%)

Query: 33  LARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMAL 92
           +A ++       W   +  L E  G    L+        +  D+ V S +     R    
Sbjct: 1   MAPLLDAADEAEWFGAIAGLAETWGFDKLLIAMLPRPTIRLEDAYVRSTYSPTWRRTYDE 60

Query: 93  SEKDKYYNVLQRPTELFCPVFHTLP----------ENITPPAGMDNRYCSLTFDVARIRI 142
                    +        P+  +                   G+ +          +   
Sbjct: 61  QGLVHIDPTVAHCATRATPLIWSPDIFKTAPQLSMYEEARAHGLRSGITLPIHGPNQEAG 120

Query: 143 GLMLLFPKGRIILRD-----RLWEIGLLAAYQANMFKSYDVHWGKD--FELTGREVECLT 195
            +  +                L  + LL     +  + +     +    +LT RE ECL 
Sbjct: 121 MMCFVNDNNPNDEFWRHINVALPNLVLLRDLVIDTSQRHLNTHAQTLLPKLTPRERECLK 180

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W + GK++ EI+ IL  S   VN ++ +I  K    +R  A   A +  ++
Sbjct: 181 WTARGKSTWEISHILNCSEAVVNFHMKNIRTKFGVNSRRAAAVIAAQLGLI 231


>gi|303241719|ref|ZP_07328216.1| two component transcriptional regulator, LuxR family [Acetivibrio
           cellulolyticus CD2]
 gi|302590720|gb|EFL60471.1| two component transcriptional regulator, LuxR family [Acetivibrio
           cellulolyticus CD2]
          Length = 216

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 38/241 (15%), Positives = 75/241 (31%), Gaps = 27/241 (11%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           + ++ +++  +       +  +      +A +                    G     L 
Sbjct: 1   MDKIRVLIADDHTMVRQGLKQILELEKDMAVIAQAPN---------------GEEAIRLA 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
           +        +D  +        ++ M                 +   +            
Sbjct: 46  KECSPDVILMDINMPGMNGLQAIKEMKADNIP--------SRIIVLTIHEDREYLFKTLQ 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
                Y     D   +   +  +      I  +   E+      + N    +D    ++ 
Sbjct: 98  MGAEGYVLKDADPVVLVEAIRSVNRGQSYIQANMTREL----VREFNKITLHDKSKSEES 153

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            LT REVE L  I+EG  + EIA  L IS  TV N++++I RK     R+ A  YA ++N
Sbjct: 154 NLTAREVEVLELIAEGMINKEIAKRLYISEKTVKNHVSNIFRKLNVSDRTQAAIYAFKHN 213

Query: 245 I 245
           +
Sbjct: 214 M 214


>gi|59940039|gb|AAX12558.1| LuxR-type transcriptional regulator [Aeromonas media]
          Length = 260

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 46/238 (19%), Positives = 84/238 (35%), Gaps = 20/238 (8%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           + + L  +  +         +   T  +G  ++          Q+   ++ +  P   V+
Sbjct: 6   QLEYLEHLTLVTDGNRLAEVIGRFTLGMGYDYYRFALILPTSMQRRKVVLFNQCPDSWVQ 65

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLPEN--------------ITPPAGMDNRYCSLT 134
              ++       ++Q       P++    +               +    G+ N      
Sbjct: 66  AYTVNNMLACDPIIQLARTQTLPIYWNRLDEKARFLQEGSMDVMGLAAEFGLRNGISFPL 125

Query: 135 FDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMF----KSYDVHWGKDFELTG 188
              A     L  +  +     +L +    +  ++ Y         +           LT 
Sbjct: 126 HGAAGENGILSFITRERASSDLLLESSPILSWMSNYIFEAAIRIVRQSMREDDPQEALTE 185

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE ECL W S+GKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 186 RETECLFWASDGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKRVSSGIL 243


>gi|149180154|ref|ZP_01858659.1| DNA-binding response regulator [Bacillus sp. SG-1]
 gi|148852346|gb|EDL66491.1| DNA-binding response regulator [Bacillus sp. SG-1]
          Length = 216

 Score =  145 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 34/240 (14%), Positives = 75/240 (31%), Gaps = 32/240 (13%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  +       +  +    D +  +           ++  L               
Sbjct: 2   IKLMLVDDHAVLRDGLKTILESEDDINVVGEAVSGSDALSKVREL--------------- 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      ++ + +                 L   +       +       
Sbjct: 47  DPDIILMDINMPGMNGVEVTKVLKQQ--------YPHIKVLMLTMHSHEEYFMAAIKEGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF-EL 186
           + Y        ++   +  +F    +I      ++          F   +    +D   L
Sbjct: 99  DGYLLKDAPSEQVVEAVRTVFSGESVIHPSLTRKLLT--------FHQQNQRQDRDDNSL 150

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T RE E L  + EG ++ EI   L +S  TV  ++++I +K   K+RS  + YAV+N +V
Sbjct: 151 TEREREVLGCLVEGLSNKEIGKRLYVSDKTVKIHVSNIFKKLNVKSRSQVVIYAVQNKLV 210


>gi|171322367|ref|ZP_02911189.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MEX-5]
 gi|171092309|gb|EDT37680.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MEX-5]
          Length = 239

 Score =  145 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 77/235 (32%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       R+ A ++ +G  +            K    + + +P   
Sbjct: 3   LRWQDAYQQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFNTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI--------TPPAGMDNRYCSLTFDVA 138
           +         +  + ++        +     + I            G+       +   A
Sbjct: 63  MARYQAQNYIEIDSTVRDGALSTNMIVWPDVDRIDPCPLWQDARDFGLSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       L+    + F    +       LT RE 
Sbjct: 122 RGAFGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPESSVTLTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAIAAGLI 236


>gi|299536017|ref|ZP_07049336.1| transcriptional regulatory protein degU [Lysinibacillus fusiformis
           ZC1]
 gi|298728622|gb|EFI69178.1| transcriptional regulatory protein degU [Lysinibacillus fusiformis
           ZC1]
          Length = 224

 Score =  145 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 33/229 (14%), Positives = 68/229 (29%), Gaps = 17/229 (7%)

Query: 22  FVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSD 81
            V       + + R++  + T              G     L   +      +D  +   
Sbjct: 6   IVDDHQLFREGVKRILDFEDTFDVVAE-----GDDGTDVVTLYAENEPDVVLMDINMPGK 60

Query: 82  WPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIR 141
              +    +                 +   +                 Y     D   I 
Sbjct: 61  NGVEATAELITE--------FPDAKVIMLSIHDDETYVTHALKSGALGYMLKEMDADEIV 112

Query: 142 IGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYD---VHWGKDFEL-TGREVECLTWI 197
             + ++   G  +       +       +      +       + F L T RE E L  +
Sbjct: 113 EAIKVVANGGSYLHPKVTKNLVAEFKRLSEHENKGNFHQTEIRRPFHLLTKRECEVLQLL 172

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++G+++  I   L IS  TV N+++SI++K     R+ A+  A++N  V
Sbjct: 173 TDGQSNRTIGETLFISEKTVKNHVSSILQKMNVNDRTQAVVTAIKNGWV 221


>gi|59940051|gb|AAX12564.1| LuxR-type transcriptional regulator [Aeromonas veronii]
          Length = 260

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 47/236 (19%), Positives = 83/236 (35%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L     +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIFPMSMQRPKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    E                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLEERARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGRE 190
            A     L  +  +     +L +    +  ++ Y             ++ +    LT RE
Sbjct: 128 AAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDAQEALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + ++
Sbjct: 188 TECLFWASEGKTSSEIACILGITERTVNYHLNQVTRKTGSMNRYHAIANGVSSGML 243


>gi|16080602|ref|NP_391429.1| two-component response regulator [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|154687664|ref|YP_001422825.1| DegU [Bacillus amyloliquefaciens FZB42]
 gi|221311500|ref|ZP_03593347.1| DegU [Bacillus subtilis subsp. subtilis str. 168]
 gi|221315827|ref|ZP_03597632.1| DegU [Bacillus subtilis subsp. subtilis str. NCIB 3610]
 gi|221320742|ref|ZP_03602036.1| DegU [Bacillus subtilis subsp. subtilis str. JH642]
 gi|221325027|ref|ZP_03606321.1| DegU [Bacillus subtilis subsp. subtilis str. SMY]
 gi|296330243|ref|ZP_06872724.1| DegU [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305676152|ref|YP_003867824.1| two-component response regulator [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|308175281|ref|YP_003921986.1| two-component response regulator [Bacillus amyloliquefaciens DSM 7]
 gi|321313096|ref|YP_004205383.1| two-component response regulator [Bacillus subtilis BSn5]
 gi|118438|sp|P13800|DEGU_BACSU RecName: Full=Transcriptional regulatory protein degU; AltName:
           Full=Protease production enhancer protein
 gi|143089|gb|AAA22545.1| iep protein [Bacillus subtilis]
 gi|143499|gb|AAA22733.1| degU protein (gtg start codon) [Bacillus subtilis]
 gi|143502|gb|AAA22735.1| protein kinase (put.); putative [Bacillus subtilis]
 gi|1762330|gb|AAC44938.1| transcriptional regulator of degradation enzymes [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|2636075|emb|CAB15566.1| two-component response regulator [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|126363001|emb|CAM35818.1| two-component response regulator DegU [Bacillus amyloliquefaciens
           FZB42]
 gi|154353515|gb|ABS75594.1| DegU [Bacillus amyloliquefaciens FZB42]
 gi|206967377|gb|ACI22669.1| two-component response regulator DegU [Bacillus subtilis]
 gi|219937642|emb|CAJ97429.1| transcriptional regulatory protein [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296152511|gb|EFG93379.1| DegU [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305414396|gb|ADM39515.1| two-component response regulator [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|307608145|emb|CBI44516.1| two-component response regulator [Bacillus amyloliquefaciens DSM 7]
 gi|320019370|gb|ADV94356.1| two-component response regulator [Bacillus subtilis BSn5]
 gi|328913615|gb|AEB65211.1| Transcriptional regulatory protein degU [Bacillus amyloliquefaciens
           LL3]
          Length = 229

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 35/249 (14%), Positives = 74/249 (29%), Gaps = 30/249 (12%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           + +VNIV+  + +     V  +         +   D                G     +V
Sbjct: 1   MTKVNIVIIDDHQLFREGVKRILDFEPTFEVVAEGDD---------------GDEAARIV 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                    +D  + +    +  + +                 +   +            
Sbjct: 46  EHYHPDVVIMDINMPNVNGVEATKQLVEL--------YPESKVIILSIHDDENYVTHALK 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILR-------DRLWEIGLLAAYQANMFKSYD 177
                Y     D   +   + ++   G  +         +    +           + Y 
Sbjct: 98  TGARGYLLKEMDADTLIEAVKVVAEGGSYLHPKVTHNLVNEFRRLATSGVSAHPQHEVYP 157

Query: 178 VHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
                   LT RE E L  +++GK++  I   L IS  TV N++++I++K     R+ A+
Sbjct: 158 EIRRPLHILTRRECEVLQMLADGKSNRGIGESLFISEKTVKNHVSNILQKMNVNDRTQAV 217

Query: 238 AYAVRNNIV 246
             A++N  V
Sbjct: 218 VVAIKNGWV 226


>gi|296101736|ref|YP_003611882.1| DNA-binding transcriptional activator SdiA [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295056195|gb|ADF60933.1| DNA-binding transcriptional activator SdiA [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 240

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 39/231 (16%), Positives = 73/231 (31%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R D   R   L         +   T+ +   ++ L         +    V + +P   + 
Sbjct: 10  RRDCFLRFQALTSASEVYQELQRQTQALEFDYYALCLRHPVPFTRPRISVHATYPQRWMA 69

Query: 89  CMALSEKDKYYNVLQR--PTELFCPVFHTLPENITPPAGMDNR----------YCSLTFD 136
                       VL+     +   P    L  +                           
Sbjct: 70  QYQSENYFAIDPVLKPENFIQGHLPWTDELFADAEALWNGARDHGLRKGITQCLMLPNHA 129

Query: 137 VARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFK-SYDVHWGKDFELTGREVECLT 195
           +  + +    +           L    LL     ++ +   ++    + + + RE E L 
Sbjct: 130 LGFLSVSCTSVQAGAVTSEELELRLQMLLQMALTSLLRFEDEMVMPPEMKFSKREREILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSAEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|260770016|ref|ZP_05878949.1| transcriptional activator protein vanR [Vibrio furnissii CIP
           102972]
 gi|260615354|gb|EEX40540.1| transcriptional activator protein vanR [Vibrio furnissii CIP
           102972]
          Length = 240

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 42/226 (18%), Positives = 78/226 (34%), Gaps = 17/226 (7%)

Query: 37  IPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKD 96
             +    +    + AL   +   +FL            ++I++ ++P    +    +   
Sbjct: 12  QVITSYENLESTLAALNNIIDHEYFLFGLSLQPTLTTSETIITDNYPASWRQQYDEAGFM 71

Query: 97  KYYNVLQRPTELFCPVFH----------TLPENITPPAGMDNRYCSLTFDVARIRIGLML 146
               ++Q     F P+                      G+   +      +      L  
Sbjct: 72  HVDPIVQYSMTNFLPIRWSQIPVASNQAHEMFEEARINGLKEGFSIPIHGLRGEFGMLSF 131

Query: 147 LFPKGR------IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEG 200
                R        ++     I LL+    N+ + +     +  ELT RE +CLTW +EG
Sbjct: 132 ATSDTRHYELNCDAIQTSQLIIPLLSHNIHNIARCHKDAAPR-IELTARENQCLTWAAEG 190

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           K++ EIA I+  S  TV  +IA+  +K     R  AI  A+    +
Sbjct: 191 KSAWEIAKIIDTSERTVKFHIANACKKLGATNRYQAITKAILGGYI 236


>gi|158320230|ref|YP_001512737.1| two component LuxR family transcriptional regulator [Alkaliphilus
           oremlandii OhILAs]
 gi|158140429|gb|ABW18741.1| two component transcriptional regulator, LuxR family [Alkaliphilus
           oremlandii OhILAs]
          Length = 224

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 37/243 (15%), Positives = 76/243 (31%), Gaps = 27/243 (11%)

Query: 3   FEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFL 62
             ++++N+++  +       +  +      +  +                    G    L
Sbjct: 6   KSVKKINVLIADDHALVRQGLKQIIELEPDIKVIGLAAD---------------GEEAVL 50

Query: 63  LVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITP 122
             +        LD  +        +R           + ++    +              
Sbjct: 51  KTQQLSPDVVLLDISMPKQNGIQTLRR-----LKDMDSTIKI---IMLTFHEDREYLFET 102

Query: 123 PAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGK 182
                N Y     +   +   +  ++     I      E+      + N  +        
Sbjct: 103 INLGANGYVLKDAESESLIKAIRDVYQGLNYIYPTLATEL----VKEFNRREVKSQKRNN 158

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           + ELT RE E LT ++EG  + EI   L IS  TV N++++I +K     R+ A  YA +
Sbjct: 159 EDELTRREYEVLTLLAEGINNKEIGDCLFISEKTVKNHVSNIFKKINVNDRTQAAIYAYK 218

Query: 243 NNI 245
           +NI
Sbjct: 219 HNI 221


>gi|323488502|ref|ZP_08093746.1| DNA-binding response regulator [Planococcus donghaensis MPA1U2]
 gi|323397719|gb|EGA90521.1| DNA-binding response regulator [Planococcus donghaensis MPA1U2]
          Length = 211

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 40/222 (18%), Positives = 81/222 (36%), Gaps = 16/222 (7%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPF 84
            +    D       L   ++    M  + E  G++       D+  +   D I+      
Sbjct: 3   QVLLVDDHAILRDGLKTLIAQEEDMEVIGEATGSTQL----IDMLPKVAPDIIMMDINMP 58

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
            +            Y  ++    +   +++     +       + Y         +   +
Sbjct: 59  QMNGIELTRWVKSNYPSIK---VIVLTMYNNDEYFMAAIREGADGYLLKDSPSKDVIDAI 115

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
             +     +I      ++  +   + N          +D  LT RE+E L  + EG ++ 
Sbjct: 116 RTVAGGESVIPPGMTKKLLSMHKQENNQ---------EDKTLTPREMEVLLVLVEGLSNK 166

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +IA  L IS  TV  ++++I +K   K+RS AI +AV+NN+V
Sbjct: 167 DIATRLYISDKTVKIHVSNIFKKFDVKSRSQAIIFAVQNNLV 208


>gi|172063602|ref|YP_001811253.1| LuxR family transcriptional regulator [Burkholderia ambifaria
           MC40-6]
 gi|171996119|gb|ACB67037.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MC40-6]
          Length = 239

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 77/235 (32%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       R+ A ++ +G  +            K    + + +P   
Sbjct: 3   LRWQDAYQQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFNTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI--------TPPAGMDNRYCSLTFDVA 138
           +         +  + ++        +     + I            G+       +   A
Sbjct: 63  MARYQAQNYIEIDSTVRDGALSTNMIVWPDVDRIDPCPLWQDARDYGLSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       L+    + F    +       LT RE 
Sbjct: 122 RGAFGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPESSVTLTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAIGAGLI 236


>gi|254254249|ref|ZP_04947566.1| DNA-binding HTH domain-containing protein [Burkholderia dolosa
           AUO158]
 gi|12620909|gb|AAG61134.1|AF330023_1 AHL receptor [Burkholderia cepacia]
 gi|124898894|gb|EAY70737.1| DNA-binding HTH domain-containing protein [Burkholderia dolosa
           AUO158]
          Length = 239

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 38/235 (16%), Positives = 75/235 (31%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       R+ A ++ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYHQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFH--------TLPENITPPAGMDNRYCSLTFDVA 138
           +            + ++        +          +         G+       +   A
Sbjct: 63  MAHYQAKNYIDIDSTVRDGALSTNMIVWPDVDGADSSPLWRDAREFGLSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +  +   +    +  + L       L+    + F    +       LT RE 
Sbjct: 122 RGAFGLLSIARRADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPEASVTLTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|170700319|ref|ZP_02891331.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           IOP40-10]
 gi|170134753|gb|EDT03069.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           IOP40-10]
          Length = 239

 Score =  144 bits (364), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 38/235 (16%), Positives = 75/235 (31%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       R+ A ++ +G  +            K    + + +P   
Sbjct: 3   LRWQDAYQQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFNTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVA 138
           +         +  + ++        +                    G+       +   A
Sbjct: 63  MARYQAQNYIEIDSTVRDGALSTNMIVWPDIDRIDPCPLWQDARDYGLSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       L+    + F    +       LT RE 
Sbjct: 122 RGAFGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPESSVTLTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAIGAGLI 236


>gi|254473001|ref|ZP_05086399.1| transcriptional regulator, LuxR family [Pseudovibrio sp. JE062]
 gi|211957722|gb|EEA92924.1| transcriptional regulator, LuxR family [Pseudovibrio sp. JE062]
          Length = 239

 Score =  144 bits (364), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 47/236 (19%), Positives = 86/236 (36%), Gaps = 16/236 (6%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFD 85
           L    + +  +   +     + R+  L +  G + F L            SI+ S W  +
Sbjct: 4   LTAALEFVESINNEETPDGVSKRIAELGQSFGFTSFCLAAIPEAGASFDGSIMLSGWRPE 63

Query: 86  LVRCMALSEKDKYYNVLQRPTELFCPVFHTLPEN-------------ITPPAGMDNRYCS 132
             +     +  +   ++ +      P   +                      GM +  C 
Sbjct: 64  WQQRYLDRDYVQNDPIVAKARTASRPFLWSSVARDRNLTAAAQQVLSEARDYGMYDGVCV 123

Query: 133 LTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKS--YDVHWGKDFELTGRE 190
               +   +  L+   P+   +    +  + L+  Y +N  +             LT RE
Sbjct: 124 PVHGLQGYQGMLIFGGPE-VRLNEREISVLHLVGIYASNKVRELVGANTNRPRHRLTPRE 182

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +ECL W + GKTS EI+ IL IS++T + Y+AS  RK     R+ A+A   R  ++
Sbjct: 183 LECLKWSAAGKTSWEISQILNISQHTADWYLASAARKLHAANRTHAVAEGFRLGLI 238


>gi|117928967|ref|YP_873518.1| two component LuxR family transcriptional regulator [Acidothermus
           cellulolyticus 11B]
 gi|117649430|gb|ABK53532.1| two component transcriptional regulator, LuxR family [Acidothermus
           cellulolyticus 11B]
          Length = 303

 Score =  144 bits (364), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 34/242 (14%), Positives = 77/242 (31%), Gaps = 25/242 (10%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           +  + +++  +       +  +  +   +  +                    GA      
Sbjct: 84  VDPIKVLVADDHALFRRGLEMVLRQEPDIQLVAEASD---------------GAEAVARA 128

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
              L     LD  +      +    +          V      +   +     +      
Sbjct: 129 AETLPDVVLLDVRMPKRTGIEACAAIKE--------VCPSAKIIMLTISDEEADLYEAIK 180

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
                Y      +  +   +  +     +I      ++  L  + + + +    H     
Sbjct: 181 AGAMGYLLKEISIDEVAAAIRAVHGGQSLISPSMASKL--LNEFASLIKRGDARHQVPAP 238

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE+E L  +++G  + +IA  L IS NTV N++ +I+ K    +R  A+ YAVR  
Sbjct: 239 KLTEREMEVLRLVAKGLNNRDIAKQLFISENTVKNHVRNILEKLQLHSRMEAVVYAVREK 298

Query: 245 IV 246
           ++
Sbjct: 299 LL 300


>gi|319785576|ref|YP_004145052.1| Autoinducer-binding domain protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317171464|gb|ADV15002.1| Autoinducer-binding domain protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 243

 Score =  144 bits (364), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 37/238 (15%), Positives = 77/238 (32%), Gaps = 20/238 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQ---EQKLDSIVSSDWPF 84
              + + ++       +   R+  +T   G +  +            Q+   ++  DWP 
Sbjct: 6   RTLEYIDQLQHAATAAAVCERLLGITSDFGLTALMAGTVPQPGTPAGQQKQHVLLCDWPG 65

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLP-------------ENITPPAGMDNRYC 131
           + +          +  V+    +L  P                           + +   
Sbjct: 66  EWLERYVARNYVDHDPVVSHMKQLQAPFQWHEASQGIRIDKSSGEVMGDAGAFKLRDGLA 125

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE---LTG 188
                +    + + L   +   +      ++ L++ Y             +  +   LT 
Sbjct: 126 FPLITLDGQIVMVSL-GGEAVELSAAEFGQVSLVSTYAVGRAMQLHTMANRTIDHIVLTP 184

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE ECL W + GK+  EI+ ILGIS +T   ++ +   K     R  A+A A+R   +
Sbjct: 185 RERECLQWAAVGKSEWEISQILGISEHTSEKHLLNAKSKLGAVNRVQAVAEAIRRGYI 242


>gi|59940029|gb|AAX12553.1| LuxR-type transcriptional regulator [Aeromonas hydrophila]
          Length = 261

 Score =  144 bits (364), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 84/237 (35%), Gaps = 21/237 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L  +  +         +   T  +G  ++          Q+   ++ +  P   V+  
Sbjct: 8   EYLEHLTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRRKVVLFNQCPDSWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    +                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGL-MLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTGR 189
            A     +   +  +     +L +    +  ++ Y             ++ +    LT R
Sbjct: 128 AAGENGIILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTDR 187

Query: 190 EVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 188 ETECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYQAIAKGVSSGIL 244


>gi|12620899|gb|AAG61129.1|AF330018_1 AHL receptor [Burkholderia cepacia ATCC 25416]
 gi|17939926|emb|CAD19536.1| CepR protein [Burkholderia cepacia]
 gi|288551614|gb|ADC53303.1| transcriptional activator [Burkholderia cepacia]
          Length = 239

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 76/235 (32%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       R+ A ++ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYQQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPSVAIFDTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI--------TPPAGMDNRYCSLTFDVA 138
           +         +  + ++        +     + I            G+       +   A
Sbjct: 63  MAHYQAHNYIEIDSTVRDGALSTNMIVWPDVDQIEPCPLWQDARDFGLSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       L+    + F    +       LT RE 
Sbjct: 122 RGAFGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPAAGVTLTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|91779483|ref|YP_554691.1| LuxR family transcriptional regulator [Burkholderia xenovorans
           LB400]
 gi|91692143|gb|ABE35341.1| transcriptional regulator, LuxR family [Burkholderia xenovorans
           LB400]
          Length = 234

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 37/231 (16%), Positives = 69/231 (29%), Gaps = 17/231 (7%)

Query: 33  LARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMAL 92
           +A ++       W   +  L E  G    L+        +  D+ V S +     R    
Sbjct: 1   MAPLLNAADEAEWFGTIAGLVETWGFEKLLIAMLPRPTIRLEDAYVRSTYSPIWRRTYDE 60

Query: 93  SEKDKYYNVLQRPTELFCPVFHTLP----------ENITPPAGMDNRYCSLTFDVARIRI 142
                    +        P+  +                   G+            +   
Sbjct: 61  QGLVHIDPTVSHCATRATPLIWSPDIFTTAPQQSMYEEARAHGLRAGVTLPIHGPNQEAG 120

Query: 143 GLMLLFPKGRIILRD-----RLWEIGLLAAYQANMFKSYDVHWGKD--FELTGREVECLT 195
            +  +                L  + LL     +  + +     +    +LT RE ECL 
Sbjct: 121 MMCFVNDSNPNDEFWQHINVALPNLVLLRDLVIDTSQRHLNTHAQTLLPKLTPRERECLK 180

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W + GK++ EI+ IL  S   VN ++ +I  K    +R  A   A +  ++
Sbjct: 181 WTARGKSTWEISHILNCSEAVVNFHMKNIRTKFGVNSRRAAAVIATQLGLI 231


>gi|167572684|ref|ZP_02365558.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia oklahomensis C6786]
          Length = 239

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 35/234 (14%), Positives = 72/234 (30%), Gaps = 14/234 (5%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       ++ A ++ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYLQFSAAENEQQLFRQIAAYSKRLGFEYCCYGIRVPLPISKPAVAIFDTYPNGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFH--------TLPENITPPAGMDNRYCSLTFDVA 138
           +         +    ++        +          T   N     G+       ++   
Sbjct: 63  MERYQEMNYLEVDPTVRDGALSTNMIVWPEASRSDGTTLWNDARDHGLAVGVAQSSWAPR 122

Query: 139 RIRIGLMLLFPKGRIILRDR------LWEIGLLAAYQANMFKSYDVHWGKDFELTGREVE 192
            +   L +     R+   +          +  ++    + F    +       LT RE E
Sbjct: 123 GVFGLLTIARHTDRLTSAEINQLTLQANWLANMSHSLMSRFLVPKLAPESGVALTHRERE 182

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            L W  EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 183 VLCWTGEGKTACEIGQILSISERTVNFHVNNILDKLGATNKVQAVVKAIAMGLI 236


>gi|170693116|ref|ZP_02884277.1| transcriptional regulator, LuxR family [Burkholderia graminis
           C4D1M]
 gi|170142114|gb|EDT10281.1| transcriptional regulator, LuxR family [Burkholderia graminis
           C4D1M]
          Length = 255

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 37/233 (15%), Positives = 71/233 (30%), Gaps = 17/233 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + +A ++      +W   +  L E  G    L+        +  D+ V S +     R  
Sbjct: 20  EQMAPLLDAADEAAWFGAVADLAETWGFDRLLIAMLPRPTIRLEDAYVRSTYAPAWRRTY 79

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLP----------ENITPPAGMDNRYCSLTFDVARI 140
                      +        P+  +                   G+            + 
Sbjct: 80  DEQGLVHIDPTVAHCATRSTPLVWSPEIFITAPQRSMYEEARAHGLRAGVTLPIHGPNQE 139

Query: 141 RIGLMLLFPKGRIIL-----RDRLWEIGLLAAYQANMFKSYDVHWGKD--FELTGREVEC 193
              +  +                L  + LL     +  + +     +    +LT RE EC
Sbjct: 140 AGMMCFVNDANPTDTFWRHIDVVLPNLVLLRDLVIDTSQRHLHTHTQTLLPKLTPREREC 199

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GK++ EI+ IL  S   VN ++ +I  K    +R  A   A +  ++
Sbjct: 200 LQWTARGKSTWEISHILNCSEAVVNFHMKNIRTKLGVNSRRAAAVIATQLGLI 252


>gi|14586754|gb|AAK70349.1|AF333004_1 N-acyl homoserine lactone transcriptional regulator [Burkholderia
           multivorans ATCC BAA-247]
          Length = 239

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 40/235 (17%), Positives = 77/235 (32%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
             R D   +    +       R+ A ++ +G  +            K    +   +P   
Sbjct: 3   LRRQDAYQQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPSVAIFDTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------PPAGMDNRYCSLTFDVA 138
           +         +  + ++        +     + I            G+       +   A
Sbjct: 63  MAHYQAHNYIEIDSTVRDGALSTNMIVWPDVDQIAPCPLWQDARDFGLSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       L+    + F    +       LT RE 
Sbjct: 122 RGAFGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPAAGVTLTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|323704464|ref|ZP_08116042.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323535926|gb|EGB25699.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 210

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 40/217 (18%), Positives = 75/217 (34%), Gaps = 21/217 (9%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
             D +     L   +     M  + +   G   + L + +      +D  + +       
Sbjct: 7   ADDHVLLRQGLKQIIELEEDMKVVYQASDGEEAYNLAKNNSPDIILMDINMPNVNGIKAA 66

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLL 147
           + +  ++             +F  +++     +         Y     D   +   + ++
Sbjct: 67  KMIKSNDPKN--------KIMFLTIYNDKEYLMEALKIGVEGYILKDADSDELIKAIRII 118

Query: 148 FPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIA 207
              G  I    + EI  L                   +LT RE E L  I+EG ++ EIA
Sbjct: 119 SNGGVYIHPSLIREIESL------------EKNECKKDLTDREFEILNLIAEGYSNKEIA 166

Query: 208 VILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
             L +S  TV N++ +I RK   K R+ A  Y ++NN
Sbjct: 167 DKLFLSEKTVKNHVYNIFRKLDVKDRTQAAIYLLKNN 203


>gi|328555254|gb|AEB25746.1| two-component response regulator [Bacillus amyloliquefaciens TA208]
          Length = 229

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 34/248 (13%), Positives = 73/248 (29%), Gaps = 30/248 (12%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           + +VNIV+  + +     V  +         +   D                G     +V
Sbjct: 1   MTKVNIVIIDDHQLFREGVKRILDFEPTFEVVAEGDD---------------GDEAARIV 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                    +D  + +    +  + +                 +   +            
Sbjct: 46  EHYHPDVVIMDINMPNVNGVEATKQLVEL--------YPESKVIILSIHDDENYVTHALK 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILR-------DRLWEIGLLAAYQANMFKSYD 177
                Y     D   +   + ++   G  +         +    +           + Y 
Sbjct: 98  TGARGYLLKEMDADTLIEAVKVVAEGGSYLHPKVTHNLVNEFRRLATSGVSAHPQHEVYP 157

Query: 178 VHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
                   LT RE E L  +++GK++  I   L IS  TV N++++I++K     R+ A+
Sbjct: 158 EIRRPLHILTRRECEVLQMLADGKSNRGIGESLFISEKTVKNHVSNILQKMNVNDRTQAV 217

Query: 238 AYAVRNNI 245
             A++N  
Sbjct: 218 VVAIKNGW 225


>gi|221196069|ref|ZP_03569116.1| N-acyl homoserine lactone transcriptional regulator [Burkholderia
           multivorans CGD2M]
 gi|221202743|ref|ZP_03575762.1| N-acyl homoserine lactone transcriptional regulator [Burkholderia
           multivorans CGD2]
 gi|221176677|gb|EEE09105.1| N-acyl homoserine lactone transcriptional regulator [Burkholderia
           multivorans CGD2]
 gi|221182623|gb|EEE15023.1| N-acyl homoserine lactone transcriptional regulator [Burkholderia
           multivorans CGD2M]
          Length = 239

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 40/235 (17%), Positives = 76/235 (32%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D        +       R+ A ++ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYDEFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI--------TPPAGMDNRYCSLTFDVA 138
           +         +  + ++  T     +     + I            G+       +   A
Sbjct: 63  MAHYQAQNYIEIDSTVRDGTLSTNMIVWPDVDKIEPCPLWRDARDFGLSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       L+    + F    +       LT RE 
Sbjct: 122 RGAFGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPEARVTLTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGASNKVQAVVKAISAGLI 236


>gi|167565578|ref|ZP_02358494.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia oklahomensis EO147]
          Length = 239

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 35/234 (14%), Positives = 72/234 (30%), Gaps = 14/234 (5%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       ++ A ++ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYLQFSAAENEQQLFRQIAAYSKRLGFEYCCYGIRVPLPISKPAVAIFDTYPNGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFH--------TLPENITPPAGMDNRYCSLTFDVA 138
           +         +    ++        +          T   N     G+       ++   
Sbjct: 63  MERYQEMNYLEVDPTVRDGALSTNMIVWPEASRSDETTLWNDARDHGLAVGVAQSSWAPR 122

Query: 139 RIRIGLMLLFPKGRIILRDR------LWEIGLLAAYQANMFKSYDVHWGKDFELTGREVE 192
            +   L +     R+   +          +  ++    + F    +       LT RE E
Sbjct: 123 GVFGLLTIARHTDRLTSAEINQLTLQANWLANMSHSLMSRFLVPKLAPESGVALTHRERE 182

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            L W  EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 183 VLCWTGEGKTACEIGQILSISERTVNFHVNNILDKLGATNKVQAVVKAIAMGLI 236


>gi|90023140|ref|YP_528967.1| LuxR family transcriptional regulator [Saccharophagus degradans
           2-40]
 gi|89952740|gb|ABD82755.1| transcriptional regulator, LuxR family [Saccharophagus degradans
           2-40]
          Length = 247

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 37/236 (15%), Positives = 78/236 (33%), Gaps = 20/236 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIV-SSDWPFDLVRC 89
           +L + +       +         E VG   ++             +I   S++P +  + 
Sbjct: 8   ELCSALCEATDEETLKELCLKFCELVGFEFYIFGIISSASSLSSPTISTISNYPDEWFKN 67

Query: 90  MALSEKDKYYNVLQRPTELFCPVFHTLPEN--------------ITPPAGMDNRYCSLTF 135
                  ++  V++   +    +      +                  +G+ +       
Sbjct: 68  YFEEGMQRHDPVVRYCMQNTSAIRWRQLMDLEHYVDAIGEKIMIRASESGLCDGLSIPIK 127

Query: 136 DVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDV-----HWGKDFELTGRE 190
             +       L   +   + +     +    ++   +F+ Y          K   LT RE
Sbjct: 128 APSGEIAIFSLASNREEGLNQRINACLPFAQSFGTQVFECYSALMLKLAQNKQTHLTARE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            E L W  EGKT+ EI+ IL +S  TV  +++S   K     R  A+A A+ + ++
Sbjct: 188 KESLFWACEGKTTWEISKILDVSERTVIFHLSSATSKLGAVNRQHAVAKAILSGLI 243


>gi|15889561|ref|NP_355242.1| LuxR family transcriptional regulator [Agrobacterium tumefaciens
           str. C58]
 gi|15157444|gb|AAK88027.1| transcriptional regulator, LuxR family [Agrobacterium tumefaciens
           str. C58]
          Length = 238

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 47/225 (20%), Positives = 86/225 (38%), Gaps = 15/225 (6%)

Query: 36  MIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQK-LDSIVSSDWPFDLVRCMALSE 94
           +        W   +  +    G +H  L+R    Q    L  +V S  P  +V  M    
Sbjct: 14  LSAAADKSQWLEALQEVMHAFGYAHVTLLRLPGGQNAFALPLVVESSLPVWVVNAMTKDG 73

Query: 95  KDKYYNVLQRPTELFCPVFHTLPENITPPA------------GMDNRYCSLTFDVARIRI 142
                 V++R      P + +L +                  G+ +        ++  R 
Sbjct: 74  ALGDCPVIKRGASSMMPQYWSLEDPEMACGSLVDAVNSVGSMGITSGLMVPVNGMSGNRH 133

Query: 143 GLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGK-DFELTGREVECLTWISEGK 201
            +     +   + +  L E+ ++A +    +        K    LT RE++ + W ++GK
Sbjct: 134 LMNFAGDRDT-LPQASLNELCMIALHALETYDRLCRVASKGPSPLTKRELDVVRWTAQGK 192

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           TS EIA +L IS +TVN Y+ + MRK     R+  +A  +R  ++
Sbjct: 193 TSVEIAELLSISEHTVNTYMNNAMRKLDCVNRTQLVAKTIRLRLI 237


>gi|13474692|ref|NP_106261.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
 gi|14025447|dbj|BAB52047.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
          Length = 243

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 39/238 (16%), Positives = 77/238 (32%), Gaps = 20/238 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQ---EQKLDSIVSSDWPF 84
              + + ++       +   ++  +T   G +  +           EQ+   ++  DWP 
Sbjct: 6   RTLEYIDQLQHAGTAAAVCEKLLGITSDFGLTALMAGTVPQPGTPSEQQKQHVLLCDWPV 65

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLP-------------ENITPPAGMDNRYC 131
           + +          +  V+    +L  P                           + +   
Sbjct: 66  EWLERYVARNYVDHDPVVSHMKQLQAPFQWREAAQGISFDKSSGEVMGDAGAFKLRDGLA 125

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGK---DFELTG 188
                +    + + L   +   +       + L++ Y             K     ELT 
Sbjct: 126 FPLITLDGQIVMVSL-GGEAMQLSAAEFGLVSLVSTYAVGRAMQLHTMATKTIDHIELTP 184

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE ECL W + GK+  EI+ ILGIS +T   ++ +   K     R  A+A A+R   +
Sbjct: 185 RERECLQWAAVGKSEWEISQILGISEHTSEKHLLNAKSKLGAVNRVQAVAEAIRRGYI 242


>gi|306850701|gb|ADN06870.1| transcriptional activator PhzR [Pseudomonas sp. CMR12a]
          Length = 241

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 38/225 (16%), Positives = 76/225 (33%), Gaps = 14/225 (6%)

Query: 36  MIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEK 95
                 T  +        + +    F      +    +  + + S++P   V+       
Sbjct: 17  FSQASDTEEFKGIAMGALQELDFDFFAYGTCSVTPFMRPKTSIYSNYPEPWVQRYQAQNY 76

Query: 96  DKYYNVLQRPTELFCPVFHT--------LPENITPPAGMDNRYCSLTFDVARIRIGLMLL 147
                 ++       P+              +    + + +     +F+       L L 
Sbjct: 77  ALIDPTVKHSKLSSAPILWGNELFRECPQLWSEARDSNLCHGLAQPSFNAQGRVGLLSLA 136

Query: 148 FPKGRIILRD------RLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGK 201
                I   +            + A  + +  ++ D       E +GRE + L W ++GK
Sbjct: 137 RRNKAISAEEFEALKPVTKAFAMAAHEKLSELENDDSSLNVQVEFSGRECDVLRWTADGK 196

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           TS+EI VI+G+  +TVN +  +I RK     R  A++YAV    +
Sbjct: 197 TSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAVALGYI 241


>gi|297583325|ref|YP_003699105.1| LuxR family two component transcriptional regulator [Bacillus
           selenitireducens MLS10]
 gi|297141782|gb|ADH98539.1| two component transcriptional regulator, LuxR family [Bacillus
           selenitireducens MLS10]
          Length = 235

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 40/241 (16%), Positives = 79/241 (32%), Gaps = 20/241 (8%)

Query: 13  NREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQ 72
             +D  R   +       + + R++ ++  +             G     LVR +     
Sbjct: 5   VNQDTLRILLIDDHQLFREGVKRILTMEPGLEVVAE-----GNDGEDVVDLVRQNKPDVV 59

Query: 73  KLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCS 132
            +D  +      D  + +  S              L   +               + Y  
Sbjct: 60  LMDINMPGMNGVDATKTLLKS--------FPNVRVLILSIHDDESYVTHVLKTGASGYLL 111

Query: 133 LTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE------- 185
              D   +   + ++   G  I       +       AN   +      ++ E       
Sbjct: 112 KEMDTEALIEAVKVVGNGGSYIHPKVTHNLIKEYRRLANETGNNGEIGFREVEYRRPLHL 171

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +++GK++  I   L IS  TV N++++I++K     R+ A+  A++N  
Sbjct: 172 LTRRECEVLQLMTDGKSNRSIGEALYISEKTVKNHVSNILQKMGMNDRTQAVVDAIKNGW 231

Query: 246 V 246
           V
Sbjct: 232 V 232


>gi|299821874|ref|ZP_07053762.1| DNA-binding response regulator [Listeria grayi DSM 20601]
 gi|299817539|gb|EFI84775.1| DNA-binding response regulator [Listeria grayi DSM 20601]
          Length = 241

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 34/246 (13%), Positives = 78/246 (31%), Gaps = 30/246 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + I++  + +     + H+    D    ++  +   +   ++   +              
Sbjct: 16  LKIMIVDDHQLFREGLKHILETEDSFEVVLEAEDGKNIVSKVREAS-------------- 61

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  + S    D    +                 +   +  +     +      
Sbjct: 62  -PDVILMDINMPSVNGLDATEMLIRQ--------FPSAKIIMLSIHDSDEFVSSALKTGA 112

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRL-------WEIGLLAAYQANMFKSYDVHW 180
             Y     D   +   + +++  G  I              +   ++ Q N         
Sbjct: 113 VGYLLKEMDANELIEAIKVVYKGGAYIHPKAAIKLIREYRNLASSSSAQGNYGYRQPEVN 172

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
                LT RE E L  +++GK++  I   L IS  TV N+++SI++K     R+ A+  A
Sbjct: 173 MPLHLLTHRECEVLQLLTDGKSNRSIGEALFISEKTVKNHVSSILQKMKVNDRTQAVVTA 232

Query: 241 VRNNIV 246
           +++  V
Sbjct: 233 IKHGWV 238


>gi|209518837|ref|ZP_03267650.1| transcriptional regulator, LuxR family [Burkholderia sp. H160]
 gi|209500722|gb|EEA00765.1| transcriptional regulator, LuxR family [Burkholderia sp. H160]
          Length = 269

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 42/255 (16%), Positives = 79/255 (30%), Gaps = 19/255 (7%)

Query: 11  VLNREDEQR-TSFVSHL-PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDL 68
            +NRE   R    V  L     + +A ++       W   +  L+E  G    L+     
Sbjct: 12  AINREWAVREPERVKKLSLHFIEQMAPLLDAANEAEWFGVITGLSETWGFDRILVAMLPR 71

Query: 69  FQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTL----------PE 118
              +  D+ + S +     +         +   +        P+  T             
Sbjct: 72  PTMRLEDAYLRSTYAPAWRQAYDEQGMVHFDPTVAHCLSRSGPLIWTPEIFATPAQQSLY 131

Query: 119 NITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILR-----DRLWEIGLLAAYQANMF 173
                 G+            +    +  +                L  + LL     +  
Sbjct: 132 EEARSYGLGAGVTLPIHGPNQEAGMMCFVNDDKPSDGFRRHVNAALPNLVLLRDLVIDTS 191

Query: 174 KSYDVHWGKD--FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATK 231
           + +     +    +LT RE ECL W + GK++ EI+ IL  S   VN ++ +I  K    
Sbjct: 192 RQHLNSHAQTLLPKLTPRERECLKWTARGKSTWEISHILSCSEAVVNFHMKNIRTKFGVN 251

Query: 232 TRSGAIAYAVRNNIV 246
           +R  A   A +  ++
Sbjct: 252 SRRAAAVIAAQLGLI 266


>gi|291486102|dbj|BAI87177.1| two-component response regulator [Bacillus subtilis subsp. natto
           BEST195]
          Length = 229

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 35/249 (14%), Positives = 74/249 (29%), Gaps = 30/249 (12%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           + +VNIV+  + +     V  +         +   D                G     +V
Sbjct: 1   MTKVNIVIIDDHQLFREGVKRILDFEPTFEVVAEGDD---------------GDEAARIV 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                    +D  + +    +  + +                 +   +            
Sbjct: 46  EHYHPDVVIMDINMPNVNGVEATKQLVEL--------YPESKVIILSIHDDENYVTHALK 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILR-------DRLWEIGLLAAYQANMFKSYD 177
                Y     D   +   + ++   G  +         +    +           + Y 
Sbjct: 98  TGARGYLLKEMDADTLIEAVKVVAEGGSYLHPKVTHNLVNEFRRLATSGVSAHPQHEVYP 157

Query: 178 VHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
                   LT RE E L  +++GK++  I   L IS  TV N++++I++K     R+ A+
Sbjct: 158 EIRRPLHILTRRECEVLQMLADGKSNRGIGESLFISEKTVKNHVSNILQKINVNDRTQAV 217

Query: 238 AYAVRNNIV 246
             A++N  V
Sbjct: 218 VVAIKNGWV 226


>gi|172152203|emb|CAP91064.1| BraR protein [Burkholderia kururiensis]
          Length = 234

 Score =  143 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 37/231 (16%), Positives = 73/231 (31%), Gaps = 17/231 (7%)

Query: 33  LARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMAL 92
           ++ ++       W   +  L    G S  LL        +  D+ V S++     +    
Sbjct: 1   MSPILAASDETQWFDAVAGLAGSWGFSQVLLAILPRPGMRLEDAYVRSNYASSWRQAYTD 60

Query: 93  SEKDKYYNVLQRPTELFCPVFHTLP----------ENITPPAGMDNRYCSLTFDVARIRI 142
                    +   T+   P+  +                   G+            +   
Sbjct: 61  QGFAYIDPTVSHCTKHSSPLVWSPDLFATTPQKSMYEEASAHGLRAGVTLPIHGPRQEAG 120

Query: 143 GLMLLFPKGR-----IILRDRLWEIGLLAAYQANMFKSYDVHWGKD--FELTGREVECLT 195
            L  +            +   L  + L+     +  + +     +    +LT RE ECL 
Sbjct: 121 MLCFVNDSNPNDKFWQHIDTALPNLVLMRDLVIDTSQRHLSAHAQTLIPKLTPRERECLK 180

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W + GK++ EI+ IL  S   VN ++ +I  K    +R  A   A +  ++
Sbjct: 181 WTALGKSTWEISHILNCSEAVVNFHMKNIRAKFGVNSRRAAAVIATQLGLI 231


>gi|311070055|ref|YP_003974978.1| two-component response regulator [Bacillus atrophaeus 1942]
 gi|310870572|gb|ADP34047.1| two-component response regulator [Bacillus atrophaeus 1942]
          Length = 229

 Score =  143 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 35/249 (14%), Positives = 74/249 (29%), Gaps = 30/249 (12%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           + +VNIV+  + +     V  +         +   D                G     +V
Sbjct: 1   MTKVNIVIIDDHQLFREGVKRILDFEPTFEVVAEGDD---------------GDEAARIV 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                    +D  + +    +  + +                 +   +            
Sbjct: 46  EHYHPDVVIMDINMPNVNGVEATKQLVEL--------YPESKVIILSIHDDENYVTHALK 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILR-------DRLWEIGLLAAYQANMFKSYD 177
                Y     D   +   + ++   G  +         +    +           + Y 
Sbjct: 98  TGARGYLLKEMDADTLIEAVKVVAEGGSYLHPKVTHNLVNEFRRLATSGVSAHPQHEVYP 157

Query: 178 VHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
                   LT RE E L  +++GK++  I   L IS  TV N++++I++K     R+ A+
Sbjct: 158 EIRRPLHILTRRECEVLQMLADGKSNRGIGESLFISEKTVENHVSNILQKMNVNDRTQAV 217

Query: 238 AYAVRNNIV 246
             A++N  V
Sbjct: 218 VVAIKNGWV 226


>gi|52082083|ref|YP_080874.1| two-component response regulator [Bacillus licheniformis ATCC
           14580]
 gi|52787473|ref|YP_093302.1| DegU [Bacillus licheniformis ATCC 14580]
 gi|319647951|ref|ZP_08002169.1| transcriptional regulatory protein degU [Bacillus sp. BT1B_CT2]
 gi|52005294|gb|AAU25236.1| two-component response regulator [Bacillus licheniformis ATCC
           14580]
 gi|52349975|gb|AAU42609.1| DegU [Bacillus licheniformis ATCC 14580]
 gi|56310547|emb|CAE82205.1| two-component response regulator [Bacillus licheniformis]
 gi|106880136|emb|CAJ70739.1| two component response regulator [Bacillus licheniformis]
 gi|106880142|emb|CAJ70744.1| two component response regulator [Bacillus licheniformis]
 gi|317390292|gb|EFV71101.1| transcriptional regulatory protein degU [Bacillus sp. BT1B_CT2]
          Length = 229

 Score =  143 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 35/249 (14%), Positives = 74/249 (29%), Gaps = 30/249 (12%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           + +VNIV+  + +     V  +         +   D                G     +V
Sbjct: 1   MTKVNIVIIDDHQLFREGVKRILDFEPTFEVVAEGDD---------------GDEAARIV 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                    +D  + +    +  + +                 +   +            
Sbjct: 46  EHYHPDVVIMDINMPNVNGVEATKQLVDL--------YPESKVIILSIHDDENYVTHALK 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILR-------DRLWEIGLLAAYQANMFKSYD 177
                Y     D   +   + ++   G  +         +    +           + Y 
Sbjct: 98  TGARGYLLKEMDADTLIEAVKVVAEGGSYLHPKVTHNLVNEFRRLATSGVSSHAQHEVYP 157

Query: 178 VHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
                   LT RE E L  +++GK++  I   L IS  TV N++++I++K     R+ A+
Sbjct: 158 EIRRPLHILTRRECEVLQMLADGKSNRGIGESLFISEKTVKNHVSNILQKMNVNDRTQAV 217

Query: 238 AYAVRNNIV 246
             A++N  V
Sbjct: 218 VVAIKNGWV 226


>gi|14627170|gb|AAK50054.2|AF364058_1 transcriptional activator [Burkholderia multivorans ATCC 17616]
          Length = 239

 Score =  143 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 75/235 (31%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D        +       R+ A ++ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYDEFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI--------TPPAGMDNRYCSLTFDVA 138
           +         +  + ++        +     + I            G+       +   A
Sbjct: 63  MAHYQAQNYIEIDSTVRDGALSTNMIVWPDVDKIEPCPLWRDARDFGLSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       L+    + F    +       LT RE 
Sbjct: 122 RGAFGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPETRVALTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILCISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|6572977|gb|AAF17494.1|AF195615_2 transcriptional activator PhzR [Pseudomonas chlororaphis]
          Length = 241

 Score =  143 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 40/226 (17%), Positives = 78/226 (34%), Gaps = 16/226 (7%)

Query: 36  MIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEK 95
                    +T     +   +    F      +    +  + +  ++P D V+    +  
Sbjct: 17  FARTMDMQEFTAVTLRVLRELRFDFFAYGMCSVTPFMRPRTCMYGNYPEDWVQRYQAANY 76

Query: 96  DKYYNVLQRPTELFCPVFHT--------LPENITPPAGMDNRYCSLTFDVARIRIGLMLL 147
                 ++       P+  +           +    + + +     +F+       L L 
Sbjct: 77  AVIDPTVKHSKVSSAPILWSNELFRGCPDLWSEANDSNLCHGLAQPSFNAQGRVGMLSLA 136

Query: 148 FPKGRIILRDRLWEIGLL----AAYQANMFKSYDV---HWGKDFELTGREVECLTWISEG 200
                 I       + L+    AA         +     +  D E +GRE + L W ++G
Sbjct: 137 RKDNP-ISLQEFEALKLMTKAFAAAIHEKISELESDVRVFNTDVEFSGRECDVLRWTADG 195

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           KTS+EI VI+G+  +TVN +  +I RK     R  A++YAV    +
Sbjct: 196 KTSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAVAMGYI 241


>gi|289435776|ref|YP_003465648.1| DNA-binding response regulator [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
 gi|289172020|emb|CBH28566.1| DNA-binding response regulator [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
 gi|313631967|gb|EFR99092.1| transcriptional regulatory protein DegU [Listeria seeligeri FSL
           N1-067]
          Length = 228

 Score =  143 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 36/233 (15%), Positives = 72/233 (30%), Gaps = 20/233 (8%)

Query: 21  SFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSS 80
             V       + + R++ L+ +              G +    VR        +D  + +
Sbjct: 6   MVVDDHQLFREGIKRILELEDSFEVVAEAEN-----GKNIVAKVREYKPDIVLMDINMPT 60

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARI 140
               D    +                 +   +  T              Y     D   +
Sbjct: 61  VNGLDATEMLVRQ--------FPSIKVIVLTIHDTDEYVTEALRAGAVGYLLKEMDAHEL 112

Query: 141 RIGLMLLFPKGRIILRDRLWEIGLLAAYQAN-------MFKSYDVHWGKDFELTGREVEC 193
              + ++   G  I      ++     + A+                     LT RE E 
Sbjct: 113 VEAVKIVDNGGAYIHPRVAIKLIREYRHLASTNTSQGVYGYQQPEVKMPLHILTHRECEV 172

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L  +++GK++  I   L IS  TV N+++SI++K     R+ A+  A+++  V
Sbjct: 173 LQLLTDGKSNRGIGETLFISEKTVKNHVSSILQKMKVNDRTQAVVTAIKHGWV 225


>gi|144900185|emb|CAM77049.1| regulatory protein, LuxR:Autoinducer-binding [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 242

 Score =  143 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 48/240 (20%), Positives = 80/240 (33%), Gaps = 15/240 (6%)

Query: 22  FVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSS- 80
            V       D + R +  D   +    + +   + G  H     +   +    D  V + 
Sbjct: 1   MVGDNFRLGDFIERTLRADTAPALMSELKSALVHWGFPHMACGAFGEPERPLDDMSVPAV 60

Query: 81  --DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPEN----------ITPPAGMDN 128
             D+P +  +            V+ R  + + P       +              AG+ +
Sbjct: 61  VVDYPEEWQKYYFEKNYVTIDPVITRACQAYVPYRWDQLRDLTNPQKRMFKEATEAGLRH 120

Query: 129 RYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFK--SYDVHWGKDFEL 186
                            +  P   I     L    +L     ++     +         L
Sbjct: 121 GITVPVHGPNGSIFVASVASPHTDIDHLRSLSVANVLVTQVYSVLVGMRHPGAPSAPVSL 180

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T RE ECL W + GK+S +I VIL IS NTVN ++ + M K    TR  AI  A+R  ++
Sbjct: 181 TARERECLIWSARGKSSWDIGVILNISDNTVNFHLKNAMGKLKASTRVLAIVKAIRMGLI 240


>gi|12620907|gb|AAG61133.1|AF330022_1 AHL receptor [Burkholderia vietnamiensis]
          Length = 239

 Score =  143 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 38/235 (16%), Positives = 74/235 (31%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       R+ A ++ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYQQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVA 138
           +         +  + ++        +                    G+       +   A
Sbjct: 63  MAHYQARNYIEIDSTVREGALSTNMIVWPDVDRIDPCPLWEDARDFGLAVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       L+    + F    +       LT RE 
Sbjct: 122 RGAFGLLSISRHADRLTPAEINMLTLQTNWLANLSHSLMSRFMLPKLSPAAGVTLTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|296156923|ref|ZP_06839760.1| transcriptional regulator, LuxR family [Burkholderia sp. Ch1-1]
 gi|295892809|gb|EFG72590.1| transcriptional regulator, LuxR family [Burkholderia sp. Ch1-1]
          Length = 234

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 37/231 (16%), Positives = 69/231 (29%), Gaps = 17/231 (7%)

Query: 33  LARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMAL 92
           +A ++       W   +  L E  G    L+        +  D+ V S +     R    
Sbjct: 1   MAPLLDAADEAEWFGAIAGLAETWGFDKLLIAMLPRPTIRLEDAYVRSTYSPIWRRTYDE 60

Query: 93  SEKDKYYNVLQRPTELFCPVFHTLP----------ENITPPAGMDNRYCSLTFDVARIRI 142
                    +        P+  +                   G+            +   
Sbjct: 61  QGLVHIDPTVSHCATRATPLIWSPDIFTTASQQSMYEEARAHGLRAGVTLPIHGPNQEAG 120

Query: 143 GLMLLFPKGRIILRD-----RLWEIGLLAAYQANMFKSYDVHWGKD--FELTGREVECLT 195
            +  +                L  + LL     +  + +     +    +LT RE ECL 
Sbjct: 121 MMCFVNDSNPSDEFWRHINVALPNLVLLRDLVIDTSQRHLNTHAQTLLPKLTPRERECLK 180

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W + GK++ EI+ IL  S   VN ++ +I  K    +R  A   A +  ++
Sbjct: 181 WTARGKSTWEISHILNCSEAVVNFHMKNIRTKFGVNSRRAAAVIATQLGLI 231


>gi|307824873|ref|ZP_07655096.1| transcriptional regulator, LuxR family [Methylobacter tundripaludum
           SV96]
 gi|307734231|gb|EFO05085.1| transcriptional regulator, LuxR family [Methylobacter tundripaludum
           SV96]
          Length = 236

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 35/232 (15%), Positives = 77/232 (33%), Gaps = 14/232 (6%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           +   L  +  + C       + + ++ +G  H               +++ +++P     
Sbjct: 5   QETQLQALQSIQCAHQLFQTILSFSKELGFDHCAYGLRMPLPLTNPKTLMFNNYPTAWQA 64

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFH--------TLPENITPPAGMDNRYCSLTFDVARI 140
                        +Q       P+          +         G+   +   + D    
Sbjct: 65  QYQAKNYLAIDPTVQHAMRSLLPIIWTDDLFSPASDLWEEACSFGLRVGWAQSSRDFNGF 124

Query: 141 RIGLMLLFPKGRIILRDR------LWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECL 194
              L L      I   +       +  +  +A    +   +  +    +  L+ RE+E L
Sbjct: 125 VGMLTLARSNEPITEIELDANKFKMAWLTQVAHLGMSRCLTPKLMQEVNVTLSNREIEVL 184

Query: 195 TWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            W ++GKTS EI+ IL I+  TVN +I +++ K     ++ A   A    ++
Sbjct: 185 RWTADGKTSSEISCILNIAERTVNFHINNVVTKLNAANKTSATIKAAMLGLL 236


>gi|16801720|ref|NP_471988.1| hypothetical protein lin2659 [Listeria innocua Clip11262]
 gi|16804553|ref|NP_466038.1| hypothetical protein lmo2515 [Listeria monocytogenes EGD-e]
 gi|46908687|ref|YP_015076.1| DNA-binding response regulator DegU [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|47093717|ref|ZP_00231469.1| DNA-binding response regulator DegU [Listeria monocytogenes str. 4b
           H7858]
 gi|47096108|ref|ZP_00233709.1| DNA-binding response regulator DegU [Listeria monocytogenes str.
           1/2a F6854]
 gi|217963383|ref|YP_002349061.1| transcriptional regulatory protein DegU (Protease production
           enhancerprotein) [Listeria monocytogenes HCC23]
 gi|224499869|ref|ZP_03668218.1| transcriptional regulatory protein DegU (Protease production
           enhancerprotein) [Listeria monocytogenes Finland 1988]
 gi|224503244|ref|ZP_03671551.1| transcriptional regulatory protein DegU (Protease production
           enhancerprotein) [Listeria monocytogenes FSL R2-561]
 gi|226225063|ref|YP_002759170.1| two-component response regulator DegU [Listeria monocytogenes
           Clip81459]
 gi|254825362|ref|ZP_05230363.1| DNA-binding response regulator DegU [Listeria monocytogenes FSL
           J1-194]
 gi|254828090|ref|ZP_05232777.1| DNA-binding response regulator DegU [Listeria monocytogenes FSL
           N3-165]
 gi|254831062|ref|ZP_05235717.1| two-component response regulator DegU [Listeria monocytogenes
           10403S]
 gi|254853956|ref|ZP_05243304.1| DegU [Listeria monocytogenes FSL R2-503]
 gi|254900347|ref|ZP_05260271.1| two-component response regulator DegU [Listeria monocytogenes
           J0161]
 gi|254913414|ref|ZP_05263426.1| DNA-binding response regulator DegU [Listeria monocytogenes J2818]
 gi|254932243|ref|ZP_05265602.1| DNA-binding response regulator DegU [Listeria monocytogenes
           HPB2262]
 gi|254937795|ref|ZP_05269492.1| DNA-binding response regulator DegU [Listeria monocytogenes F6900]
 gi|254993056|ref|ZP_05275246.1| two-component response regulator DegU [Listeria monocytogenes FSL
           J2-064]
 gi|255030722|ref|ZP_05302673.1| two-component response regulator DegU [Listeria monocytogenes LO28]
 gi|255521855|ref|ZP_05389092.1| two-component response regulator DegU [Listeria monocytogenes FSL
           J1-175]
 gi|284802953|ref|YP_003414818.1| hypothetical protein LM5578_2710 [Listeria monocytogenes 08-5578]
 gi|284996094|ref|YP_003417862.1| hypothetical protein LM5923_2659 [Listeria monocytogenes 08-5923]
 gi|290892678|ref|ZP_06555670.1| DNA-binding response regulator DegU [Listeria monocytogenes FSL
           J2-071]
 gi|300764985|ref|ZP_07074973.1| DNA-binding response regulator DegU [Listeria monocytogenes FSL
           N1-017]
 gi|16412003|emb|CAD00593.1| lmo2515 [Listeria monocytogenes EGD-e]
 gi|16415195|emb|CAC97885.1| lin2659 [Listeria innocua Clip11262]
 gi|46881959|gb|AAT05253.1| DNA-binding response regulator DegU [Listeria monocytogenes
           serotype 4b str. F2365]
 gi|47015569|gb|EAL06501.1| DNA-binding response regulator DegU [Listeria monocytogenes str.
           1/2a F6854]
 gi|47017911|gb|EAL08692.1| DNA-binding response regulator DegU [Listeria monocytogenes str. 4b
           H7858]
 gi|50313181|gb|AAT74538.1| DegU [Listeria monocytogenes]
 gi|217332653|gb|ACK38447.1| transcriptional regulatory protein DegU (Protease production
           enhancerprotein) [Listeria monocytogenes HCC23]
 gi|225877525|emb|CAS06239.1| Putative two-component response regulator DegU [Listeria
           monocytogenes serotype 4b str. CLIP 80459]
 gi|258600475|gb|EEW13800.1| DNA-binding response regulator DegU [Listeria monocytogenes FSL
           N3-165]
 gi|258607345|gb|EEW19953.1| DegU [Listeria monocytogenes FSL R2-503]
 gi|258610399|gb|EEW23007.1| DNA-binding response regulator DegU [Listeria monocytogenes F6900]
 gi|284058515|gb|ADB69456.1| hypothetical protein LM5578_2710 [Listeria monocytogenes 08-5578]
 gi|284061561|gb|ADB72500.1| hypothetical protein LM5923_2659 [Listeria monocytogenes 08-5923]
 gi|290557738|gb|EFD91260.1| DNA-binding response regulator DegU [Listeria monocytogenes FSL
           J2-071]
 gi|293583800|gb|EFF95832.1| DNA-binding response regulator DegU [Listeria monocytogenes
           HPB2262]
 gi|293591421|gb|EFF99755.1| DNA-binding response regulator DegU [Listeria monocytogenes J2818]
 gi|293594605|gb|EFG02366.1| DNA-binding response regulator DegU [Listeria monocytogenes FSL
           J1-194]
 gi|300514285|gb|EFK41344.1| DNA-binding response regulator DegU [Listeria monocytogenes FSL
           N1-017]
 gi|307572042|emb|CAR85221.1| DNA-binding response regulator [Listeria monocytogenes L99]
 gi|313617172|gb|EFR89687.1| transcriptional regulatory protein DegU [Listeria innocua FSL
           S4-378]
 gi|313622371|gb|EFR92844.1| transcriptional regulatory protein DegU [Listeria innocua FSL
           J1-023]
 gi|328465121|gb|EGF36389.1| hypothetical protein LM1816_15707 [Listeria monocytogenes 1816]
 gi|328471125|gb|EGF42029.1| hypothetical protein LM220_09715 [Listeria monocytogenes 220]
 gi|332312945|gb|EGJ26040.1| Transcriptional regulatory protein degU [Listeria monocytogenes
           str. Scott A]
          Length = 228

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 36/233 (15%), Positives = 72/233 (30%), Gaps = 20/233 (8%)

Query: 21  SFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSS 80
             V       + + R++ L+ +              G +    VR        +D  + +
Sbjct: 6   MIVDDHQLFREGIKRILELEDSFEVVAEAEN-----GKNIVAKVREYKPDIVLMDINMPT 60

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARI 140
               D    +                 +   +  T              Y     D   +
Sbjct: 61  VNGLDATEMLVRQ--------FPSIKVIVLTIHDTDEYVTEALRAGAVGYLLKEMDAHEL 112

Query: 141 RIGLMLLFPKGRIILRDRLWEIGLLAAYQAN-------MFKSYDVHWGKDFELTGREVEC 193
              + ++   G  I      ++     + A+                     LT RE E 
Sbjct: 113 VEAVKIVDNGGAYIHPRVAIKLIREYRHLASTNTSQGVYGYQQPEVKMPLHILTHRECEV 172

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L  +++GK++  I   L IS  TV N+++SI++K     R+ A+  A+++  V
Sbjct: 173 LQLLTDGKSNRGIGETLFISEKTVKNHVSSILQKMKVNDRTQAVVTAIKHGWV 225


>gi|313636331|gb|EFS02121.1| transcriptional regulatory protein DegU [Listeria seeligeri FSL
           S4-171]
          Length = 228

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 36/233 (15%), Positives = 72/233 (30%), Gaps = 20/233 (8%)

Query: 21  SFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSS 80
             V       + + R++ L+ +              G +    VR        +D  + +
Sbjct: 6   MVVDDHQLFREGIKRILELEDSFEVVAEAEN-----GKNIVAKVREYKPDIVLMDINMPT 60

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARI 140
               D    +                 +   +  T              Y     D   +
Sbjct: 61  VNGLDATEMLVRQ--------FPSIKVIVLTINDTDEYVTEALRAGAVGYLLKEMDAHEL 112

Query: 141 RIGLMLLFPKGRIILRDRLWEIGLLAAYQAN-------MFKSYDVHWGKDFELTGREVEC 193
              + ++   G  I      ++     + A+                     LT RE E 
Sbjct: 113 VEAVKIVDNGGAYIHPRVAIKLIREYRHLASTNTSQGVYGYQQPEVKMPLHILTHRECEV 172

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L  +++GK++  I   L IS  TV N+++SI++K     R+ A+  A+++  V
Sbjct: 173 LQLLTDGKSNRGIGETLFISEKTVKNHVSSILQKMKVNDRTQAVVTAIKHGWV 225


>gi|260773944|ref|ZP_05882859.1| transcriptional activator protein luxR [Vibrio metschnikovii CIP
           69.14]
 gi|260610905|gb|EEX36109.1| transcriptional activator protein luxR [Vibrio metschnikovii CIP
           69.14]
          Length = 240

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 36/223 (16%), Positives = 74/223 (33%), Gaps = 15/223 (6%)

Query: 39  LDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKY 98
           +D   +    +  +   +   +FL            D++++ ++P    +    S+    
Sbjct: 14  IDSFQALQPTLAKMNHLIEHEYFLFGLSLQTTLTSNDTLIADNYPLAWRQQYDESQFMLI 73

Query: 99  YNVLQRPTELFCPVFHTLPEN----------ITPPAGMDNRYCSLTFDVARIRIGLMLLF 148
             +++     F P+  +                   G+   +      +      L    
Sbjct: 74  DPIVRYSMTNFLPIRWSEIRAHHQDSQIIFEEARLNGLKEGFSIPVHGLRGEFGMLSFAT 133

Query: 149 PKGR-----IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
              R     +        +  L A   +             ELT RE +CL+W +EGK++
Sbjct: 134 SDTRHYDLNLPAIQASQLLVPLLAQNIDNIVRCHRDAKPRAELTCREGQCLSWAAEGKSA 193

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            EIA I+  S  TV  ++++  +K     R  AI  A+    +
Sbjct: 194 WEIAQIINTSERTVKFHLSNACKKLGATNRYQAITKAILGGYI 236


>gi|166850622|gb|ABY91283.1| transcriptional regulator [Mesorhizobium huakuii]
          Length = 243

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 37/238 (15%), Positives = 75/238 (31%), Gaps = 20/238 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQ---EQKLDSIVSSDWPF 84
              + + ++       +   ++  +T   G +  +            Q+   ++  DWP 
Sbjct: 6   RTLEYIDQLQHAGTAAAVCEKLLGITSDFGLTALMAGTVPQPGTPSGQQKQHVLLCDWPV 65

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFH-------------TLPENITPPAGMDNRYC 131
           + +          +  V+    +L  P                           + +   
Sbjct: 66  EWLERYVARNYVDHDPVVSHMKQLQAPFQWREAAQGISFDKSSDEVMGDAGAFKLRDGLA 125

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGK---DFELTG 188
                +    + + L   +   +       + L++ Y                   ELT 
Sbjct: 126 FPLITLDGQIVMVSL-GGEAVQLSGAEFGLVSLVSTYAVGRAMQIHTMATSTIDHIELTP 184

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE ECL W + GK+  EI+ ILGIS +T   ++ +   K     R  A+A A+R   +
Sbjct: 185 RERECLQWAAVGKSEWEISQILGISEHTSEKHLLNAKSKLGAVNRVQAVAEAIRRGYI 242


>gi|171316408|ref|ZP_02905627.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MEX-5]
 gi|171098441|gb|EDT43244.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MEX-5]
          Length = 237

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 36/225 (16%), Positives = 67/225 (29%), Gaps = 16/225 (7%)

Query: 37  IPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKD 96
                     +   A    +G  +            K   ++ S++P   V         
Sbjct: 13  ATAKSEADVFLEFTADVRALGFEYCSFGLRVPLPVSKPQFMLQSNYPQTWVDRYVSQNYF 72

Query: 97  KYYNVLQRPTELFCPVFHT--------LPENITPPAGMDNRYCSLTFDVARIRIGLMLLF 148
                ++       P+              +     G+ + +C  +         + ++ 
Sbjct: 73  AVDPTVRHGLSQMSPLIWRADSQTQSVEFWDEAEHHGLRHGWCMPSISRTGAIGLVTMVR 132

Query: 149 PKGRIILRDRLWE-------IGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGK 201
                I    L E       +  +A Y  +M            ELT RE E L W + GK
Sbjct: 133 SGEP-IDERELAEKGYQMSWLANMANYAMSMHLLAKFVPEYAVELTARERETLQWSAAGK 191

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T  EI  I+ +   TV  ++ + MRK     ++ A   A    ++
Sbjct: 192 TYAEIGKIMHVDDRTVKFHLVNAMRKLNATNKTEAAVKAAMLGLL 236


>gi|116873879|ref|YP_850660.1| DNA-binding response regulator [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|116742757|emb|CAK21881.1| DNA-binding response regulator [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 228

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 36/233 (15%), Positives = 72/233 (30%), Gaps = 20/233 (8%)

Query: 21  SFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSS 80
             V       + + R++ L+ +              G +    VR        +D  + +
Sbjct: 6   MIVDDHQLFREGIKRILELEDSFEVVAEAEN-----GKNIVAKVREYKPDIVLMDINMPT 60

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARI 140
               D    +                 +   +  T              Y     D   +
Sbjct: 61  VNGLDATEMLVRQ--------FPSIKVIVLTIHDTDEYVTEALRAGAVGYLLKEMDAQEL 112

Query: 141 RIGLMLLFPKGRIILRDRLWEIGLLAAYQAN-------MFKSYDVHWGKDFELTGREVEC 193
              + ++   G  I      ++     + A+                     LT RE E 
Sbjct: 113 VEAVKIVENGGAYIHPRVAIKLIREYRHLASTNTSQGVYGYQQPEVKMPLHILTHRECEV 172

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L  +++GK++  I   L IS  TV N+++SI++K     R+ A+  A+++  V
Sbjct: 173 LQLLTDGKSNRGIGETLFISEKTVKNHVSSILQKMKVNDRTQAVVTAIKHGWV 225


>gi|107025997|ref|YP_623508.1| LuxR family transcriptional regulator [Burkholderia cenocepacia AU
           1054]
 gi|116692818|ref|YP_838351.1| LuxR family transcriptional regulator [Burkholderia cenocepacia
           HI2424]
 gi|170737931|ref|YP_001779191.1| LuxR family transcriptional regulator [Burkholderia cenocepacia
           MC0-3]
 gi|105895371|gb|ABF78535.1| transcriptional regulator, LuxR family [Burkholderia cenocepacia AU
           1054]
 gi|116650818|gb|ABK11458.1| transcriptional regulator, LuxR family [Burkholderia cenocepacia
           HI2424]
 gi|169820119|gb|ACA94701.1| transcriptional regulator, LuxR family [Burkholderia cenocepacia
           MC0-3]
          Length = 239

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 77/235 (32%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       R+ A ++ +G  +            K    + + +P   
Sbjct: 3   LRWQDAYQQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFNTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI--------TPPAGMDNRYCSLTFDVA 138
           +         +  + ++        +     + I            G+       +   A
Sbjct: 63  MAHYQAQNYIEIDSTVRDGALSTNMIVWPDVDRIDPCPLWQDARDFGLSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       L+    + F    +       LT RE 
Sbjct: 122 RGAFGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPAAGVTLTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|83716915|ref|YP_439706.1| ATP-dependent transcription regulator LuxR [Burkholderia
           thailandensis E264]
 gi|167578146|ref|ZP_02371020.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis TXDOH]
 gi|167616276|ref|ZP_02384911.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis Bt4]
 gi|257142845|ref|ZP_05591107.1| ATP-dependent transcription regulator LuxR [Burkholderia
           thailandensis E264]
 gi|83650740|gb|ABC34804.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia thailandensis E264]
          Length = 239

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 75/235 (31%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       ++ A T+ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYLQFSAAENEQQLFQQIAAYTKRLGFEYCCYGIRVPLPISKPVVAIFDTYPNGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFH--------TLPENITPPAGMDNRYCSLTFDVA 138
           +         +    ++        +          T   +     G+       +   +
Sbjct: 63  MERYQEMNYLEVDPTVRDGALSSNMIVWPEASANDATTLWSDARDHGLAVGVAQ-SSWAS 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVH-------WGKDFELTGREV 191
           R   GL+ +      +    +  + L A + ANM  S                 LT RE 
Sbjct: 122 RGVFGLLTIARHTDRLTSAEINHLTLQANWLANMSHSLMSRFLVPKLAPESGVALTHRER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W  EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTGEGKTACEIGQILSISERTVNFHVNNILDKLGATNKVQAVVKAIAMGLI 236


>gi|323702109|ref|ZP_08113777.1| two component transcriptional regulator, LuxR family
           [Desulfotomaculum nigrificans DSM 574]
 gi|323532991|gb|EGB22862.1| two component transcriptional regulator, LuxR family
           [Desulfotomaculum nigrificans DSM 574]
          Length = 218

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 39/222 (17%), Positives = 75/222 (33%), Gaps = 13/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           L    D       L   +S   R+  + E   G       R        +D  +      
Sbjct: 7   LLIADDHALIREGLRKILSIEPRINVVGEVTDGQQAVEFCRQQPVDIVLMDINMPVMNGI 66

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +  R +  +          R   +   +               + Y        ++   +
Sbjct: 67  EACRLIKQNN--------PRVGIIALTIHDQDEYLFELIKYGISGYVLKDVHPDQLIQTI 118

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
           + +      I      ++      + +   S D H  K   LT RE+E L  +++G+++ 
Sbjct: 119 LGVARGESFIPPALTAKV----LAEFSRLTSVDHHDKKHSTLTERELEVLKQVAKGQSNK 174

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +IA  L IS  TV N++ +I +K     R+ A  YA++  +V
Sbjct: 175 DIAKTLFISEKTVKNHLTNIFQKIGVADRTQAALYAIKEKLV 216


>gi|172058475|ref|YP_001814935.1| two component LuxR family transcriptional regulator
           [Exiguobacterium sibiricum 255-15]
 gi|171990996|gb|ACB61918.1| two component transcriptional regulator, LuxR family
           [Exiguobacterium sibiricum 255-15]
          Length = 231

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 37/248 (14%), Positives = 75/248 (30%), Gaps = 30/248 (12%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVR 65
           +QV +V+  + +     V  +    +    +   +                GA    LV 
Sbjct: 4   EQVKVVIIDDHQLFREGVKRILDFEEEFVVVAEGES---------------GADVIPLVE 48

Query: 66  WDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
                   +D  +      +  + +          V      +   +       +     
Sbjct: 49  AHQPDIVLMDINMPKVNGVEATKRLME--------VHPEVRVIILSIHDDETYVMHALGA 100

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQA-------NMFKSYDV 178
               Y         +   +  ++ +G  +       +               +      V
Sbjct: 101 GAVGYLLKEMATDELVNAIRSVYREGGYVHPKVTPNLLQEYRRLMKMKQTMSSQPIEKRV 160

Query: 179 HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
                  LT RE E L  +++G ++  I+  L IS  TV N+++SI+RK     R+GA+ 
Sbjct: 161 AEAPLHVLTRRECEVLQLLADGFSNRAISDTLFISEKTVKNHVSSILRKMNVPDRTGAVV 220

Query: 239 YAVRNNIV 246
            A+R   V
Sbjct: 221 EAIRRGWV 228


>gi|14586756|gb|AAK70350.1|AF333005_1 N-acyl homoserine lactone transcriptional regulator [Burkholderia
           stabilis]
          Length = 239

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 75/235 (31%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
             R D   +    +       R+ A ++ +G  +            K    +   +P   
Sbjct: 3   LRRQDAYQQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPSVAIFDTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFH--------TLPENITPPAGMDNRYCSLTFDVA 138
           +         +  + ++        +                    G+       +   A
Sbjct: 63  MARYQAQNYIEIDSTVRDGALSTNMIVWPDVDRSDPGPLWQDAREFGLSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       L+    + F    +       LT RE 
Sbjct: 122 RGAFGLLSIARHADRLTPAEINILTLQTNWLASLSHSLMSRFMVPKLSPAAGVTLTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|315182540|gb|ADT89453.1| Transcriptional activator protein vanR [Vibrio furnissii NCTC
           11218]
          Length = 240

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 78/226 (34%), Gaps = 17/226 (7%)

Query: 37  IPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKD 96
             +    +    + AL   +   +FL            +++++ ++P    +    +   
Sbjct: 12  QVITSYENLETTLAALNNIIDHEYFLFGLSLQPTLTTSETLITDNYPASWRQQYDEAGFM 71

Query: 97  KYYNVLQRPTELFCPVFH----------TLPENITPPAGMDNRYCSLTFDVARIRIGLML 146
               ++Q     F P+                      G+   +      +      L  
Sbjct: 72  HVDPIVQYSMTNFLPIRWSQIPVASNQAHEMFEEARINGLKEGFSIPIHGLRGEFGMLSF 131

Query: 147 LFPKGR------IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEG 200
                R        ++     I LL+    N+ + +     +  ELT RE +CLTW +EG
Sbjct: 132 ATSDTRHYELNCDAIQTSQLIIPLLSHNIHNIARCHKDAAPR-IELTARENQCLTWAAEG 190

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           K++ EIA I+  S  TV  +IA+  +K     R  AI  A+    +
Sbjct: 191 KSAWEIAKIIDTSERTVKFHIANACKKLGATNRYQAITKAILGGYI 236


>gi|78061902|ref|YP_371810.1| LuxR family transcriptional regulator [Burkholderia sp. 383]
 gi|77969787|gb|ABB11166.1| transcriptional regulator, LuxR family [Burkholderia sp. 383]
          Length = 239

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 77/235 (32%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       R+ A ++ +G  +            K    + + +P   
Sbjct: 3   LRWQDAYQQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFNTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI--------TPPAGMDNRYCSLTFDVA 138
           +         +  + ++        +     + I            G+       +   A
Sbjct: 63  MAHYQAQNYIEIDSTVRDGALSTNMIVWPDVDRIEPCPLWQDARDYGLSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       L+    + F    +       LT RE 
Sbjct: 122 RGAFGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFVVPKLAPAAGVTLTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|73672744|gb|AAZ80478.1| PpuR [Pseudomonas putida]
          Length = 238

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 44/227 (19%), Positives = 76/227 (33%), Gaps = 14/227 (6%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           D L R+  ++    W   +  LT  +G S+FL+       +     ++ SD+P       
Sbjct: 7   DELLRLSEMERFEDWLAHLKILTRKLGYSNFLIGLKPAPTDANQQVLIYSDYPDAWRTRY 66

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTL----------PENITPPAGMDNRYCSLTFDVARI 140
                     V+Q       P+                      G+              
Sbjct: 67  DAESYAAVDPVVQHCLNANRPLLWDRDNYRRPSESEFFEEAAAHGLQQGLALPLHGPRGE 126

Query: 141 RIGLML----LFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTW 196
              L L      P+    + + L    LL  Y         +       LT RE E L W
Sbjct: 127 AGMLCLKPFESGPRATATMIESLPMATLLRDYAMEGMLKARIECSTPVHLTSREKEVLQW 186

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
            + GKT+ EI++IL  + + ++ +  +I RK    +R  A+  A++ 
Sbjct: 187 SAAGKTTWEISMILSCTTSAIDFHFKNIRRKFQVSSRQMAVLKAIQQ 233


>gi|269126536|ref|YP_003299906.1| LuxR family two component transcriptional regulator
           [Thermomonospora curvata DSM 43183]
 gi|268311494|gb|ACY97868.1| two component transcriptional regulator, LuxR family
           [Thermomonospora curvata DSM 43183]
          Length = 226

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 35/227 (15%), Positives = 71/227 (31%), Gaps = 11/227 (4%)

Query: 19  RTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIV 78
           R   V   P        ++  +  ++            GA+   L R  L     +D  +
Sbjct: 4   RVLLVDDQPLLRTGFKLILEAESDLTVVGEAG-----DGATAVELTRTMLPDVVLMDIRM 58

Query: 79  SSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVA 138
                 +  R +       +   +   T      F      I       + +        
Sbjct: 59  PGMDGIEATRRIVREGAAAHDPRVLILTT-----FDLDEYVIEAVRAGASGFLLKDAPPE 113

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWIS 198
            +   + ++     I+       +    A +    +      G +  LT RE E L  ++
Sbjct: 114 DLVSAIRIVAAGDAIVAPSVTRRLLDKFASRLPSMRQTPPPPGLET-LTEREREVLKHVA 172

Query: 199 EGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
            G ++ EIA  L +S  TV  ++ +++ K   + R  A+ YA    +
Sbjct: 173 RGLSNAEIARELVVSETTVKTHVGNVLAKLGLRDRVQAVVYAYETGM 219


>gi|289641016|ref|ZP_06473185.1| two component transcriptional regulator, LuxR family [Frankia
           symbiont of Datisca glomerata]
 gi|289509136|gb|EFD30066.1| two component transcriptional regulator, LuxR family [Frankia
           symbiont of Datisca glomerata]
          Length = 234

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 36/234 (15%), Positives = 74/234 (31%), Gaps = 15/234 (6%)

Query: 13  NREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQ 72
           +  D  R   V         L  ++  +  +             G+    +         
Sbjct: 13  SSPDPIRVLVVDDHALFRRGLQMVLEQEKDIEVVGEA-----PDGSEAVTMAVDTAPDIV 67

Query: 73  KLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCS 132
            +D  +      D    +           +     +   +     +           Y  
Sbjct: 68  LMDVRMPRRGGIDATSAIKQ--------AVPSAKIVMLTISDEEGDLYDAIKAGAMGYLL 119

Query: 133 LTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVE 192
               +  +   +  +     +I      ++  L+ +   + K+          LT RE+E
Sbjct: 120 KEISIDEVATAIRAVHGGQSLISPSMASKL--LSEFALMIKKADSRPQLPTPRLTDREME 177

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            L  +++G  + +IA  L IS NTV N+I +I+ K    +R  A+ YAVR  ++
Sbjct: 178 VLRLVAKGLNNRDIAKQLFISENTVKNHIRNILEKLQLHSRMEAVVYAVREKLL 231


>gi|304317230|ref|YP_003852375.1| LuxR family transcriptional regulator [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778732|gb|ADL69291.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 210

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 38/220 (17%), Positives = 75/220 (34%), Gaps = 21/220 (9%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D +     L   +     M  + +   G   + + +        +D  + +    
Sbjct: 4   ILIADDHVLLRQGLKQIIELEEDMKVIYQASDGEEAYEIAKKISPDIILMDINMPNINGI 63

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
              + +                 +F  +++     +         Y     D   +   +
Sbjct: 64  KAAKMLKNDNPKN--------KIMFLTIYNDKEYLMEALKIGVEGYILKDADSDELIKAI 115

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
             +   G  I                +  ++ D    K  ELT RE++ L+ I+EG ++ 
Sbjct: 116 RTISNGGVYIHPS-----------LVSEIENLDTDECKK-ELTDREMQILSLIAEGYSNK 163

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EIA  L +S  TV N++ +I RK   K R+ A  Y ++NN
Sbjct: 164 EIADKLFLSEKTVKNHVYNIFRKLDVKDRTQAAIYLLKNN 203


>gi|166798330|gb|ABY89693.1| transcriptional regulator [Mesorhizobium loti]
          Length = 243

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 38/238 (15%), Positives = 77/238 (32%), Gaps = 20/238 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQ---EQKLDSIVSSDWPF 84
              + + ++       +   R+  +T   G +  +            Q+   ++  DWP 
Sbjct: 6   RTLEFIDQLQHAATAAAVCERLLGITADFGLTALMAGTVPQPGTPAGQQKQHVLLCDWPG 65

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLP-------------ENITPPAGMDNRYC 131
           + +          +  V+    +L  P                           + +   
Sbjct: 66  EWLERYVARNYVDHDPVVSHMKQLQAPFQWREASQSIRIDKSSGEVMGDAGAFKLRDGLA 125

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE---LTG 188
                +    + + L   +   +      ++ L++ Y             K  +   LT 
Sbjct: 126 FPLVTLDGQIVMVSL-GGEAVELSAAEFGQVSLVSTYAVGRAMQLHTMASKSIDHIVLTP 184

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE ECL W + GK+  EI+ ILGIS +T   ++ +   K     R  A+A A+R   +
Sbjct: 185 RERECLQWAAVGKSEWEISQILGISEHTSEKHLLNAKSKLGAVNRVQAVAEAIRRGYI 242


>gi|26417542|gb|AAM75413.1| transcriptional regulator PpuR [Pseudomonas putida]
          Length = 238

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 44/227 (19%), Positives = 76/227 (33%), Gaps = 14/227 (6%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           D L R+  ++    W   +  LT  +G S+FL+       +     ++ SD+P       
Sbjct: 7   DELLRLSEMERFEDWLAHLKILTRKLGYSNFLIGLKPAPTDANQQVLIYSDYPDAWRTRY 66

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTL----------PENITPPAGMDNRYCSLTFDVARI 140
                     V+Q       P+                      G+              
Sbjct: 67  DAESYAAVDPVVQHCLNANRPLLWDRDNYRRPSESEFFEEAAAHGLQQGLALPLHGPRGE 126

Query: 141 RIGLML----LFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTW 196
              L L      P+    + + L    LL  Y         +       LT RE E L W
Sbjct: 127 AGMLCLKPSESGPRATATMIESLPMATLLRDYAMEGMLKARIECSTPVHLTSREKEVLQW 186

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
            + GKT+ EI++IL  + + ++ +  +I RK    +R  A+  A++ 
Sbjct: 187 SAAGKTTWEISMILSCTTSAIDFHFKNIRRKFQVSSRQMAVLKAIQQ 233


>gi|226314987|ref|YP_002774883.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
 gi|226097937|dbj|BAH46379.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
          Length = 235

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 36/260 (13%), Positives = 78/260 (30%), Gaps = 41/260 (15%)

Query: 1   MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASH 60
           M+   Q++ IV+  + +     V  +    +    +                    G   
Sbjct: 1   MDKRQQELRIVIVDDHQLFREGVKRILEMEEDFKVVGEGAD---------------GGEA 45

Query: 61  FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI 120
            +L          +D  + +          A           +    +   +        
Sbjct: 46  TVLAEEHKPDVLLMDINMPNINGVS-----AAENVISVSPSTR---VIMLSIHDDEGYVY 97

Query: 121 TPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW 180
                  + Y       + +   + ++   G  I      ++      +       +   
Sbjct: 98  RTLRAGASGYLLKEMGTSDLVDAVRVVASGGAYIHPKVTGKL----IEEFRRLSEQEGTA 153

Query: 181 GKDFE--------------LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMR 226
            + F               LT RE E L  ++EGK++  I   L IS  TV N+++SI++
Sbjct: 154 ERSFSVDESQAIDPKVIESLTRREREVLQLMAEGKSNRAIGEFLFISEKTVKNHVSSILQ 213

Query: 227 KTATKTRSGAIAYAVRNNIV 246
           K   + R+ A+  +++N  V
Sbjct: 214 KLNVQDRTQAVVISIKNGWV 233


>gi|229062451|ref|ZP_04199766.1| DNA-binding response regulator [Bacillus cereus AH603]
 gi|228716840|gb|EEL68528.1| DNA-binding response regulator [Bacillus cereus AH603]
          Length = 186

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 39/199 (19%), Positives = 68/199 (34%), Gaps = 17/199 (8%)

Query: 49  MYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTE 107
           M  + E V G      V         +D  +      +    +   +             
Sbjct: 1   MRVVGEAVSGDEVVKKVEECRPDCILMDINLPGKNGIEATS-LVKDQYPS-------CRV 52

Query: 108 LFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAA 167
           L   ++      +       + Y        ++   + ++     +I      ++     
Sbjct: 53  LVLTMYEHDEYLMAALRAGADGYLLKDSSSDQVVAAIRMVLQGDSVIHPRMTKKLIT--- 109

Query: 168 YQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRK 227
                +         + ELT RE E L  +++G ++ EIA  L IS  TV  +I  I RK
Sbjct: 110 -----YHQQTKSESNENELTEREKEILFELAKGLSNKEIAEALYISDKTVKIHINKIFRK 164

Query: 228 TATKTRSGAIAYAVRNNIV 246
              K+RS A+ YAVRN +V
Sbjct: 165 LNVKSRSQAVIYAVRNQLV 183


>gi|315654640|ref|ZP_07907546.1| two component system response regulator [Mobiluncus curtisii ATCC
           51333]
 gi|315491104|gb|EFU80723.1| two component system response regulator [Mobiluncus curtisii ATCC
           51333]
          Length = 254

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 34/246 (13%), Positives = 70/246 (28%), Gaps = 28/246 (11%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVR 65
           + + ++L  +          +   +D +  +       +    + A +            
Sbjct: 30  EAIKVLLVDDQSLIRMGFRMVLEAADDITVVGEAADGKTALQMVKATS------------ 77

Query: 66  WDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
                   +D  +      +    +     +           L    F            
Sbjct: 78  ---PDVVLMDVRMPHMNGIEATSEIITGNPN--------VKVLILTTFDLDEYAFAALRA 126

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRL-WEIGLLAAYQANMFKSYDVHWGKD- 183
             + +         +   +  +      I        + + A          +     D 
Sbjct: 127 GASGFLLKDAKPEELIGAIRNVAHGDATISPRVTKRMLEMFAPQLPGEQDEAEETNLVDK 186

Query: 184 ---FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
                LT RE E LT I++G T+ EIA  L IS  TV  ++ +I+ K   + R  A+ +A
Sbjct: 187 ALLDSLTDRETEVLTLIAQGLTNQEIATQLFISMTTVKTHVGNILNKIGARDRVQAVIFA 246

Query: 241 VRNNIV 246
             N +V
Sbjct: 247 YENGLV 252


>gi|260551305|ref|ZP_05825506.1| transcriptional activator protein phzR [Acinetobacter sp. RUH2624]
 gi|260405619|gb|EEW99110.1| transcriptional activator protein phzR [Acinetobacter sp. RUH2624]
          Length = 238

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 78/235 (33%), Gaps = 18/235 (7%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           + DLL+  + +         + +    +G  +            +  +I+ +++P    +
Sbjct: 5   QEDLLSAFLVVKNEDELFEVVKSTASKLGFDYCAYGMQSPLSIAEPKTIMLNNYPQAWQK 64

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHT----------LPENITPPAGMDNRYCSLTFDVA 138
                   K    +Q       P+  +                   G++  +   + D  
Sbjct: 65  RYIEQRYVKVDPTVQHCMVSLQPLVWSSQNAKTQEEKDFWEEARSYGLNVGWAQSSRDFI 124

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-------LTGREV 191
             R  L L     + +             +      S       D E       LT RE 
Sbjct: 125 GTRGMLTLARSTDQ-LSEKEQKAQYTNMYWLTQTLHSSIAKIVNDVEFSQFNLYLTNREK 183

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKTS EIA I+G++  TVN ++ + M+K     +  A   AV   ++
Sbjct: 184 EALRWTAEGKTSAEIAQIIGVTERTVNFHLCNSMQKLNVNNKISAAIRAVMLGLL 238


>gi|161520519|ref|YP_001583946.1| LuxR family transcriptional regulator [Burkholderia multivorans
           ATCC 17616]
 gi|189353291|ref|YP_001948918.1| LuxR family transcriptional regulator [Burkholderia multivorans
           ATCC 17616]
 gi|221209754|ref|ZP_03582735.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           multivorans CGD1]
 gi|160344569|gb|ABX17654.1| transcriptional regulator, LuxR family [Burkholderia multivorans
           ATCC 17616]
 gi|189337313|dbj|BAG46382.1| LuxR family transcriptional regulator [Burkholderia multivorans
           ATCC 17616]
 gi|221170442|gb|EEE02908.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           multivorans CGD1]
          Length = 239

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 75/235 (31%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D        +       R+ A ++ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYDEFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI--------TPPAGMDNRYCSLTFDVA 138
           +         +  + ++        +     + I            G+       +   A
Sbjct: 63  MAHYQAQNYIEIDSTVRDGALSTNMIVWPDVDKIEPCPLWRDARDFGLSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       L+    + F    +       LT RE 
Sbjct: 122 RGAFGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPEARVALTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILCISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|163758577|ref|ZP_02165664.1| probable transcriptional regulator protein, LuxR family [Hoeflea
           phototrophica DFL-43]
 gi|162283867|gb|EDQ34151.1| probable transcriptional regulator protein, LuxR family [Hoeflea
           phototrophica DFL-43]
          Length = 237

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 80/233 (34%), Gaps = 17/233 (7%)

Query: 30  SDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDL-FQEQKLDSIVSSDWPFDLVR 88
            DL  R+          + + ALT       F +      F ++    I  S+ P + + 
Sbjct: 5   EDLFQRLKTATTEHELAVSLQALTSEFDFRFFSIFDIPATFSDRLSKHIRLSNLPSEYIE 64

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLPENITPP--------------AGMDNRYCSLT 134
                      +V     +   P+   L   +                   M        
Sbjct: 65  EYDSLNLLSNSSVFAMLRQSTAPMTRFLDLAVKERPTEEQQVMRAVFEKHNMTMGVYFPV 124

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWG-KDFELTGREVEC 193
                 R  +   +     +       +GL   +  + +       G K   +T RE+E 
Sbjct: 125 HGSNGRRAAMAF-YGTRPALSFAETGVLGLCVLHAFDAYSKMTNKTGTKANGITTRELEV 183

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GKTS EIA IL +S +TVN Y+ S MRK     R+  +A A+R +++
Sbjct: 184 LHWAANGKTSTEIAAILSLSDHTVNTYMNSAMRKLDCVNRTQLVAKALRLHLI 236


>gi|53717160|ref|YP_105961.1| N-acyl homoserine lactone transcriptional regulator [Burkholderia
           mallei ATCC 23344]
 gi|53721911|ref|YP_110896.1| N-acylhomoserine lactone dependent regulatory protein [Burkholderia
           pseudomallei K96243]
 gi|67643283|ref|ZP_00442030.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei GB8 horse 4]
 gi|76818142|ref|YP_337635.1| BpsR [Burkholderia pseudomallei 1710b]
 gi|121598108|ref|YP_989940.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei SAVP1]
 gi|124382764|ref|YP_001024423.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei NCTC 10229]
 gi|126442328|ref|YP_001062292.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 668]
 gi|126445689|ref|YP_001078154.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei NCTC 10247]
 gi|126458533|ref|YP_001075258.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 1106a]
 gi|134278985|ref|ZP_01765698.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 305]
 gi|167000171|ref|ZP_02265991.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei PRL-20]
 gi|167723232|ref|ZP_02406468.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei DM98]
 gi|167742204|ref|ZP_02414978.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 14]
 gi|167819378|ref|ZP_02451058.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 91]
 gi|167827752|ref|ZP_02459223.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 9]
 gi|167849226|ref|ZP_02474734.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei B7210]
 gi|167906168|ref|ZP_02493373.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei NCTC 13177]
 gi|167914491|ref|ZP_02501582.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 112]
 gi|167922390|ref|ZP_02509481.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei BCC215]
 gi|217418339|ref|ZP_03449846.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 576]
 gi|226197543|ref|ZP_03793118.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei Pakistan 9]
 gi|237507418|ref|ZP_04520133.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei MSHR346]
 gi|242313785|ref|ZP_04812802.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 1106b]
 gi|254174155|ref|ZP_04880817.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei ATCC 10399]
 gi|254183341|ref|ZP_04889933.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 1655]
 gi|254193094|ref|ZP_04899529.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei S13]
 gi|254200806|ref|ZP_04907171.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei FMH]
 gi|254204776|ref|ZP_04911129.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei JHU]
 gi|254263057|ref|ZP_04953922.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 1710a]
 gi|254300240|ref|ZP_04967686.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 406e]
 gi|254357025|ref|ZP_04973300.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei 2002721280]
 gi|37223137|gb|AAQ90167.1| transcriptional activator [Burkholderia pseudomallei]
 gi|40646736|gb|AAR88244.1| BpsR [Burkholderia pseudomallei]
 gi|43469096|gb|AAS46624.1| BpsR [Burkholderia pseudomallei]
 gi|52212325|emb|CAH38349.1| N-acylhomoserine lactone dependent regulatory protein [Burkholderia
           pseudomallei K96243]
 gi|52423130|gb|AAU46700.1| N-acyl homoserine lactone transcriptional regulator [Burkholderia
           mallei ATCC 23344]
 gi|76582615|gb|ABA52089.1| BpsR [Burkholderia pseudomallei 1710b]
 gi|121225906|gb|ABM49437.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei SAVP1]
 gi|124290784|gb|ABN00054.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei NCTC 10229]
 gi|126221819|gb|ABN85324.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 668]
 gi|126232301|gb|ABN95714.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 1106a]
 gi|126238543|gb|ABO01655.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei NCTC 10247]
 gi|134249404|gb|EBA49485.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 305]
 gi|147748418|gb|EDK55493.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei FMH]
 gi|147754362|gb|EDK61426.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei JHU]
 gi|148026052|gb|EDK84175.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei 2002721280]
 gi|157809975|gb|EDO87145.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 406e]
 gi|160695201|gb|EDP85171.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei ATCC 10399]
 gi|169649848|gb|EDS82541.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei S13]
 gi|184213874|gb|EDU10917.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 1655]
 gi|217397643|gb|EEC37658.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 576]
 gi|225930152|gb|EEH26164.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei Pakistan 9]
 gi|234999623|gb|EEP49047.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei MSHR346]
 gi|238524594|gb|EEP88026.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei GB8 horse 4]
 gi|242137024|gb|EES23427.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 1106b]
 gi|243063823|gb|EES46009.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           mallei PRL-20]
 gi|254214059|gb|EET03444.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 1710a]
          Length = 239

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 75/235 (31%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       ++ A T+ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYLQFSAAENEQQLFQQIAAYTKRLGFEYCCYGIRVPLPISKPVVAIFDTYPNGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFH--------TLPENITPPAGMDNRYCSLTFDVA 138
           +         +    ++        +          T   +     G+       +   +
Sbjct: 63  MERYQEMNYLEVDPTVREGALSSNMIVWPEASASDATTLWSDARDHGLAVGVAQ-SSWAS 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVH-------WGKDFELTGREV 191
           R   GL+ +      +    +  + L A + ANM  S                 LT RE 
Sbjct: 122 RGVFGLLTIARHTDRLTSAEINHLTLQANWLANMSHSLMSRFLVPKLAPESGVALTHRER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W  EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTGEGKTACEIGQILSISERTVNFHVNNILDKLGATNKVQAVVKAIAMGLI 236


>gi|260461917|ref|ZP_05810162.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|259032164|gb|EEW33430.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
          Length = 243

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 38/238 (15%), Positives = 76/238 (31%), Gaps = 20/238 (8%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQ---EQKLDSIVSSDWPF 84
              + + ++       +   ++  +T   G +  +            Q+   ++  DWP 
Sbjct: 6   RTLEYIDQLQHAGTAAAVCEKLLGITSDFGLTALMAGTVPQPGTPAGQQKQHVLLCDWPV 65

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLP-------------ENITPPAGMDNRYC 131
           + +          +  V+    +L  P                           + +   
Sbjct: 66  EWLERYVARNYVDHDPVVSHMKQLQAPFQWREAAQDIRIDKSSGEVMGDAGAFKLRDGLA 125

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWG---KDFELTG 188
                +    + + L   +   +       + L++ Y            G      ELT 
Sbjct: 126 FPLITLDGQIVMVSL-GGEAVELSAAEFGLVSLVSTYAVGRAMQLHTMSGNTIDHVELTP 184

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE ECL W + GK+  EI+ ILGIS +T   ++ +   K     R  A+A A+R   +
Sbjct: 185 RERECLQWAAVGKSEWEISQILGISEHTSEKHLLNAKSKLGAVNRVQAVAEAIRRGYI 242


>gi|12620901|gb|AAG61130.1|AF330019_1 AHL receptor [Burkholderia multivorans]
          Length = 239

 Score =  142 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 38/234 (16%), Positives = 75/234 (32%), Gaps = 14/234 (5%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D        +       R+ A ++ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYDEFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT-------PPAGMDNRYCSLTFDVAR 139
           +         +  + ++        +     + I              +   + +   AR
Sbjct: 63  MTHYQAQNYIEIDSTVRDGALSTNMIVWPDVDKIEPCPLWRDARDFGPSVGVAQSSWAAR 122

Query: 140 IRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREVE 192
              GL+ +      +    +  + L       L+    + F    +       LT RE E
Sbjct: 123 GAFGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFVVPKLSPEARVALTARERE 182

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 183 VLCWTAEGKTACEIGQILCISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|59940041|gb|AAX12559.1| LuxR-type transcriptional regulator [Aeromonas eucrenophila]
          Length = 260

 Score =  142 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 48/231 (20%), Positives = 78/231 (33%), Gaps = 20/231 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + L  +  +         +   T  +G  ++          Q+  + V   +P   V+  
Sbjct: 8   EYLEHLTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPRAEVFMQYPDPWVQAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENIT--------------PPAGMDNRYCSLTFD 136
             +       ++Q   +   P++    E                    G+ N        
Sbjct: 68  TANHMLACDPIIQLARKQTLPIYWNRLEGRARFLQEGSLDVMGLAAEFGLRNGISFPLHG 127

Query: 137 VARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVH----WGKDFELTGRE 190
            A     L  +  +     +L +    +  ++ Y                     LT RE
Sbjct: 128 AAGENGILSFITSERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREHDPHEALTDRE 187

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
            ECL W SEGKTS EIA ILGI+  TVN ++  + RKT +  R  AIA  V
Sbjct: 188 TECLFWASEGKTSGEIACILGITERTVNYHLNQVTRKTGSMNRYHAIAKGV 238


>gi|138896712|ref|YP_001127165.1| two-component response regulator [Geobacillus thermodenitrificans
           NG80-2]
 gi|196249414|ref|ZP_03148112.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. G11MC16]
 gi|134268225|gb|ABO68420.1| Two-component response regulator [Geobacillus thermodenitrificans
           NG80-2]
 gi|196211171|gb|EDY05932.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. G11MC16]
          Length = 225

 Score =  142 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 35/232 (15%), Positives = 73/232 (31%), Gaps = 17/232 (7%)

Query: 19  RTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIV 78
           R + +       + + R++  D                G     +V         +D  +
Sbjct: 4   RIAIIDDHQLFREGIKRILEFDGDFEVVAE-----GSDGREALSIVEEHRPDLVLMDINM 58

Query: 79  SSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVA 138
                 +  + +  +  D           +   +       +         Y     D  
Sbjct: 59  PDTNGVEATKQLIETYPD--------TKVVVLSIHDDENYVMRALQTGATGYLLKEMDAD 110

Query: 139 RIRIGLMLLFPKGRIILR----DRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECL 194
            +   + ++   G  +      + + E   L     +              LT RE E L
Sbjct: 111 TLIEAVRIVAEGGSYLHPKVTHNLIREYRRLTTETNSNVMVQQEVRRPLHLLTRRECEVL 170

Query: 195 TWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
             +++GK++  I   L IS  TV N+++SI++K     R+ A+  A++N  V
Sbjct: 171 QLLADGKSNRAIGETLYISEKTVKNHVSSILQKLNVNDRTQAVVVAIKNGWV 222


>gi|327441352|dbj|BAK17717.1| response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Solibacillus silvestris StLB046]
          Length = 224

 Score =  142 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 34/243 (13%), Positives = 70/243 (28%), Gaps = 27/243 (11%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
             I++  + +     V  +    D    +   D                      L   +
Sbjct: 2   TKIIIVDDHQLFREGVKRILDFEDTFEVVAEGDDGTDIVN---------------LYEQN 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +    +          V      +   +               
Sbjct: 47  EPDVVLMDINMPGKNGVEATADLLA--------VYPDAKVMVLSIHDDESYVTHALKSGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYD---VHWGKDF 184
             Y     D   I   + ++   G  +       +       +      +       + F
Sbjct: 99  LGYMLKEMDADEIVEAIKVVSNGGSYLHPKVTKNLVAEFRRLSEHENKGNFHQTEIRRPF 158

Query: 185 EL-TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
            L T RE E L  +++G+++  I   L IS  TV N+++SI++K     R+ A+  A++N
Sbjct: 159 HLLTKRECEVLQLLTDGQSNRTIGETLFISEKTVKNHVSSILQKMNVNDRTQAVVTAIKN 218

Query: 244 NIV 246
             V
Sbjct: 219 GWV 221


>gi|298346055|ref|YP_003718742.1| LuxR family response regulator [Mobiluncus curtisii ATCC 43063]
 gi|315657448|ref|ZP_07910330.1| exopolyphosphatase [Mobiluncus curtisii subsp. holmesii ATCC 35242]
 gi|298236116|gb|ADI67248.1| LuxR family response regulator [Mobiluncus curtisii ATCC 43063]
 gi|315491920|gb|EFU81529.1| exopolyphosphatase [Mobiluncus curtisii subsp. holmesii ATCC 35242]
          Length = 248

 Score =  142 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 34/246 (13%), Positives = 70/246 (28%), Gaps = 28/246 (11%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVR 65
           + + ++L  +          +   +D +  +       +    + A +            
Sbjct: 24  EAIKVLLVDDQSLIRMGFRMVLEAADDITVVGEAADGKTALQMVKATS------------ 71

Query: 66  WDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
                   +D  +      +    +     +           L    F            
Sbjct: 72  ---PDVVLMDVRMPHMNGIEATSEIITGNPN--------VKVLILTTFDLDEYAFAALRA 120

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRL-WEIGLLAAYQANMFKSYDVHWGKD- 183
             + +         +   +  +      I        + + A          +     D 
Sbjct: 121 GASGFLLKDAKPEELIGAIRNVAHGDATISPRVTKRMLEMFAPQLPGEQDEVEEANLVDK 180

Query: 184 ---FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
                LT RE E LT I++G T+ EIA  L IS  TV  ++ +I+ K   + R  A+ +A
Sbjct: 181 ALLDSLTDRETEVLTLIAQGLTNQEIATQLFISMTTVKTHVGNILNKIGARDRVQAVIFA 240

Query: 241 VRNNIV 246
             N +V
Sbjct: 241 YENGLV 246


>gi|134299954|ref|YP_001113450.1| two component LuxR family transcriptional regulator
           [Desulfotomaculum reducens MI-1]
 gi|134052654|gb|ABO50625.1| two component transcriptional regulator, LuxR family
           [Desulfotomaculum reducens MI-1]
          Length = 218

 Score =  142 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 35/222 (15%), Positives = 70/222 (31%), Gaps = 13/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           L    D +     L   +S    +  + E   G         +      +D  +      
Sbjct: 7   LLIADDHILIREGLRKILSIEPHISVVGEVTNGQQAVDYCLKNPVDIVLMDINMPIMNGI 66

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +  R +     +           +   +               + Y        ++   +
Sbjct: 67  EACRQIKKLNPNIG--------IIALTIHDQDEYLFELIKYGISGYVLKDIHPDQLIKTI 118

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
           + +      I       +      +     S D    K   LT RE+E L  +++G+++ 
Sbjct: 119 LGVAQGESFIPPSLTARV----LAEFTRLSSGDYSEKKHLNLTEREIEVLKQVAKGQSNK 174

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            IA  L IS  TV N++ +I +K     R+ A  YA++  +V
Sbjct: 175 AIANALYISEKTVKNHLTNIFQKIGVADRTQAALYAIKEKLV 216


>gi|229087315|ref|ZP_04219457.1| DNA-binding response regulator [Bacillus cereus Rock3-44]
 gi|228696017|gb|EEL48860.1| DNA-binding response regulator [Bacillus cereus Rock3-44]
          Length = 186

 Score =  142 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 39/199 (19%), Positives = 67/199 (33%), Gaps = 17/199 (8%)

Query: 49  MYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTE 107
           M  + E V G      V         +D  +      +    +     +           
Sbjct: 1   MRVVGEAVSGDEVVKKVEECRPDCILMDINLPGKNGIEATSLVKGQYPN--------CRV 52

Query: 108 LFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAA 167
           L   ++      +       + Y        ++   + ++     +I      ++     
Sbjct: 53  LVLTMYEHDEYLMAALRAGADGYLLKDSSSEQVVAAIRMVLQGDSVIHPRMTKKLIT--- 109

Query: 168 YQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRK 227
                +         + ELT RE E L  + +G ++ EIA  L IS  TV  +I  I RK
Sbjct: 110 -----YHQQTKSESNENELTEREKEILFELVKGLSNKEIAEALYISDKTVKIHINKIFRK 164

Query: 228 TATKTRSGAIAYAVRNNIV 246
              K+RS A+ YAVRN +V
Sbjct: 165 LNVKSRSQAVIYAVRNQLV 183


>gi|262281348|ref|ZP_06059129.1| transcriptional activator protein phzR [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257174|gb|EEY75911.1| transcriptional activator protein phzR [Acinetobacter calcoaceticus
           RUH2202]
          Length = 238

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 41/234 (17%), Positives = 83/234 (35%), Gaps = 16/234 (6%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           + DLL+  + +         + +    +G  +            +  +I+ +++P    +
Sbjct: 5   QEDLLSASLMVKNEYQLFEVVKSTALKLGFDYCAYGMQAPLSIAEPKTIMLNNYPEAWQK 64

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHT----------LPENITPPAGMDNRYCSLTFDVA 138
                +       +Q       P+  +                   G++  +   + D  
Sbjct: 65  RYVKQQYVVVDPTVQHCMLSLQPLVWSSQSANTQSQKDFWEEARSYGLNVGWAQSSRDFI 124

Query: 139 RIRIGLMLLFPKGRIILRDRLWE---IGLLAAYQANMFKSYDVHWGK---DFELTGREVE 192
             R  L L     ++  +++  +   +  L+    +              +  LT RE E
Sbjct: 125 GTRGMLTLARSTDQLSEKEQKAQYTNMYWLSQTVHSSIAKIVNDAEFAQFNLYLTNREKE 184

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            L W +EGKTS EIA ILG++  TVN ++ + M+K     +  A   AV   I+
Sbjct: 185 VLRWTAEGKTSAEIAQILGVTERTVNFHLCNSMQKLNVNNKISAAIRAVMLGIL 238


>gi|167897824|ref|ZP_02485226.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           pseudomallei 7894]
          Length = 239

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 75/235 (31%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       ++ A T+ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYLQFSAAENEQQLFQQIAAYTKRLGFEYCCYGIRVPLPISKPVVAIFDTYPNGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFH--------TLPENITPPAGMDNRYCSLTFDVA 138
           +         +    ++        +          T   +     G+       +   +
Sbjct: 63  MERYEEMNYLEVDPTVREGALSSNMIVWPEASASDATTLWSDARDHGLAVGVAQ-SSWAS 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVH-------WGKDFELTGREV 191
           R   GL+ +      +    +  + L A + ANM  S                 LT RE 
Sbjct: 122 RGVFGLLTIARHTDRLTSAEINHLTLQANWLANMSHSLMSRFLVPKLAPESGVALTHRER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W  EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTGEGKTACEIGQILSISERTVNFHVNNILDKLGATNKVQAVVKAIAMGLI 236


>gi|12620903|gb|AAG61131.1|AF330020_1 AHL receptor [Burkholderia cepacia]
          Length = 239

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 77/235 (32%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       R+ A ++ +G  +            K    + + +P   
Sbjct: 3   LRWQDAYQQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFNTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI--------TPPAGMDNRYCSLTFDVA 138
           +         +  + ++        +     + I            G+       +   A
Sbjct: 63  MAHYQARNYIEIDSTVRDGALSTNMIVWPDVDRIDPCPLWQDARDFGLSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       L+    + F    +       LT RE 
Sbjct: 122 RGAFGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPAAGVTLTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|229163761|ref|ZP_04291706.1| DNA-binding response regulator [Bacillus cereus R309803]
 gi|228619728|gb|EEK76609.1| DNA-binding response regulator [Bacillus cereus R309803]
          Length = 186

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 39/199 (19%), Positives = 68/199 (34%), Gaps = 17/199 (8%)

Query: 49  MYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTE 107
           M  + E V G      V         +D  +      +    +     +           
Sbjct: 1   MRVVGEAVSGDEVVKKVEECKPDCILMDINLPGKNGIEATTLVKNQYPN--------CRV 52

Query: 108 LFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAA 167
           L   ++      ++      + Y        ++   + ++     +I      ++     
Sbjct: 53  LVLTMYEHDEYLMSALRAGADGYLLKDSSSEQVVAAIRMVLQGDSVIHPRMTKKLIT--- 109

Query: 168 YQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRK 227
                +         + ELT RE E L  + +G ++ EIA  L IS  TV  +I  I RK
Sbjct: 110 -----YHQQTKLESNENELTEREKEILFELVKGLSNKEIAEALYISDKTVKIHINKIFRK 164

Query: 228 TATKTRSGAIAYAVRNNIV 246
              K+RS A+ YAVRN +V
Sbjct: 165 LNVKSRSQAVIYAVRNQLV 183


>gi|319650652|ref|ZP_08004792.1| two-component system response regulator [Bacillus sp. 2_A_57_CT2]
 gi|317397833|gb|EFV78531.1| two-component system response regulator [Bacillus sp. 2_A_57_CT2]
          Length = 228

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 36/225 (16%), Positives = 72/225 (32%), Gaps = 16/225 (7%)

Query: 30  SDLLARMIPLDCTVSWTMRMYALTE-YVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
            D       +   + +      + E   GA    LV         +D  + +    +  R
Sbjct: 9   DDHQLFREGVKRILDFERSFDVVAEGDDGAEAISLVEEYNPDVVIMDINMPNVNGVEATR 68

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLF 148
            +     D           +   +               + Y     D   +   + ++ 
Sbjct: 69  QLIEKHPD--------SKVIILSIHDDENYVTHALKTGASGYLLKEMDADALVEAVKVVA 120

Query: 149 PKGRIILRDRL-------WEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGK 201
             G  +              +  + A  +  + S          LT RE E L  +++GK
Sbjct: 121 DGGSYLHPKVTHNLVNEYRRLSAVGAGSSGGYSSQIEIRRPLHLLTRRECEVLQLLADGK 180

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++  I   L IS  TV N++++I++K     R+ A+  A++N  V
Sbjct: 181 SNRGIGEALYISEKTVKNHVSNILQKMNVNDRTQAVVVAIKNGWV 225


>gi|304390186|ref|ZP_07372140.1| two component system response regulator [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|304326668|gb|EFL93912.1| two component system response regulator [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
          Length = 248

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 34/246 (13%), Positives = 70/246 (28%), Gaps = 28/246 (11%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVR 65
           + + ++L  +          +   +D +  +       +    + A +            
Sbjct: 24  EAIKVLLVDDQSLIRMGFRMVLEAADDITVVGEAADGKTALQMVKATS------------ 71

Query: 66  WDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
                   +D  +      +    +     +           L    F            
Sbjct: 72  ---PDVVLMDVRMPHMNGIEATSEIITGNPN--------VKVLILTTFDLDEYAFAALRA 120

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRL-WEIGLLAAYQANMFKSYDVHWGKD- 183
             + +         +   +  +      I        + + A          +     D 
Sbjct: 121 GASGFLLKDAKPEELIGAIRNVAHGDATISPRVTKRMLEMFAPQLPGEQDEAEEANLVDK 180

Query: 184 ---FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
                LT RE E LT I++G T+ EIA  L IS  TV  ++ +I+ K   + R  A+ +A
Sbjct: 181 ALLDSLTDRETEVLTLIAQGLTNQEIATQLFISMTTVKTHVGNILNKIGARDRVQAVIFA 240

Query: 241 VRNNIV 246
             N +V
Sbjct: 241 YENGLV 246


>gi|167589289|ref|ZP_02381677.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia ubonensis Bu]
          Length = 229

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 37/228 (16%), Positives = 76/228 (33%), Gaps = 14/228 (6%)

Query: 33  LARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMAL 92
           +A +   D        +      +G  +        +   +    + +++P    +    
Sbjct: 1   MAGLEQADSEREIYGWIEHAARSLGYEYCAYGLRMPWPVSRPRIYMLNNYPEAWQKRYQE 60

Query: 93  SEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVARIRIGL 144
           +        ++       P+  +                 G+ + +    FD   +   L
Sbjct: 61  ARYVDIDPTVKHARRSQAPLVWSDACFAATPQLWCEAQAHGLRHGWTQSAFDSCGVSGML 120

Query: 145 MLLFPKGRIILRDR------LWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWIS 198
            L    G I   +       +  +   A           +    +  LT REVE L W +
Sbjct: 121 TLARSNGPITPAELEQNEFKMRWLVSTAHLAMTGKLLPKLAPDTERGLTDREVEVLKWAA 180

Query: 199 EGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +GKTS EI+ IL IS +TVN ++ + + K     ++ A+  A    ++
Sbjct: 181 DGKTSGEISTILVISVDTVNFHVKNAVSKLKAANKTSAVVRATMLGLL 228


>gi|310659232|ref|YP_003936953.1| degu [Clostridium sticklandii DSM 519]
 gi|308826010|emb|CBH22048.1| DegU [Clostridium sticklandii]
          Length = 211

 Score =  141 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 38/225 (16%), Positives = 79/225 (35%), Gaps = 17/225 (7%)

Query: 21  SFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSS 80
             V       + L +++ ++                G      +  +      LD  + +
Sbjct: 1   MIVDDHALMREGLTKILEMEDNFEVV-----FKAADGYEALDYIEQNPVDIVLLDINMPN 55

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARI 140
               + ++ M   + +           +   V+ T    I       N Y     +   +
Sbjct: 56  MNGIETLKKMKQLDFE--------TKIIMLTVYDTREYLIETLNLGANGYMLKDAETDSL 107

Query: 141 RIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEG 200
              +  ++  G  I  +   E+      + N  +           LT RE E L  I+EG
Sbjct: 108 VKAIEAVYNGGSYIHPNLAGEL----FKEINRQRVSRNIKSGVDSLTRREYEVLLLIAEG 163

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
            ++ +I+  L IS  TV N+++SI+RK   + R+ A  +A++  +
Sbjct: 164 MSNKDISDHLVISEKTVKNHVSSILRKLDLQDRTQAAIFAIKQKL 208


>gi|307266655|ref|ZP_07548184.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306918318|gb|EFN48563.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 208

 Score =  141 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 38/220 (17%), Positives = 75/220 (34%), Gaps = 21/220 (9%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWP 83
            L    D       L   +     +  +++   G   + L +  +     +D  +     
Sbjct: 3   RLLVADDHALIRKGLVQLIEMENDIKVISQASNGEEAYKLAKKFMPDLILMDVNMPVMNG 62

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
               + +   +             LF  +++     +         Y     +   +   
Sbjct: 63  IKAAKMLKEEKHP--------SKVLFLTIYNDREYLLEALKLGVEGYILKDAEYDDLIKA 114

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           +  ++  G  I    + EI  +             H     +LT RE+E L  IS+G ++
Sbjct: 115 IRTIYNGGVYIHPSLMEEIDNI------------DHENLKKDLTPREIEILKLISKGYSN 162

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
            EIA  L +S  TV N++ +I +K   K R+ A  Y ++N
Sbjct: 163 KEIAQKLFLSEKTVKNHVYNIFKKLDVKDRTQAAIYMLKN 202


>gi|167584437|ref|ZP_02376825.1| transcriptional regulator, LuxR family protein [Burkholderia
           ubonensis Bu]
          Length = 239

 Score =  141 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 76/235 (32%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       R+ A ++ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYHQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFH--------TLPENITPPAGMDNRYCSLTFDVA 138
           +            + ++        +          +        +G+       +   A
Sbjct: 63  MAHYQEQNYIDIDSTVRDGALSTNLIVWPDADKAGASPLWADARASGLAVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDV-------HWGKDFELTGREV 191
           R   GL+ +      +    +  + L   + AN+  S              +  LT RE 
Sbjct: 122 RGAFGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSGFMVPKLAPEANVVLTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILNISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|20808107|ref|NP_623278.1| response regulator [Thermoanaerobacter tengcongensis MB4]
 gi|254479031|ref|ZP_05092387.1| response regulator receiver domain protein [Carboxydibrachium
           pacificum DSM 12653]
 gi|20516692|gb|AAM24882.1| Response regulators consisting of a CheY-like receiver domain and a
           HTH DNA-binding domain [Thermoanaerobacter tengcongensis
           MB4]
 gi|214035027|gb|EEB75745.1| response regulator receiver domain protein [Carboxydibrachium
           pacificum DSM 12653]
          Length = 208

 Score =  141 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 38/220 (17%), Positives = 72/220 (32%), Gaps = 21/220 (9%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWP 83
            L    D       L   +     +  +++   G   + L +        +D  +     
Sbjct: 3   RLLVADDHALIRKGLVQLIELEKDIRVISQASNGEEAYRLAKELSPDIILMDINMPVMNG 62

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
               + +   +             LF  +++     +         Y     +   +   
Sbjct: 63  ITAAKKLKAEKHP--------SKILFLTIYNDKEYLVEALKLGVEGYILKDAEYDDLIKA 114

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           +  ++  G  I    + EI                      ELT RE+E L  +S+G ++
Sbjct: 115 VRTIYNGGVYIHPSLMQEI------------EDSNEELLRKELTPREIEILKLLSQGYSN 162

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
            EIA  L +S  TV N++ +I RK   K R+ A  Y ++N
Sbjct: 163 KEIAQKLFLSEKTVKNHVYNIFRKLGVKDRTQAAIYMLKN 202


>gi|218134363|ref|ZP_03463167.1| hypothetical protein BACPEC_02257 [Bacteroides pectinophilus ATCC
           43243]
 gi|217989748|gb|EEC55759.1| hypothetical protein BACPEC_02257 [Bacteroides pectinophilus ATCC
           43243]
          Length = 218

 Score =  141 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 44/235 (18%), Positives = 81/235 (34%), Gaps = 20/235 (8%)

Query: 12  LNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQE 71
           +N     R           + L +++ L+  +             G     L+     + 
Sbjct: 1   MNDNKPIRILIADDHAMIREGLKQILELEGDIEIVGEA-----SDGYECLNLINKLNPEI 55

Query: 72  QKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYC 131
             LD  + +     ++  M   +             +   +   +   I       + Y 
Sbjct: 56  VLLDINMPNLDGIQVLNIMKQQQLTN--------KVIVLTIHKEIDYLIKVFDIGCDGYV 107

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREV 191
               D A +R  +  +      +       +        +     D+  GK  +LT RE+
Sbjct: 108 LKDSDSATLRKAITAVHMGEGYVEPSLTPLL-------NSSLVERDIMTGKVNDLTKREL 160

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + L  I+ G  + EIAV L IS  TV N+I++I RK     R+ A  +A++N IV
Sbjct: 161 QVLKLIANGMFNREIAVQLKISERTVKNHISNIFRKINVSDRTQAAVFAIKNKIV 215


>gi|170697219|ref|ZP_02888313.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           IOP40-10]
 gi|170137839|gb|EDT06073.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           IOP40-10]
          Length = 237

 Score =  141 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 36/225 (16%), Positives = 67/225 (29%), Gaps = 16/225 (7%)

Query: 37  IPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKD 96
                     +   A    +G  +            K   ++ S++P   V         
Sbjct: 13  ATAKSEADVFLEFTADVRALGFEYCSFGLRIPLPVSKPQFMLQSNYPQTWVDRYVSQNYF 72

Query: 97  KYYNVLQRPTELFCPVFHT--------LPENITPPAGMDNRYCSLTFDVARIRIGLMLLF 148
                ++       P+              +     G+ + +C  +         + ++ 
Sbjct: 73  AVDPTVRHGLSQMSPLIWRADSQTQSVEFWDEAEHHGLRHGWCMPSISRTGAIGLVTMVR 132

Query: 149 PKGRIILRDRLWE-------IGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGK 201
                I    L E       +  +A Y  +M            ELT RE E L W + GK
Sbjct: 133 SGEP-IDERELAEKGYQMSWLANMANYAMSMHLLARFVPEYAVELTARERETLQWSAAGK 191

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T  EI  I+ +   TV  ++ + MRK     ++ A   A    ++
Sbjct: 192 TYAEIGKIMHVDDRTVKFHLVNAMRKLNATNKTEAAVKAAMLGLL 236


>gi|163761139|ref|ZP_02168216.1| probable transcriptional regulator protein, LuxR family [Hoeflea
           phototrophica DFL-43]
 gi|162281690|gb|EDQ31984.1| probable transcriptional regulator protein, LuxR family [Hoeflea
           phototrophica DFL-43]
          Length = 246

 Score =  141 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 45/229 (19%), Positives = 77/229 (33%), Gaps = 20/229 (8%)

Query: 36  MIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLF----QEQKLDSIVSSDWPFDLVRCMA 91
           +  +  T      +       G  +F ++          +      V S WP +L+    
Sbjct: 17  ISKIRTTFDAIQVLRKTCLSYGFRYFSVLTIPAMVSESAQVMSHISVISSWPPELIADYD 76

Query: 92  LSEKDKYYNVLQRPTELFCPVF------HTLPENITPP--------AGMDNRYCSLTFDV 137
             E  K   VL+R  +   P+        +  +              G+         D 
Sbjct: 77  RLELGKNSPVLERLRKQITPLLFEVENIDSERDGAEQASAKELFTRFGVTMGVYFPVQDG 136

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGK-DFELTGREVECLTW 196
              R  +  +  +   +    L  + + A    +       +       L  RE E L W
Sbjct: 137 RGQRFAVCFMGARKP-LSATELPSLAMFATLLVDQLSQITANEDTAKLVLNARETEVLQW 195

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
            +EGKTS EIA I G+S +TVN+Y     +K     R+ A+  A+R  +
Sbjct: 196 TAEGKTSAEIARITGLSEHTVNHYATIATQKLGCSNRTQAVVQAIRLGL 244


>gi|311105770|ref|YP_003978623.1| LuxR family transcriptional regulator [Achromobacter xylosoxidans
           A8]
 gi|310760459|gb|ADP15908.1| bacterial regulatory protein, LuxR family protein 7 [Achromobacter
           xylosoxidans A8]
          Length = 237

 Score =  141 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 39/232 (16%), Positives = 81/232 (34%), Gaps = 14/232 (6%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
             DLL          +   ++ A+ + +G S+                ++ SD+P     
Sbjct: 5   AQDLLLTTNSATSEQAVFTKVAAVAQELGFSYCAYGLRAALPFTNPQFVMISDYPIAWQE 64

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVARI 140
             A +   +    ++  +    P+  +           +     G+   +     D    
Sbjct: 65  RYAQARYLEIDPTVKHCSRSSIPIVWSDRVFAETPELWDEAQAVGLCVGWSQSNLDAYGT 124

Query: 141 RIGLMLLFPKGRIILRD------RLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECL 194
              L L   K ++   +      R+  +   A    +           +  LT RE E L
Sbjct: 125 GGMLTLARQKEQLSDAELLSKELRMRWLVTAAHLAFSKVLLPRFKLAPNVPLTRRETEIL 184

Query: 195 TWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            W ++GKTS +++ IL I+ +TV  +  + + K   + R+ A+A A    ++
Sbjct: 185 KWAADGKTSSDVSEILAIAESTVRFHTKNAISKLGARNRTAAVARAALLGLL 236


>gi|310769028|gb|ADP21168.1| PhzR [Pseudomonas chlororaphis]
          Length = 241

 Score =  141 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 40/225 (17%), Positives = 79/225 (35%), Gaps = 14/225 (6%)

Query: 36  MIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEK 95
                    +T         +    F      +    +  + +  ++P D V+    +  
Sbjct: 17  FARTMDMQEFTAVALRALRELRFDFFAYGMCSVTPFMRPRTYMYGNYPEDWVQRYQAANY 76

Query: 96  DKYYNVLQRPTELFCPVFHT--------LPENITPPAGMDNRYCSLTFDVARIRIGLMLL 147
                 ++       P+  +           +    + + +     +F+       L L 
Sbjct: 77  AVIDPTVKHSKVSSAPILWSNELFRGCADLWSEAKDSHLCHGLAQPSFNAQGRVGVLSLA 136

Query: 148 FPKGRIILRD------RLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGK 201
                I L++              A  + +  +S    +  D E +GRE + L W ++GK
Sbjct: 137 RKNNPISLQEFEALKPVTRAFAAAAHEKISELESDVRVFNTDVEFSGRECDVLRWTADGK 196

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           TS+EI VI+G+  +TVN +  +I RK     R  A++YAV    +
Sbjct: 197 TSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAVAMGYI 241


>gi|311279135|ref|YP_003941366.1| transcriptional regulator, LuxR family [Enterobacter cloacae SCF1]
 gi|308748330|gb|ADO48082.1| transcriptional regulator, LuxR family [Enterobacter cloacae SCF1]
          Length = 240

 Score =  141 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 77/231 (33%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R D+L +      +      +   TE +    + L         +    + + +P   + 
Sbjct: 10  RRDVLQKFQLASSSEEIYSILQQQTEMLEYDWYALCVRHPVPFTRPKIALQTTYPRAWIA 69

Query: 89  CMALSEKDKYYNVLQRP--TELFCPVFHTLP------ENITPPAGMDNRYCSLTFDVARI 140
                       VL+       + P    L        +     G+            R 
Sbjct: 70  QYQAENYFTIDPVLKPENYRHGYLPWTDRLFQDAQEFWDAARDHGLRKGVTQCLILPNRA 129

Query: 141 RIGLMLLFPK---GRIILRDRLWEIGLLAAYQANMFKSYDVHW--GKDFELTGREVECLT 195
              L +         +   +    + +LA +        D       + + + RE+E L 
Sbjct: 130 LGFLSVSREGIQKDPLAEDETQMRLQMLAEFSTTALLRLDDSAILTPEMKFSKRELEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EI++IL IS NTVN +  ++ +K     ++    YAV   ++
Sbjct: 190 WTAEGKTSAEISIILSISENTVNFHQKNMQKKFNAPNKTQIACYAVATGLI 240


>gi|89095961|ref|ZP_01168855.1| two-component response regulator [Bacillus sp. NRRL B-14911]
 gi|89089707|gb|EAR68814.1| two-component response regulator [Bacillus sp. NRRL B-14911]
          Length = 227

 Score =  141 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 34/232 (14%), Positives = 72/232 (31%), Gaps = 19/232 (8%)

Query: 21  SFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSS 80
             +       + + R++  + T           E +G     LV         +D  + +
Sbjct: 6   VIIDDHQLFREGVKRILDFEKTFEVVAEGDDGNEALG-----LVEEYDPDVVIMDINMPT 60

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARI 140
               +  + +     D           +   +               + Y     D   +
Sbjct: 61  INGVEATKQLVEKYPD--------AKVIILSIHDDENYVTHALKTGASGYLLKEMDADAL 112

Query: 141 RIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDV------HWGKDFELTGREVECL 194
              + ++   G  +       +       A+                    LT RE E L
Sbjct: 113 VEAVKVVADGGSYLHPKVTHNLVKEYRRLASDENGSSEGYTQVEIRRPLHLLTRRECEVL 172

Query: 195 TWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
             +++GK++  I   L IS  TV N++++I++K     R+ A+  A++N  V
Sbjct: 173 QLLADGKSNRGIGEALFISEKTVKNHVSNILQKMNVNDRTQAVVVAIKNGWV 224


>gi|326391463|ref|ZP_08212998.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter ethanolicus JW 200]
 gi|325992489|gb|EGD50946.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 208

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 38/220 (17%), Positives = 75/220 (34%), Gaps = 21/220 (9%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWP 83
            L    D       L   +     +  +++   G   + L +  +     +D  +     
Sbjct: 3   RLLVADDHALIRKGLVQLIEMENDIKVISQASNGEEAYKLAKKFMPDLILMDVNMPVMNG 62

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
               + +   +             LF  +++     +         Y     +   +   
Sbjct: 63  IKAAKMLKEEKHP--------SKVLFLTIYNDREYLLEALKLGVEGYILKDAEYDDLIKA 114

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           +  ++  G  I    + EI  +             H     +LT RE+E L  IS+G ++
Sbjct: 115 IRTIYNGGVYIHPSLMEEIDNI------------DHENLKKDLTPREIEILKLISKGYSN 162

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
            EIA  L +S  TV N++ +I +K   K R+ A  Y ++N
Sbjct: 163 KEIAQKLFLSEKTVKNHVYNIFKKLDVKDRTQAAIYMLKN 202


>gi|206563716|ref|YP_002234479.1| N-acylhomoserine lactone dependent regulatory protein CepR
           [Burkholderia cenocepacia J2315]
 gi|198039756|emb|CAR55726.1| N-acylhomoserine lactone dependent regulatory protein CepR
           [Burkholderia cenocepacia J2315]
          Length = 239

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 76/235 (32%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       R+ A ++ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYQQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI--------TPPAGMDNRYCSLTFDVA 138
           +         +  + ++        +     + I            G+       +   A
Sbjct: 63  MAHYQAQNYIEIDSTVRDGALNTNMIVWPDVDRIDPCPLWQDARDFGLSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       L+    + F    +       LT RE 
Sbjct: 122 RGAFGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPAAGVTLTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|229169497|ref|ZP_04297202.1| DNA-binding response regulator [Bacillus cereus AH621]
 gi|228613996|gb|EEK71116.1| DNA-binding response regulator [Bacillus cereus AH621]
          Length = 184

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 33/179 (18%), Positives = 61/179 (34%), Gaps = 16/179 (8%)

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +    +     +           L   ++      +       
Sbjct: 19  RPDCILMDINLPGKNGIEATSLVKGQYPN--------CRVLVLTMYEHDEYLMAALRAGA 70

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + Y        ++   + ++     +I      ++          +         + ELT
Sbjct: 71  DGYLLKDSSSEQVVAAIRMVLQGDSVIHPRMTKKLIT--------YHQQTKSESNENELT 122

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  + +G ++ EIA  L IS  TV  ++  I RK   K+RS A+ YAVRN +V
Sbjct: 123 EREKEILFELVKGLSNKEIAEALYISDKTVKIHVNKIFRKLNVKSRSQAVIYAVRNQLV 181


>gi|12620586|gb|AAG60862.1|AF322012_167 ID375 [Bradyrhizobium japonicum]
          Length = 261

 Score =  141 bits (356), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 84/243 (34%), Gaps = 24/243 (9%)

Query: 28  TRSDLLARM---IPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVS----S 80
              DL + +   I      +    +       G             E++L   +      
Sbjct: 19  RGPDLFSFIECAIQTRSIAALFDLLVNFASNEGFDKVAYGALSCSNERRLPEYLPPPPTI 78

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLP-------------ENITPPAGMD 127
           ++P D  +  A  E      V++R   L  P                         AG+ 
Sbjct: 79  NFPSDWCQRYAEQEYQAIDPVVRRTAMLPRPFLWDELTSRYELQPRELRVLREAKEAGLK 138

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-- 185
           +      F        +    P      +DR+  +  LA+   N          +  E  
Sbjct: 139 HGMSVPLFGSQGRSAFVSFASPFDDADPQDRMAHLTTLASAFHNAVAQITPPLDESCETD 198

Query: 186 --LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             LT RE ECL W++EGK++  I  ++ ++ NTVN ++ +++RK     R+ A+A A R 
Sbjct: 199 IPLTPRETECLYWVAEGKSAWVIGQLVNVTDNTVNFHMKNVIRKLGAANRTNAVAKATRR 258

Query: 244 NIV 246
            I+
Sbjct: 259 GII 261


>gi|260892920|ref|YP_003239017.1| two component transcriptional regulator, LuxR family [Ammonifex
           degensii KC4]
 gi|260865061|gb|ACX52167.1| two component transcriptional regulator, LuxR family [Ammonifex
           degensii KC4]
          Length = 213

 Score =  141 bits (355), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 33/240 (13%), Positives = 71/240 (29%), Gaps = 31/240 (12%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           ++++ +++  +       +  L    + L  +                    G     LV
Sbjct: 1   MERIKVLVVDDHALVREGIKKLLMEDERLEVVGEAGN---------------GREAVELV 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
           +        LD  +      +  R +                 +   V       +    
Sbjct: 46  KKRPVDVVLLDISMPDMGGVEACREIKRLR--------PSVAVVALTVHDQEEYCLAMLE 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
                Y        ++   ++        +      ++        +  +S         
Sbjct: 98  AGAAGYVLKESSADQLIEAIVRAARGEEYLSPRLAGKM----VKWFSRAESKRGL----C 149

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            LT RE E L  ++ G ++ EIA  L +S  TV N++ SI +K     R+ A  +AV++ 
Sbjct: 150 GLTPREKEILRLLASGLSNREIARRLYLSEKTVKNHLTSIFQKIGVSDRTQAALWAVKHG 209


>gi|306817801|ref|ZP_07451542.1| DNA-binding response regulator [Mobiluncus mulieris ATCC 35239]
 gi|304649450|gb|EFM46734.1| DNA-binding response regulator [Mobiluncus mulieris ATCC 35239]
          Length = 233

 Score =  141 bits (355), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 34/255 (13%), Positives = 71/255 (27%), Gaps = 32/255 (12%)

Query: 1   MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASH 60
           M+ E +++ ++L  +          +    D +  +       +    + AL        
Sbjct: 1   MSEETEKIKVLLVDDQALIRMGFRMVLEACDDIEVVGEAADGKTALGMVRAL-------- 52

Query: 61  FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI 120
                        +D  + +    +    +                 L    F       
Sbjct: 53  -------QPNVVLMDVRMPNMNGIEATGEIVSEN--------PEVKVLILTTFDLDEYAF 97

Query: 121 TPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLW-EIGLLAAYQANM------- 172
                  + +         +   +  +      I        + + A    +        
Sbjct: 98  GALRAGASGFLLKDAKPEELVAAIRAVAAGDATISPRITKKMLDMFAPQLPDENAEADAA 157

Query: 173 -FKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATK 231
              +          LT RE E L  I+ G T+ E+A  L IS  TV  ++ +I+ K   +
Sbjct: 158 GAGATSADAVALASLTERETEVLKLIAHGMTNQELADKLFISMTTVKTHVGNILNKIGAR 217

Query: 232 TRSGAIAYAVRNNIV 246
            R  A+ +A  N +V
Sbjct: 218 DRVQAVIFAYENGLV 232


>gi|227876856|ref|ZP_03994965.1| possible response regulator [Mobiluncus mulieris ATCC 35243]
 gi|269977833|ref|ZP_06184790.1| response regulator protein VraR [Mobiluncus mulieris 28-1]
 gi|227842753|gb|EEJ52953.1| possible response regulator [Mobiluncus mulieris ATCC 35243]
 gi|269934003|gb|EEZ90580.1| response regulator protein VraR [Mobiluncus mulieris 28-1]
          Length = 233

 Score =  141 bits (355), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 34/255 (13%), Positives = 71/255 (27%), Gaps = 32/255 (12%)

Query: 1   MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASH 60
           M+ E +++ ++L  +          +    D +  +       +    + AL        
Sbjct: 1   MSEETEKIKVLLVDDQALIRMGFRMVLEACDDIEVVGEAADGKTALGMVRAL-------- 52

Query: 61  FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI 120
                        +D  + +    +    +                 L    F       
Sbjct: 53  -------QPNVVLMDVRMPNMNGIEATGEIVSEN--------PEVKVLILTTFDLDEYAF 97

Query: 121 TPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLW-EIGLLAAYQANM------- 172
                  + +         +   +  +      I        + + A    +        
Sbjct: 98  GALRAGASGFLLKDAKPEELVAAIRAVAAGDATISPRITKKMLDMFAPQLPDENAGADAA 157

Query: 173 -FKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATK 231
              +          LT RE E L  I+ G T+ E+A  L IS  TV  ++ +I+ K   +
Sbjct: 158 GAGATSADAVALASLTERETEVLKLIAHGMTNQELADKLFISMTTVKTHVGNILNKIGAR 217

Query: 232 TRSGAIAYAVRNNIV 246
            R  A+ +A  N +V
Sbjct: 218 DRVQAVIFAYENGLV 232


>gi|158317264|ref|YP_001509772.1| two component LuxR family transcriptional regulator [Frankia sp.
           EAN1pec]
 gi|158112669|gb|ABW14866.1| two component transcriptional regulator, LuxR family [Frankia sp.
           EAN1pec]
          Length = 250

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 39/234 (16%), Positives = 71/234 (30%), Gaps = 11/234 (4%)

Query: 13  NREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQE 71
              D  R      +    D    +  L   +     +  +     G     L        
Sbjct: 23  ADADPTRDVMPIRVLVVDDHELFLQGLQTVLETEEDISVVGRAADGQEALTLASGTTPDI 82

Query: 72  QKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYC 131
             +D  +           +           + R   +   V     +           Y 
Sbjct: 83  VLMDVRMPGRDGIAAAGAIKR--------AVPRTRIVMLTVSDEESDLFEAIKAGAVGYL 134

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREV 191
             +     +   +  +     +I      ++ +  A  A   +           LT RE+
Sbjct: 135 LKSIPPHEVADAVRAVHNGQSLISPSMASKLMVEFATMARGGEDRPRAHAP--HLTAREL 192

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           E L  ++EG+ + EIA  L IS NTV N++ +I+ K    +R  A+ YAVR  +
Sbjct: 193 EVLKLVAEGRANREIARKLFISENTVKNHVRNILDKLQLHSRMEAVMYAVRQGL 246


>gi|330820206|ref|YP_004349068.1| quorum sensing LuxR family sensor regulator [Burkholderia gladioli
           BSR3]
 gi|327372201|gb|AEA63556.1| quorum sensing LuxR family sensor regulator [Burkholderia gladioli
           BSR3]
          Length = 240

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 38/235 (16%), Positives = 74/235 (31%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +            ++ A ++ +G  +            +    +   +P   
Sbjct: 4   LRWQDAYHQFNAAANEQQLFQQISAYSKRLGFEYCCYGIRVPQPGTQPVVEIFDTYPAGW 63

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI--------TPPAGMDNRYCSLTFDVA 138
           +         +    ++        +     +              GM       +   A
Sbjct: 64  MAHYQARNYIEVDPTVRDGAMSPNMIIWPDVDTAEDPSLWRDARDFGMSVGVAQ-SAWAA 122

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVH-------WGKDFELTGREV 191
           R   GL+ +  +   +    +  + L A + AN+  S                 LT RE 
Sbjct: 123 RGVFGLLTIARRSDRLTPAEINSLTLQANWLANLSHSLMGKFLVPKLSPAASVTLTKRER 182

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L+W SEG+T+ EI   L IS  TV  +I +I+ K     +  A+  A+   ++
Sbjct: 183 EVLSWTSEGRTASEIGEQLNISERTVTFHINNILAKLGATNKVQAVVKAIGMGLI 237


>gi|15806010|ref|NP_294711.1| DNA-binding response regulator [Deinococcus radiodurans R1]
 gi|6458715|gb|AAF10563.1|AE001951_3 DNA-binding response regulator [Deinococcus radiodurans R1]
          Length = 239

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 31/245 (12%), Positives = 68/245 (27%), Gaps = 30/245 (12%)

Query: 2   NFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHF 61
           N   + + ++L  +          L      L  +           +  +LT        
Sbjct: 20  NEAARPITLLLVDDHPVVRKGTRELLEGETDLRVVGEAGSGEEALAQARSLT-------- 71

Query: 62  LLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT 121
                       +D  +      +  + +   +             L    +        
Sbjct: 72  -------PDVILMDVSMPGMNGIEATKAIKAEQ--------PSVGVLVLTSYDDDAYVFA 116

Query: 122 PPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWG 181
                   Y         +   +  +      +          +A      F        
Sbjct: 117 LLEAGAAGYLLKNASEDDLLGAVRAVAAGESALHPS-------IARKVLERFSVASTPTP 169

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
            + +L+ RE+E L   + G+T+ EIA  L IS  TV  ++A+I  K    +R+ A+ + +
Sbjct: 170 PEDDLSPRELEVLRVAASGRTNKEIARDLDISPRTVQVHLANIFSKLGVGSRTEAVLHGI 229

Query: 242 RNNIV 246
           +   +
Sbjct: 230 KRGWI 234


>gi|329948078|ref|ZP_08294979.1| response regulator receiver domain protein [Actinomyces sp. oral
           taxon 170 str. F0386]
 gi|328523217|gb|EGF50318.1| response regulator receiver domain protein [Actinomyces sp. oral
           taxon 170 str. F0386]
          Length = 244

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 28/241 (11%), Positives = 67/241 (27%), Gaps = 24/241 (9%)

Query: 7   QVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRW 66
            +++VL  +          +    + +  +       +   +  AL              
Sbjct: 26  PISVVLADDQALMRMGFRMVLEAEEDINVVGEASDGTAALAQAKAL-------------- 71

Query: 67  DLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGM 126
                  +D  +      +    +A           +         F             
Sbjct: 72  -HPDVILMDVRMPGMNGIEATELIARE-----CPGTRVL---ILTTFDLDEYAFAGLRAG 122

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRL-WEIGLLAAYQANMFKSYDVHWGKDFE 185
            + +         +   +  +     ++        + + A    N          +   
Sbjct: 123 ASGFLLKDTRPTELAEAIRTVASGEAVVSPRVTQRMLEMFAPSLPNSGAPTQASDPRIDS 182

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  +S+G ++ EIA  L +S  TV  ++ +++ K   + R  A+  A    +
Sbjct: 183 LTPREKEILVLMSQGLSNAEIADHLVVSATTVKTHVGNVLAKLDVRDRVQAVVVAYETGL 242

Query: 246 V 246
           +
Sbjct: 243 M 243


>gi|229164358|ref|ZP_04292288.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           R309803]
 gi|228619101|gb|EEK75997.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           R309803]
          Length = 215

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 36/222 (16%), Positives = 72/222 (32%), Gaps = 12/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D    +  L   +S    +  + E   G    + V         +D  +      
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDLELVGEANNGKEALVKVGETNPDVVLMDLYMPEMDGV 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +   C+     +           +    F      +       + Y     +  ++   +
Sbjct: 65  EATACIKKEYPN--------VKVIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
              +     +  D    +           +   +       LT RE E L  +++G ++ 
Sbjct: 117 RSAYKGNIQLHPDIANALLSQTLPVEEKEEEPSIQVD---VLTARENEVLQLLAKGMSNK 173

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 174 EIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGIV 215


>gi|75674825|ref|YP_317246.1| LuxR family transcriptional regulator [Nitrobacter winogradskyi
           Nb-255]
 gi|74419695|gb|ABA03894.1| Transcriptional regulatory protein, LuxR family [Nitrobacter
           winogradskyi Nb-255]
          Length = 241

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 42/231 (18%), Positives = 78/231 (33%), Gaps = 18/231 (7%)

Query: 32  LLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQ---EQKLDSIVSSDWPFDLVR 88
            +AR+            +  +   +G SH L     +     EQ++ ++V   WP     
Sbjct: 12  FIARVDKASTPAEIADAVVDVARPLGFSHVLAGIIPIPGMTAEQQISNVVLHRWPKAWSE 71

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLPE-------------NITPPAGMDNRYCSLTF 135
                        +QR      P   +  E                    +   +     
Sbjct: 72  RYFTKGYLFDDPTIQRVNTSTEPFLWSELEPTYRNTPAPTRVMGEAREFNLGCGFTVPMI 131

Query: 136 DVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLT 195
            +     G  L   +  +       ++ L+A Y                 LT RE++ L 
Sbjct: 132 TLNGQTAGFSLASERAEVPS-ILRGQLQLIAMYAFARALGQKYKPAP-VNLTPREMDILQ 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W++EGK+  EI+VIL +S + V+     +  K     R+  +A A+R+N++
Sbjct: 190 WMAEGKSDWEISVILKVSEHLVDKIARQLRAKLNATNRTQTVAVALRHNLI 240


>gi|317130322|ref|YP_004096604.1| LuxR family transcriptional regulator [Bacillus cellulosilyticus
           DSM 2522]
 gi|315475270|gb|ADU31873.1| two component transcriptional regulator, LuxR family [Bacillus
           cellulosilyticus DSM 2522]
          Length = 232

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 42/253 (16%), Positives = 86/253 (33%), Gaps = 31/253 (12%)

Query: 1   MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASH 60
           MN E +++ IVL  + +     V           R++ ++ +              G + 
Sbjct: 1   MNIE-KKLRIVLIDDHQLFREGVK----------RILAMEPSFEIVAE-----GSDGDAS 44

Query: 61  FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI 120
             LV+        +D  + +    +  + +          +      L   +        
Sbjct: 45  MELVQMYEPDVVLMDINMPNVNGVEATKQLVE--------MFPGVKVLILSIHDDETYVT 96

Query: 121 TPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW 180
                  + Y     D   +   + ++   G  I       +       AN  +      
Sbjct: 97  HVLKTGASGYLLKEMDTEALIEAVKVVGEGGAYIHPKVTHNLINEYRKLANEDRLEPEVG 156

Query: 181 GKDFE-------LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
            ++ E       LT RE E L  +++GK++  I   L IS  TV N++++I++K     R
Sbjct: 157 FREVEFRRPLHLLTRRECEVLQLMTDGKSNRAIGEALYISEKTVKNHVSNILQKMGMNDR 216

Query: 234 SGAIAYAVRNNIV 246
           + A+  A++N  V
Sbjct: 217 TQAVVDAIKNGWV 229


>gi|14586760|gb|AAK70352.1|AF333007_1 N-acyl homoserine lactone transcriptional regulator [Burkholderia
           vietnamiensis]
          Length = 239

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 76/235 (32%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       R+ A ++ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYHQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI--------TPPAGMDNRYCSLTFDVA 138
           +         +  + ++        +     + I            G+       +   A
Sbjct: 63  MAHYQAQNYIEIDSTVRDGALNTNMIVWPDVDRIDPCPLWQDARDFGLSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       L+    + F    +       LT RE 
Sbjct: 122 RGAFGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPAAGVTLTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|304406459|ref|ZP_07388115.1| two component transcriptional regulator, LuxR family [Paenibacillus
           curdlanolyticus YK9]
 gi|304344517|gb|EFM10355.1| two component transcriptional regulator, LuxR family [Paenibacillus
           curdlanolyticus YK9]
          Length = 220

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 34/221 (15%), Positives = 67/221 (30%), Gaps = 9/221 (4%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           L    D       L   +S    +  + E   G                +D  +      
Sbjct: 5   LLLADDHAMVRKGLQMFLSMQSDLQVIGEASNGQETIERAAELAPDMILMDLNMPVLDGI 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           ++ + +  S              +    F      +         Y     +   +   +
Sbjct: 65  EVTKRLKQSH--------PHVKVIVLTSFSDEAHVLPAIRAGAKGYLLKDIEPDELVRAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
             ++     +  D    +  + A   +     D    +  ELT RE E L  I+ G ++ 
Sbjct: 117 RRVWQGQVELHPDAASRLMNILAEPESNRDDPDEAAKRLSELTKREHEVLRLIATGMSNK 176

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           EI   L I+  TV  +++ ++ K     R+ A  +AV+  I
Sbjct: 177 EIGDSLSITEKTVKTHVSHVLEKLGFADRTQAAIFAVKQGI 217


>gi|221633642|ref|YP_002522868.1| transcriptional regulatory protein degU [Thermomicrobium roseum DSM
           5159]
 gi|221156159|gb|ACM05286.1| transcriptional regulatory protein degU [Thermomicrobium roseum DSM
           5159]
          Length = 245

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 40/246 (16%), Positives = 84/246 (34%), Gaps = 28/246 (11%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           +  +NI++  +     S +     ++     +                    G+    L 
Sbjct: 1   MSPINILIVDDHPLFRSGIRWSLEQNPQFVIVGEAAD---------------GSEALRLA 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                    +D  +      ++ R +   +         +   +   +     +      
Sbjct: 46  DELSPDVILVDLSLPGMNGLEVARALKRRQ--------PQAGVIILTMHQDDEQLFNAIR 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
              + YC+   +  ++   +  +     +I    L     +A+   + F+          
Sbjct: 98  AGASAYCTKDIEPEQLIDVITRVARGEYLINEMVLSR-PFVASRVLDQFRELSRLDRTSS 156

Query: 185 ----ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
                LT RE+E L  ++ G ++ EIA  L IS  TV N+I SI+RK A   R+ A+ YA
Sbjct: 157 GFFSPLTPREIEILDCVARGYSNKEIAQALNISDQTVKNHITSILRKLAVNDRTQAVIYA 216

Query: 241 VRNNIV 246
           +R+  +
Sbjct: 217 LRHGWI 222


>gi|12620905|gb|AAG61132.1|AF330021_1 AHL receptor [Burkholderia stabilis]
          Length = 239

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 38/235 (16%), Positives = 74/235 (31%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       R+ A ++ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYQQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPSVAIFDTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFH--------TLPENITPPAGMDNRYCSLTFDVA 138
           +         +  + ++        +                    G+       +   A
Sbjct: 63  MARYQAQNYIEIDSTVRDGALSTNMIVWPDVDRSDPGPLWQDAREFGLSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       L+    + F    +       LT RE 
Sbjct: 122 RGAFGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPAAGVTLTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILSISGRTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|121663600|emb|CAM12358.1| quorum sensing LuxR family sensor regulator [Burkholderia glumae]
          Length = 239

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 38/235 (16%), Positives = 75/235 (31%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       ++ A ++ +G  +            +    +   +P   
Sbjct: 3   LRWQDAYHQFNTAENEQQLFHQVSAYSKRLGFEYCCYGIRVPQPGSQPLVEIFDTYPPGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI--------TPPAGMDNRYCSLTFDVA 138
           +         +    ++        +     +              GM       +   A
Sbjct: 63  MAHYQARNYIEIDPTVRDGAASPNMIIWPDADAAEQPSLWRDARDFGMSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQAN-------MFKSYDVHWGKDFELTGREV 191
           R   GL+ +  +   +    +  + L A + AN        F    +       LT RE 
Sbjct: 122 RGVFGLLTIARRSDRLTPAEINSLTLQANWLANLSHSLMGRFLVPKLSPAASISLTKRER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L+W SEG+T+ EI   L IS  TV  +I +I+ K     +  A+  A+   ++
Sbjct: 182 EVLSWTSEGRTASEIGEQLNISERTVTFHINNILAKLGAANKVQAVVKAIGMGLI 236


>gi|315304744|ref|ZP_07874927.1| transcriptional regulatory protein DegU [Listeria ivanovii FSL
           F6-596]
 gi|313626888|gb|EFR95838.1| transcriptional regulatory protein DegU [Listeria ivanovii FSL
           F6-596]
          Length = 228

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 36/233 (15%), Positives = 72/233 (30%), Gaps = 20/233 (8%)

Query: 21  SFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSS 80
             V       + + R++ L+ +              G +    VR        +D  + +
Sbjct: 6   MIVDDHQLFREGIKRILELEDSFEVVAEAEN-----GKNIVAKVREYKPDIVLMDINMPT 60

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARI 140
               D    +                 +   +  T              Y     D   +
Sbjct: 61  VNGLDATEMLVRQ--------FPSIKVIILTIHDTDEYVTEALRSGAVGYLLKEMDAHEL 112

Query: 141 RIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFK-------SYDVHWGKDFELTGREVEC 193
              + ++   G  I      ++     + A+                     LT RE E 
Sbjct: 113 VEAVKIVDNGGAYIHPRVAIKLIREYRHLASTNAAQGVYGYQQPEVKMPLHILTHRECEV 172

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L  +++GK++  I   L IS  TV N+++SI++K     R+ A+  A+++  V
Sbjct: 173 LQLLTDGKSNRGIGETLFISEKTVKNHVSSILQKMKVNDRTQAVVTAIKHGWV 225


>gi|152989200|ref|YP_001349253.1| transcriptional regulator LasR [Pseudomonas aeruginosa PA7]
 gi|150964358|gb|ABR86383.1| transcriptional regulator LasR [Pseudomonas aeruginosa PA7]
          Length = 239

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 42/233 (18%), Positives = 73/233 (31%), Gaps = 17/233 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           D    +      + W+  +  +   +G S  L        +   ++ +  ++P       
Sbjct: 5   DGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHY 64

Query: 91  ALSEKDKYYNVLQRPTELFCPVFH----------TLPENITPPAGMDNRYCSLTFDVARI 140
             +   +    +   T+   P+F                    AG+              
Sbjct: 65  DKAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGE 124

Query: 141 RIGLMLL-----FPKGRIILRDRLWEIGLLAAYQANMFKSY--DVHWGKDFELTGREVEC 193
              L L        +    +   L  + +L  Y          +    K   LT RE E 
Sbjct: 125 LGALSLSVEAESRAEANRFMESVLPTLWMLKDYALQSGAGLAFEHPVNKPVVLTSREKEV 184

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GKTS EI+VI   S   VN ++ +I RK    +R  A   AV   ++
Sbjct: 185 LQWCAIGKTSWEISVICNCSEANVNFHMGNIRRKFGVTSRRVAAIMAVNLGLI 237


>gi|27376991|ref|NP_768520.1| transcriptional regulator [Bradyrhizobium japonicum USDA 110]
 gi|27350133|dbj|BAC47145.1| transcriptional regulatory protein [Bradyrhizobium japonicum USDA
           110]
          Length = 253

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 84/243 (34%), Gaps = 24/243 (9%)

Query: 28  TRSDLLARM---IPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVS----S 80
              DL + +   I      +    +       G             E++L   +      
Sbjct: 11  RGPDLFSFIECAIQTRSIAALFDLLVNFASNEGFDKVAYGALSCSNERRLPEYLPPPPTI 70

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLP-------------ENITPPAGMD 127
           ++P D  +  A  E      V++R   L  P                         AG+ 
Sbjct: 71  NFPSDWCQRYAEQEYQAIDPVVRRTAMLPRPFLWDELTSRYELQPRELRVLREAKEAGLK 130

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-- 185
           +      F        +    P      +DR+  +  LA+   N          +  E  
Sbjct: 131 HGMSVPLFGSQGRSAFVSFASPFDDADPQDRMAHLTTLASAFHNAVAQITPPLDESCETD 190

Query: 186 --LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             LT RE ECL W++EGK++  I  ++ ++ NTVN ++ +++RK     R+ A+A A R 
Sbjct: 191 IPLTPRETECLYWVAEGKSAWVIGQLVNVTDNTVNFHMKNVIRKLGAANRTNAVAKATRR 250

Query: 244 NIV 246
            I+
Sbjct: 251 GII 253


>gi|218663535|ref|ZP_03519465.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli IE4771]
          Length = 240

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 45/226 (19%), Positives = 88/226 (38%), Gaps = 18/226 (7%)

Query: 37  IPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI-VSSDWPFDLVRCMALSEK 95
                       M  LT+ +G + FL++     +  ++ +  + ++WP ++V        
Sbjct: 15  AGFKTHYEVFKYMKGLTQDLGMTAFLIMTLPTVEFVEIGATKIITNWPAEMVDYYDAHNL 74

Query: 96  DKYYNVLQRPTELFCPVFHTLPE--------------NITPPAGMDNRYCSLTFDVARIR 141
                V++R      P  + +                ++    GM+        D A  R
Sbjct: 75  MVDSPVIRRMLRSTSPFNYDVEAINTDRGGGKKSTVIDLFRRYGMEKGAYFPLHDAAGGR 134

Query: 142 IGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYD-VHWGKDFELTGREVECLTWISEG 200
             + +   +   +    + +I  +A    +           K    T  E++CL   + G
Sbjct: 135 GAMSISGSRNFSM--IEMAKILFIATLIYDRLSQLTLNEKHKPIAFTSSELDCLRLTAGG 192

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + S EIA +L +S N VNN+I S+++K    TR+ A+  A+R NI+
Sbjct: 193 RKSSEIAKLLHLSENAVNNHIGSVIKKLGCTTRTQAVVSALRLNII 238


>gi|149182102|ref|ZP_01860586.1| DegU [Bacillus sp. SG-1]
 gi|148850204|gb|EDL64370.1| DegU [Bacillus sp. SG-1]
          Length = 225

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 37/243 (15%), Positives = 72/243 (29%), Gaps = 27/243 (11%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
            NIV+  + +     V  +         +   D                G+    LV   
Sbjct: 3   TNIVIIDDHQLFREGVKRILEFEPTFNVLAEGDD---------------GSEAMRLVEQH 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +  + +     D           +   +               
Sbjct: 48  NPDVVLMDINMPEKNGVEATQELVNKYPD--------TKVIILSIHDDENYVSHALKTGA 99

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYD----VHWGKD 183
             Y     D   +   + ++   G  I       +       AN  ++            
Sbjct: 100 LGYLLKEMDSEALIEAVKVVAAGGSYIHPKVTHNLISDYRRLANTQETGGFKQTEVRRPL 159

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             LT RE E L  +++GK++  I   L IS  TV N++++I++K     R+ A+   ++N
Sbjct: 160 HLLTRRECEVLQMLADGKSNRGIGEALYISEKTVKNHVSNILQKMNVNDRTQAVVTGIKN 219

Query: 244 NIV 246
             V
Sbjct: 220 GWV 222


>gi|229176087|ref|ZP_04303581.1| Two component transcriptional regulator, LuxR [Bacillus cereus MM3]
 gi|228607431|gb|EEK64759.1| Two component transcriptional regulator, LuxR [Bacillus cereus MM3]
          Length = 215

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 38/221 (17%), Positives = 77/221 (34%), Gaps = 10/221 (4%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFD 85
           +    D    +  L   +S    +  + E       L+       E   D ++   +  +
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDLELVGEANNGKEALV----KVGETNPDVVLMDLYMPE 60

Query: 86  LVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLM 145
           +    A +   K Y  ++    +    F      +       + Y     +  ++   + 
Sbjct: 61  MDGVEATACIKKEYPDVK---VIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAIR 117

Query: 146 LLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDE 205
             +     +  D    +           +   +       LT RE E L  +++G ++ E
Sbjct: 118 SAYKGNIQLHPDIANTLLSQTLPVEEKEEEPSIQVD---VLTARENEVLQLLAKGMSNKE 174

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           IA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 175 IASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGIV 215


>gi|45453489|gb|AAS65458.1| quorum sensing transcriptional activator [Burkholderia
           thailandensis]
          Length = 239

 Score =  140 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 75/235 (31%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       ++ A T+ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYLQFSAAENEQQLFQQIAAYTKRLGFEYCCYGIRVPLPISKPVVAIFDTYPNGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFH--------TLPENITPPAGMDNRYCSLTFDVA 138
           +         +    ++        +          T   +     G+       +   +
Sbjct: 63  MERYQEMNYLEVDPTVRDGALSSNMIVWPEASANDATTLWSDARDHGLAVGVAQ-SSWAS 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVH-------WGKDFELTGREV 191
           R   GL+ +      +    +  + L A + ANM  S                 LT RE 
Sbjct: 122 RGVFGLLTIARHTDRLTSAEINHLTLQANWLANMSHSLMSRFLVPKLAPESGVALTHRER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W  EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTGEGKTACEIGQILSISERTVNFHVNNILDKLGATNKVQAVVNAIAMGLI 236


>gi|46371737|gb|AAS90557.1| transcriptional activator [Burkholderia pseudomallei]
          Length = 239

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 40/235 (17%), Positives = 75/235 (31%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       ++ A T+ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYLQFSAAENEQQLFQQIAAYTKRLGFEYCCYGIRVPLPISKPVVAIFDTYPNGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFH--------TLPENITPPAGMDNRYCSLTFDVA 138
           +         +    ++        +          T   +     G+       +   +
Sbjct: 63  MERYQEMNYLEVDPTVREGALSSNMIVWPEASASDATTLWSDARDHGLAVGVAQ-SSWAS 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVH-------WGKDFELTGREV 191
           R   GL+ +      +    +  + L A + ANM  S                 LT RE 
Sbjct: 122 RGVFGLLTIARHTDRLTSAEINHLTLQANWLANMSHSLMSRFLVPKLAPESGVALTHRER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + L W  EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 KVLCWTGEGKTACEIGQILSISERTVNFHVNNILDKLGATNKVQAVVKAIAMGLI 236


>gi|75760127|ref|ZP_00740188.1| Two-component response regulator yhcZ [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|218900537|ref|YP_002448948.1| DNA-binding response regulator [Bacillus cereus G9842]
 gi|228903890|ref|ZP_04068005.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis IBL 4222]
 gi|228968544|ref|ZP_04129531.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|74492399|gb|EAO55554.1| Two-component response regulator yhcZ [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|218542579|gb|ACK94973.1| DNA-binding response regulator [Bacillus cereus G9842]
 gi|228791148|gb|EEM38763.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|228855799|gb|EEN00344.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis IBL 4222]
          Length = 215

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 36/222 (16%), Positives = 72/222 (32%), Gaps = 12/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D    +  L   +S    +  + E   G    + V         +D  +      
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDLTLVGEANNGKEALVKVGETNPDVVLMDLYMPEMDGV 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +   C+     +           +    F      +       + Y     +  ++   +
Sbjct: 65  EATACIKKEYPN--------VKVIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
              +     +  D    +           +   +       LT RE E L  +++G ++ 
Sbjct: 117 RSAYKGNIQLHPDIANTLLSQTLPVEEKEEEPSIQVD---VLTARENEVLQLLAKGMSNK 173

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 174 EIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGIV 215


>gi|229015963|ref|ZP_04172924.1| DNA-binding response regulator [Bacillus cereus AH1273]
 gi|229022180|ref|ZP_04178730.1| DNA-binding response regulator [Bacillus cereus AH1272]
 gi|228739111|gb|EEL89557.1| DNA-binding response regulator [Bacillus cereus AH1272]
 gi|228745323|gb|EEL95364.1| DNA-binding response regulator [Bacillus cereus AH1273]
          Length = 213

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 39/222 (17%), Positives = 71/222 (31%), Gaps = 16/222 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D       +   +     M  + E   G      V         +D  +      
Sbjct: 4   ILVVDDHAFLRDAIRSILEVESDMKVVGEASSGDEVLGKVEECRPDCILMDINLPGKNGI 63

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +    +     +           L   ++      +       + Y        ++   +
Sbjct: 64  EATGLVKKKYPN--------CRVLVFTMYEHDEYLMDALQSGADGYLLKDSSSEQVVAAI 115

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
            +L+    +I      ++           +        + ELT RE E L  + +G ++ 
Sbjct: 116 RMLYQGDSVIHPRMTKKLIT-------YHQQKMKLESNENELTEREKEILFELVKGLSNK 168

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA  L IS  TV  +I  I +K   K+RS A+ YAVRN +V
Sbjct: 169 EIAEALYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQLV 210


>gi|218232786|ref|YP_002370188.1| DNA-binding response regulator [Bacillus cereus B4264]
 gi|218160743|gb|ACK60735.1| DNA-binding response regulator [Bacillus cereus B4264]
          Length = 215

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/222 (15%), Positives = 71/222 (31%), Gaps = 12/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D    +  L   +S    +  + E   G    + V         +D  +      
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDLELVGEANNGKEALVKVGETNPDVILMDLYMPEMDGV 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +    +     +           +    F      +       + Y     +  ++   +
Sbjct: 65  EATAYIKKEYPN--------VKVIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
              +     +  D    +           +   +       LT RE E L  +++G ++ 
Sbjct: 117 RSAYKGNIQLHPDIANALLSQTLPVEEKEEEPSIQVD---VLTARENEVLQLLAKGMSNK 173

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 174 EIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGIV 215


>gi|56421685|ref|YP_149003.1| two-component response regulator [Geobacillus kaustophilus HTA426]
 gi|56381527|dbj|BAD77435.1| two-component response regulator (extracellular proteinase response
           regulator) [Geobacillus kaustophilus HTA426]
          Length = 224

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 31/231 (13%), Positives = 68/231 (29%), Gaps = 16/231 (6%)

Query: 19  RTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIV 78
           R + +       + + R++  +                G+    +V         +D  +
Sbjct: 4   RIAIIDDHQLFREGIKRILEFEGDFEVVAE-----GSDGSEALSIVETYRPDLVLMDINM 58

Query: 79  SSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVA 138
                 +  + +                 +   +       +         Y     D  
Sbjct: 59  PDINGVEATKQLIE--------AYPDTKVVVLSIHDDEHYVMRALQTGATGYLLKEMDAD 110

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSY---DVHWGKDFELTGREVECLT 195
            +   + ++   G  +       +                          LT RE E L 
Sbjct: 111 TLIEAVRIVAEGGSYLHPKVTHNLIREYRRLTTEKGGAVVKQEVRRPLHLLTRRECEVLQ 170

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            +++GK++  I   L IS  TV N+++SI++K     R+ A+  A++N  V
Sbjct: 171 LLADGKSNRAIGEALYISEKTVKNHVSSILQKLNVNDRTQAVVVAIKNGWV 221


>gi|30023441|ref|NP_835072.1| two-component response regulator yhcZ [Bacillus cereus ATCC 14579]
 gi|228961674|ref|ZP_04123282.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|229051082|ref|ZP_04194629.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH676]
 gi|229112824|ref|ZP_04242356.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock1-15]
 gi|229130659|ref|ZP_04259615.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           BDRD-Cer4]
 gi|229147955|ref|ZP_04276296.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           BDRD-ST24]
 gi|296505833|ref|YP_003667533.1| two-component response regulator yhcZ [Bacillus thuringiensis
           BMB171]
 gi|29899002|gb|AAP12273.1| Two-component response regulator yhcZ [Bacillus cereus ATCC 14579]
 gi|228635605|gb|EEK92094.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           BDRD-ST24]
 gi|228652998|gb|EEL08880.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           BDRD-Cer4]
 gi|228670658|gb|EEL25970.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock1-15]
 gi|228722293|gb|EEL73691.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH676]
 gi|228798024|gb|EEM45029.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|296326885|gb|ADH09813.1| two-component response regulator yhcZ [Bacillus thuringiensis
           BMB171]
          Length = 215

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/222 (15%), Positives = 71/222 (31%), Gaps = 12/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D    +  L   +S    +  + E   G    + V         +D  +      
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDLELVGEANNGKEALVKVGETNPDVILMDLYMPEMDGV 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +    +     +           +    F      +       + Y     +  ++   +
Sbjct: 65  EATAYIKKEYPN--------VKVIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
              +     +  D    +           +   +       LT RE E L  +++G ++ 
Sbjct: 117 RSAYKGNIQLHPDIANALLSQTLPVEEKEEESSIQVD---VLTARENEVLQLLAKGMSNK 173

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 174 EIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGIV 215


>gi|302035554|ref|YP_003795876.1| LuxR family transcriptional regulator [Candidatus Nitrospira
           defluvii]
 gi|300603618|emb|CBK39949.1| Transcriptional regulator, LuxR family [Candidatus Nitrospira
           defluvii]
          Length = 223

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 34/242 (14%), Positives = 80/242 (33%), Gaps = 25/242 (10%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           ++++ +++  +       ++ +    D +  +      V    +   L            
Sbjct: 1   MEKIKVLIADDHRVVREGLAAILKTKDDINVVGEAQDGVEAVEKTKTL------------ 48

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
              +     +D  +      +  R +                 +   ++           
Sbjct: 49  ---MPDVILMDVSMPRMGGIEATRQIKRE--------FPHMGIVALTMYEEQQYIFDLVR 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
                Y     + ++I   +  ++    +I      +I  LA +     K        + 
Sbjct: 98  AGATGYLLKDSESSQIVAAIRAIYRGESLIHPSVASKI--LAEFSLMSQKKGKKPAWVEH 155

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE+  L  +++GKT+ EIA  L +S  TV N++ +I  K     R+ A   A+R  
Sbjct: 156 DLTEREITVLRLVADGKTNKEIANNLDLSEKTVKNHVRNIFHKLQVYDRTQAAILAIRKG 215

Query: 245 IV 246
           ++
Sbjct: 216 LI 217


>gi|146312149|ref|YP_001177223.1| DNA-binding transcriptional activator SdiA [Enterobacter sp. 638]
 gi|145319025|gb|ABP61172.1| transcriptional activator SdiA [Enterobacter sp. 638]
          Length = 240

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 40/231 (17%), Positives = 77/231 (33%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R +   R   +         +   T+ +   ++ L         +    + S +P + + 
Sbjct: 10  RRNCFLRFQEMGSADEVYEELQRQTQALEFDYYSLCVRHPVPFTRPKISIHSSYPAEWIS 69

Query: 89  CMALSEKDKYYNVLQR--PTELFCPVFHTLPENI------TPPAGMDNR----YCSLTFD 136
                       VL+R    +   P    L  +           G+              
Sbjct: 70  QYQSENYYAIDPVLKRENFLQGHLPWTDALFADAQALWDGARDHGLRKGITQCLMLPNHA 129

Query: 137 VARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFK-SYDVHWGKDFELTGREVECLT 195
           +  + +     F K        L    L+      + +  +++    + + + RE E L 
Sbjct: 130 LGFLSVSRTSQFGKMMDSDEIELRLQVLVQMALTTLLRFEHEMVMPPEMKFSKREKEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA     +
Sbjct: 190 WTAEGKTSAEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGFI 240


>gi|167564011|ref|ZP_02356927.1| transcriptional regulator, LuxR family protein [Burkholderia
           oklahomensis EO147]
 gi|167571156|ref|ZP_02364030.1| transcriptional regulator, LuxR family protein [Burkholderia
           oklahomensis C6786]
          Length = 238

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 43/235 (18%), Positives = 75/235 (31%), Gaps = 19/235 (8%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           D+L +             +  +   +G  +F        ++ +      S++P       
Sbjct: 4   DILDQTSSAKTERDIHDILSRIAARLGFDYFFYGTLSDMRKPENPVKTVSNYPMAWQEKY 63

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTL----------PENITPPAGMDNRYCSLTFDVARI 140
             S   +   V++       P+                      G+              
Sbjct: 64  KSSGYIRIDPVVRHCGHRLIPLQWNDGICHCREQRNFMEDARGHGLVAGASFPVHSRHGE 123

Query: 141 RIGLMLLFPKG-------RIILRDRLWEIGLLAAYQANMFKSYDVHWG--KDFELTGREV 191
              L L                     +  L AA+     +             LT RE+
Sbjct: 124 VSILSLASRSAGGTTSLSAKHAPATFAQGALAAAFVREGMERISNRPDHEPSAPLTHREL 183

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ECL WI+ GK+S EIA+ILGIS N V  ++  +M K   ++R  A+  A+ + +V
Sbjct: 184 ECLKWIAAGKSSWEIAMILGISENGVLYHVKKLMAKFDVQSRHLAVLKAMASGVV 238


>gi|297160873|gb|ADI10585.1| putative two-component system response regulator [Streptomyces
           bingchenggensis BCW-1]
          Length = 224

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 34/223 (15%), Positives = 70/223 (31%), Gaps = 7/223 (3%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D           ++    +  + E   G     + R        +D  +     
Sbjct: 4   RVIIVDDQAMVRAGFAALLAAQSDIDVVGEAPDGRQAVDVSRGTHPDVVLMDVRMPEMDG 63

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
            +  R +     D    V  RP  L    F              + +       A +   
Sbjct: 64  LEAARRI----LDPPPGVTHRPKVLMLTTFDVDDYVYEALRAGASGFLLKDAPPADLISA 119

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           + ++     ++       +  +A +             +   LT RE E L  I+ G ++
Sbjct: 120 VRIVAAGEALLAPSVTRRL--IADFARQRPAPRKNFAARRSGLTPRETEVLELIARGLSN 177

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            EIA  L ++  TV  +I  ++ K   + R+ A+ +A  + +V
Sbjct: 178 QEIAESLVLAEQTVKTHIGRVLAKLGLRDRAQAVIFAYESGLV 220


>gi|325067354|ref|ZP_08126027.1| two component transcriptional regulator, LuxR family protein
           [Actinomyces oris K20]
          Length = 244

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 30/237 (12%), Positives = 67/237 (28%), Gaps = 11/237 (4%)

Query: 13  NREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQE 71
             E     S    +    D     +     +     +  + E   G S     R      
Sbjct: 15  GSEHPGEVSGPVSVVLADDQALMRMGFRMVLEAEEDITVVGEASDGTSALAQARALHPDV 74

Query: 72  QKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYC 131
             +D  +      +    +A           +         F              + + 
Sbjct: 75  ILMDVRMPGMNGIEATERIAQE-----CPGTRVL---ILTTFDLDEYAFAGLRAGASGFL 126

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLL--AAYQANMFKSYDVHWGKDFELTGR 189
                   +   +  +     ++       +  +  A+  ++          +   LT R
Sbjct: 127 LKDTRPTELAEAIRTVASGEAVVSPRITQRMLEMFAASLPSSDAPEQSSCDPRIESLTPR 186

Query: 190 EVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E E L  +S+G ++ EIA  L +S  TV  ++ +++ K   + R  A+  A    ++
Sbjct: 187 EKEILVLMSQGMSNAEIAAHLVVSATTVKTHVGNVLAKLDVRDRVQAVVVAYETGLM 243


>gi|188586933|ref|YP_001918478.1| two component transcriptional regulator, LuxR family
           [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179351620|gb|ACB85890.1| two component transcriptional regulator, LuxR family
           [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 228

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 34/240 (14%), Positives = 73/240 (30%), Gaps = 24/240 (10%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + I+L  +       +  +    + LA             ++                  
Sbjct: 10  IRILLADDHALFRQGLKKILDMEEDLAVCGEAQNGEEVVDKVK---------------LL 54

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +  + +          V      +   +               
Sbjct: 55  KPNIILMDINMPLLNGVEATKYVKE--------VSPETKVIALTIHEDEEYLFEIVKEGA 106

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQA-NMFKSYDVHWGKDFEL 186
             +     +   +   +  +      I      ++       A N  ++         EL
Sbjct: 107 AGFLLKDVETPTLVQAIQEVNKGNSFIHPTITHKLLGEFNRLAQNSPRNIKSDEAVQSEL 166

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           TGRE E L  +++G T+ EI+  L IS  TV N++++I+RK     R+ A+  A++  +V
Sbjct: 167 TGREKEILELMAQGYTNKEISKELYISEKTVKNHVSNILRKMDVTDRTQAVITALKCGVV 226


>gi|326202012|ref|ZP_08191882.1| two component transcriptional regulator, LuxR family [Clostridium
           papyrosolvens DSM 2782]
 gi|325987807|gb|EGD48633.1| two component transcriptional regulator, LuxR family [Clostridium
           papyrosolvens DSM 2782]
          Length = 216

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/241 (14%), Positives = 76/241 (31%), Gaps = 27/241 (11%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           + ++ +++  +       +  +    + +  +                    G     + 
Sbjct: 1   MNKIRVMIADDHAMVRQGLKTILELEEDICVVSQASN---------------GEEAVAMS 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
           +        +D  +        ++ +     +           +   +            
Sbjct: 46  KKIRPDIILMDINMPVINGLQAIKMLKQEPVNY--------KIIVLTLHQDREYLFKTLQ 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
                Y     + + +   +  ++     I  +   E+      + N    Y+       
Sbjct: 98  LGCEGYVLKDAESSVLIEAIRSVYHDQTYIQPNMTGEL----VKEFNRVTLYEQDKSIAN 153

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            LT REVE L  I+EG  + EIA  L IS  TV N+I++I +K     R+ A  YA ++N
Sbjct: 154 NLTNREVEVLKLIAEGMINKEIAKTLYISEKTVKNHISNIFKKLDVNDRTQAAIYAFKHN 213

Query: 245 I 245
           I
Sbjct: 214 I 214


>gi|229035051|ref|ZP_04188998.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH1271]
 gi|228728236|gb|EEL79265.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH1271]
          Length = 215

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 38/221 (17%), Positives = 77/221 (34%), Gaps = 10/221 (4%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFD 85
           +    D    +  L   +S    +  + E       L+       E   D ++   +  +
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDLALVGEANNGKEALV----KVGETNPDVVLMDLYMPE 60

Query: 86  LVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLM 145
           +    A +   K Y  ++    +    F      +       + Y     +  ++   + 
Sbjct: 61  MDGVEATTCIKKEYPNVK---VIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAIR 117

Query: 146 LLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDE 205
             +     +  D    +           +   +       LT RE E L  +++G ++ E
Sbjct: 118 SAYKGNIQLHPDIANTLLSQTLPVEEKEEESSIQVD---VLTARENEVLQLLAKGMSNKE 174

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           IA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 175 IASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGIV 215


>gi|289578700|ref|YP_003477327.1| LuxR family transcriptional regulator [Thermoanaerobacter italicus
           Ab9]
 gi|297544934|ref|YP_003677236.1| two component LuxR family transcriptional regulator
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
 gi|289528413|gb|ADD02765.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter italicus Ab9]
 gi|296842709|gb|ADH61225.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
          Length = 205

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 37/218 (16%), Positives = 74/218 (33%), Gaps = 21/218 (9%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPFD 85
               D       L   +     +  +++   G   + L +  +     +D  +       
Sbjct: 2   LVADDHALIRKGLVQLIEMEKDIKVISQASNGEEAYQLAKKFMPDLILMDVNMPVMNGIK 61

Query: 86  LVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLM 145
             + +   +             LF  +++     +         Y     +   +   + 
Sbjct: 62  AAKMLKEEKHP--------SKVLFLTIYNDREYILEALKLGVEGYILKDAEYDDLIKAIR 113

Query: 146 LLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDE 205
            ++  G  I    + EI  +             H     +LT RE+E L  IS+G ++ E
Sbjct: 114 TIYNGGVYIHPSLMEEIDNI------------DHENLKKDLTPREIEILKLISKGYSNKE 161

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           IA  L +S  TV N++ +I +K   K R+ A  Y ++N
Sbjct: 162 IAQKLFLSEKTVKNHVYNIFKKLDVKDRTQAAIYMLKN 199


>gi|163943094|ref|YP_001647978.1| two component LuxR family transcriptional regulator [Bacillus
           weihenstephanensis KBAB4]
 gi|229014574|ref|ZP_04171690.1| Two component transcriptional regulator, LuxR [Bacillus mycoides
           DSM 2048]
 gi|229065062|ref|ZP_04200357.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH603]
 gi|229136229|ref|ZP_04264978.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           BDRD-ST196]
 gi|229170116|ref|ZP_04297805.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH621]
 gi|163865291|gb|ABY46350.1| two component transcriptional regulator, LuxR family [Bacillus
           weihenstephanensis KBAB4]
 gi|228613347|gb|EEK70483.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH621]
 gi|228647209|gb|EEL03295.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           BDRD-ST196]
 gi|228716204|gb|EEL67920.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH603]
 gi|228746726|gb|EEL96613.1| Two component transcriptional regulator, LuxR [Bacillus mycoides
           DSM 2048]
          Length = 215

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 40/222 (18%), Positives = 74/222 (33%), Gaps = 12/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D    +  L   +S       + E   G    + V         +D  +      
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDFELVGEANNGKEALVKVGETSPDVVLMDLYMPEMDGI 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +   C+     +           +    F      +       + Y     +  ++   +
Sbjct: 65  EATACIKKEYPN--------VKVIVLTSFSDQAHVLPALKAGASGYILKDIEPDQLVEAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
              +     +  D      LL+       K  +     D  LT RE E L  +++G ++ 
Sbjct: 117 RSAYKGNIQLHPDIAN--ALLSQTLPQEEKEEEPSVQVDV-LTARENEVLQLLAKGMSNK 173

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 174 EIASVLVITEKTVKAHMSSILSKLHLSDRTQAALYAVKNGIV 215


>gi|225862611|ref|YP_002747989.1| transcriptional regulatory protein DegU [Bacillus cereus 03BB102]
 gi|225789899|gb|ACO30116.1| transcriptional regulatory protein DegU [Bacillus cereus 03BB102]
          Length = 213

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 75/239 (31%), Gaps = 30/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + I++  +       +  +      +  +           ++ A                
Sbjct: 2   IKILVVDDHAFLRDAIRSILEDESDMNVVGEASSGDGVLEKVEA---------------C 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +    +  +  +           L   ++      +       
Sbjct: 47  RPDCILMDINLPGKNGIEATELVKKNYPN--------CRVLVFTMYEHDEYLMDALQAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + Y        ++   + +L+    +I      ++           +        + ELT
Sbjct: 99  DGYLLKDSSSEQVVAAIRMLYRGDSVIHPRMTKKLIT-------YHQQKMKVESNENELT 151

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  + +G ++ EIA  L IS  TV  +I  I +K   K+RS A+ YAVRN +V
Sbjct: 152 EREKEILFELVKGLSNKEIAEALYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQLV 210


>gi|312199008|ref|YP_004019069.1| LuxR family transcriptional regulator [Frankia sp. EuI1c]
 gi|311230344|gb|ADP83199.1| two component transcriptional regulator, LuxR family [Frankia sp.
           EuI1c]
          Length = 239

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 38/234 (16%), Positives = 73/234 (31%), Gaps = 11/234 (4%)

Query: 13  NREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQE 71
              D  R +    +    D    +  L   +     +  +     G     L        
Sbjct: 12  AEADPIRQTSPIRVLVVDDHELFLQGLQTVLEIEDDIRVVGRAGNGQEAVSLAAGTTPDI 71

Query: 72  QKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYC 131
             +D  +           +           +     +   V     +           Y 
Sbjct: 72  VLMDVRMPLRDGIAATGGVKR--------AVPGVKIVMLTVSDEENDLFEAIKAGAVGYL 123

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREV 191
             +     +   +  +     +I      ++  +A + +    + D        LT RE+
Sbjct: 124 LKSIPPHEVADAVRSVHHGQSLISPSMASKL--MAEFASIARGTDDRPRLHTPHLTAREL 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           E L  ++EG+ + EIA  L IS NTV N++ +I+ K    +R  A+ YAVR  +
Sbjct: 182 EVLKLVAEGRANREIARKLFISENTVKNHVRNILDKLQLHSRMEAVMYAVRQGL 235


>gi|227497785|ref|ZP_03927971.1| response regulator [Actinomyces urogenitalis DSM 15434]
 gi|226832785|gb|EEH65168.1| response regulator [Actinomyces urogenitalis DSM 15434]
          Length = 246

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 31/236 (13%), Positives = 67/236 (28%), Gaps = 10/236 (4%)

Query: 13  NREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQE 71
            + D    S    +    D     +     +     +  + E   GAS     R      
Sbjct: 18  AQGDSAVPSRPVSVVLADDQALMRMGFRMVLDAEEGIEVVGEASDGASALAQARALHPDV 77

Query: 72  QKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYC 131
             +D  +      +    +            +         F                + 
Sbjct: 78  ILMDVRMPGMNGIEATEAITQQ-----CPGTKIL---ILTTFDLDEYAFAGLRAGAAGFL 129

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWE-IGLLAAYQANMFKSYDVHWGKDFELTGRE 190
                 A +   +  +     ++        + + A++             +   LT RE
Sbjct: 130 LKDTRPAELAEAIRTVASGEAVVSPRVTRRMLEMFASHLPQDGAQDAAEDPRIASLTPRE 189

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            E L  I++G ++ EIA  L +S  TV  ++ +++ K   + R  A+  A    ++
Sbjct: 190 REILVLIAQGMSNSEIADQLVVSATTVKTHVGNVLAKLDVRDRVQAVVVAYETGLM 245


>gi|62822972|gb|AAY15207.1| transcriptional activator PhzR [Pseudomonas chlororaphis]
          Length = 241

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 39/225 (17%), Positives = 78/225 (34%), Gaps = 14/225 (6%)

Query: 36  MIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEK 95
                    +T         +    F      +    +  + +  ++P D V+    +  
Sbjct: 17  FARTMDMQEFTAVALRALRELRFDFFAYGMCSVTPFMRPRTYMYGNYPEDWVQRYQAANY 76

Query: 96  DKYYNVLQRPTELFCPVFHT--------LPENITPPAGMDNRYCSLTFDVARIRIGLMLL 147
                 ++       P+  +           +    + + +     +F+       L L 
Sbjct: 77  AVIDPTVKHSKVSSAPILWSNELFRGCADLWSEAKDSHLCHGLAQPSFNAQGRVGVLSLA 136

Query: 148 FPKGRIILRD------RLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGK 201
                I L++              A  + +  +S    +    E +GRE + L W ++GK
Sbjct: 137 RKNNPISLQEFEALKPVTRAFAAAAHEKISELESDVRVFNTGVEFSGRECDVLRWTADGK 196

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           TS+EI VI+G+  +TVN +  +I RK     R  A++YAV    +
Sbjct: 197 TSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAVAMGYI 241


>gi|206970021|ref|ZP_03230974.1| DNA-binding response regulator [Bacillus cereus AH1134]
 gi|229193664|ref|ZP_04320607.1| Two component transcriptional regulator, LuxR [Bacillus cereus ATCC
           10876]
 gi|206734598|gb|EDZ51767.1| DNA-binding response regulator [Bacillus cereus AH1134]
 gi|228589817|gb|EEK47693.1| Two component transcriptional regulator, LuxR [Bacillus cereus ATCC
           10876]
          Length = 215

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/222 (15%), Positives = 71/222 (31%), Gaps = 12/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D    +  L   +S    +  + E   G    + V         +D  +      
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDLELVGEANNGKEALVKVGETTPDVILMDLYMPEMDGV 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +    +     +           +    F      +       + Y     +  ++   +
Sbjct: 65  EATAYIKKEYPN--------VKVIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
              +     +  D    +           +   +       LT RE E L  +++G ++ 
Sbjct: 117 RSAYKGNIQLHPDIANALLSQTLPVEEKEEEPSIQVD---VLTARENEVLQLLAKGMSNK 173

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 174 EIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGIV 215


>gi|47568085|ref|ZP_00238790.1| DNA-binding response regulator [Bacillus cereus G9241]
 gi|229042495|ref|ZP_04190240.1| DNA-binding response regulator [Bacillus cereus AH676]
 gi|229108243|ref|ZP_04237865.1| DNA-binding response regulator [Bacillus cereus Rock1-15]
 gi|229194950|ref|ZP_04321731.1| DNA-binding response regulator [Bacillus cereus m1293]
 gi|47555239|gb|EAL13585.1| DNA-binding response regulator [Bacillus cereus G9241]
 gi|228588518|gb|EEK46555.1| DNA-binding response regulator [Bacillus cereus m1293]
 gi|228675259|gb|EEL30481.1| DNA-binding response regulator [Bacillus cereus Rock1-15]
 gi|228726848|gb|EEL78060.1| DNA-binding response regulator [Bacillus cereus AH676]
          Length = 213

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 74/239 (30%), Gaps = 30/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + I++  +       +  +      +  +           ++                  
Sbjct: 2   IKILVVDDHAFLRDAIRSILEDESDMKVVGEASSGDEVLGKVEECG-------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +    +          +      L   ++      +       
Sbjct: 48  -PDCILMDINLPGKNGIEATELVKK--------IYPSCRVLVFTMYEHDEYLMDALQAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + Y        ++   + +L+    +I      ++           +        + ELT
Sbjct: 99  DGYLLKDSSSEQVVAAIRMLYRGDSVIHPRMTKKLIT-------YHQQKMKVESNENELT 151

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  + +G ++ EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN +V
Sbjct: 152 EREKEILFELVKGLSNKEIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQLV 210


>gi|45259344|emb|CAF32980.1| uR protein [Pseudomonas putida]
          Length = 238

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 43/227 (18%), Positives = 76/227 (33%), Gaps = 14/227 (6%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           D L R+  ++    W   +  LT  +G S+FL+       +   + ++ SD+P       
Sbjct: 7   DELLRLNEMERFEDWLAHLKILTRKLGYSNFLIGLKPAPTDANQEVLIYSDYPDAWRTRY 66

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTL----------PENITPPAGMDNRYCSLTFDVARI 140
                     V+Q        +                      G+              
Sbjct: 67  DAESYAAVDPVVQHCLNANRALLWDRDNYRRPSESEFFEEAAAHGLQQGLALPLHGPRGE 126

Query: 141 RIGLML----LFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTW 196
              L L      P+    + + L    LL  Y         +       LT RE E L W
Sbjct: 127 AGMLCLKPSESGPQATATMIESLPTATLLRDYAMEGMLKARIECSTPVHLTSREKEVLQW 186

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
            + GKT+ EI++IL  + + ++ +  +I RK    +R  A+  A++ 
Sbjct: 187 SAAGKTTWEISMILSCTTSAIDFHFKNIRRKFQVSSRQMAVLKAIQQ 233


>gi|228924157|ref|ZP_04087433.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228835647|gb|EEM81012.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
          Length = 214

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 36/222 (16%), Positives = 71/222 (31%), Gaps = 13/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D    +  L   +S    +  + E   G    + V         +D  +      
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDLELVGEANNGKEALVKVGETNPDVILMDLYMPEMDGV 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +    +     +           +    F      +       + Y     +  ++   +
Sbjct: 65  EATAYIKKEYPN--------VKVIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
              +     +  D    + L         +           LT RE E L  +++G ++ 
Sbjct: 117 RSAYKGNIQLHPDIANAL-LSQTLPVEEKEEEPSIVD---VLTARENEVLQLLAKGMSNK 172

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 173 EIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGIV 214


>gi|254385060|ref|ZP_05000394.1| two-component system response regulator [Streptomyces sp. Mg1]
 gi|194343939|gb|EDX24905.1| two-component system response regulator [Streptomyces sp. Mg1]
          Length = 224

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 34/239 (14%), Positives = 73/239 (30%), Gaps = 23/239 (9%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  +     +    +      LA +      +    ++ AL               
Sbjct: 3   IRVLLVDDQPLLRTGFRMILEAEQDLAVVGEAGDGLQALDQVRAL--------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +  R +    +D           L    F      +       
Sbjct: 48  QPDVVLMDIRMPRMDGVEATRQITGPGRDG------PAKVLVLTTFDLDEYVVEALRAGA 101

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +         +   + ++     ++       +  L  Y  ++    D        LT
Sbjct: 102 SGFLLKDAPANELVQAIRVVAAGEAMLAPSITRRL--LDKYAGHLPSGEDSVPNTLGTLT 159

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            REVE L  ++ G ++ EIA  L +S  TV  ++  ++ K   + R  A  YA  + +V
Sbjct: 160 EREVEVLKLVARGLSNAEIAADLFVSETTVKTHVGHVLTKLGLRDRVQAAVYAYESGLV 218


>gi|238024809|ref|YP_002909041.1| AHL receptor [Burkholderia glumae BGR1]
 gi|55509000|gb|AAV52804.1| AHL receptor [Burkholderia glumae BGR1]
 gi|237879474|gb|ACR31806.1| AHL receptor [Burkholderia glumae BGR1]
          Length = 239

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 38/235 (16%), Positives = 75/235 (31%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       ++ A ++ +G  +            +    +   +P   
Sbjct: 3   LRWQDAYHQFNTAENEQQLFHQVSAYSKRLGFEYCCYGIRVPQPGSQPLVEIFDTYPPGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI--------TPPAGMDNRYCSLTFDVA 138
           +         +    ++        +     +              GM       +   A
Sbjct: 63  MAHYQARNYIEIDPTVRDGAASPNMIIWPDADAAEQPSLWRDARDFGMSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQAN-------MFKSYDVHWGKDFELTGREV 191
           R   GL+ +  +   +    +  + L A + AN        F    +       LT RE 
Sbjct: 122 RGVFGLLTIARRSDRLTPAEINSLTLQANWLANLSHSLMGRFLVPKLSPAASISLTKRER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L+W SEG+T+ EI   L IS  TV  +I +I+ K     +  A+  A+   ++
Sbjct: 182 EVLSWTSEGRTASEIGEQLNISERTVTFHINNILAKLGAANKVQAVVKAIGMGLI 236


>gi|327190710|gb|EGE57792.1| putative transcriptional regulator protein, LuxR family [Rhizobium
           etli CNPAF512]
          Length = 240

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 88/226 (38%), Gaps = 18/226 (7%)

Query: 37  IPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI-VSSDWPFDLVRCMALSEK 95
                       M  LT+ +G + FL++        ++ +  + ++WP ++V        
Sbjct: 15  AGFKTHYEVFKFMKGLTQDLGMTAFLIMTLPTVDFVEIGATKIITNWPAEMVDYYDAHNL 74

Query: 96  DKYYNVLQRPTELFCPVFHTLPE--------------NITPPAGMDNRYCSLTFDVARIR 141
                V++R      P  + +                ++    GM+        D A  R
Sbjct: 75  MVDSPVIRRMLRSTSPFNYDVEAINTDRGEGKKSTVIDLFRRYGMEKGAYFPVHDAAGGR 134

Query: 142 IGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYD-VHWGKDFELTGREVECLTWISEG 200
             + +   +   +L   + +I  +A    +           K    T  E++CL   + G
Sbjct: 135 GAMSISGSRNFTML--EMAKILFIATLIYDRLSQLTLNEKHKPIAFTSSELDCLRLTAGG 192

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + S EIA +L +S N VNN+I S+++K    TR+ A+  A+R NI+
Sbjct: 193 RKSSEIAKLLDLSENAVNNHIGSVIKKLGCTTRTQAVVSALRLNII 238


>gi|291453746|ref|ZP_06593136.1| two-component system response regulator [Streptomyces albus J1074]
 gi|291356695|gb|EFE83597.1| two-component system response regulator [Streptomyces albus J1074]
          Length = 267

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 32/242 (13%), Positives = 76/242 (31%), Gaps = 25/242 (10%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           ++ + +++  +       +  +    + +  +                    GA      
Sbjct: 48  VEPIRVLVVDDHALFRRGLEIVLEAEEDIEVIGEAGD---------------GAEAVEKA 92

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
              L     +D  +      +    +          V      +   +     +      
Sbjct: 93  ADLLPDIVLMDVRMPKRGGIEACTAIKE--------VAPSAKIIMLTISDEEADLYEAIK 144

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
                Y         +   +  +      I      ++  L  +++ + ++ +       
Sbjct: 145 AGATGYLLKEISTDEVATAIRAVADGQSQISPSMASKL--LTEFKSMIQRTDERRLVPAP 202

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            LT RE+E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  
Sbjct: 203 RLTDRELEVLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREK 262

Query: 245 IV 246
           I+
Sbjct: 263 IL 264


>gi|1706361|sp|P54662|DEGU_BREBE RecName: Full=Transcriptional regulatory protein degU
 gi|710496|gb|AAC41439.1| transcriptional activator protein [Brevibacillus brevis]
          Length = 236

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 39/254 (15%), Positives = 82/254 (32%), Gaps = 29/254 (11%)

Query: 1   MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASH 60
           MN   +QVN     E++ +   +       + + R++ ++                G + 
Sbjct: 1   MN---EQVN-----ENKIQIVIIDDHQLFREGVKRILAMEPEFEVVADGE-----DGENA 47

Query: 61  FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI 120
             LV         +D  +      +  R     +  + Y  ++        +        
Sbjct: 48  VELVEKYNPDVILMDINMPKVNGVEATR-----DLIQRYPDVKVL---VLSIHDDESYVT 99

Query: 121 TPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW 180
                  + Y     D   +   + ++   G  I       +        N  +      
Sbjct: 100 HVLKTGASGYLLKEMDADALIEAVKVVAQGGAYIHPKVTHNLIKEYRRLVNEDEQESSEI 159

Query: 181 G--------KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKT 232
           G            LT RE E L  +++G ++  I   L IS  TV N++++I++K     
Sbjct: 160 GFKEVEYRKPLHILTRRECEVLQLMTDGYSNRMIGEALYISEKTVKNHVSNILQKMNVND 219

Query: 233 RSGAIAYAVRNNIV 246
           R+ A+  +++N  V
Sbjct: 220 RTQAVVESIKNGWV 233


>gi|229114235|ref|ZP_04243656.1| DNA-binding response regulator [Bacillus cereus Rock1-3]
 gi|228669255|gb|EEL24676.1| DNA-binding response regulator [Bacillus cereus Rock1-3]
          Length = 213

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 39/222 (17%), Positives = 72/222 (32%), Gaps = 16/222 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL-VRWDLFQEQKLDSIVSSDWPF 84
           +    D       +   +     M  + E       L  V         +D  +      
Sbjct: 4   ILVVDDHAFLRDAIRNILEDESDMKVVGEASSGDGVLGKVEECRPDCILMDINLPGKNGI 63

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +    +  +  +           L   ++      +       + Y        ++   +
Sbjct: 64  EATDLVKKNYPN--------CRVLVFTMYEHDEYLMDALQAGADGYLLKDSSSEQVVAAI 115

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
            +L+    +I      ++           +        + ELT RE E L  + +G ++ 
Sbjct: 116 RMLYRGDSVIHPRMTKKLIT-------YHQQKMKLESNENELTEREKEILFELVKGLSNK 168

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA  L IS  TV  +I  I +K   K+RS A+ YAVRN +V
Sbjct: 169 EIAEALYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQLV 210


>gi|229143361|ref|ZP_04271792.1| DNA-binding response regulator [Bacillus cereus BDRD-ST24]
 gi|228640168|gb|EEK96567.1| DNA-binding response regulator [Bacillus cereus BDRD-ST24]
          Length = 213

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 74/239 (30%), Gaps = 30/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + I++  +       +  +      +  +           ++                  
Sbjct: 2   IKILVVDDHAFLRDAIRSILEDESDMKVVGEASSGDEVLGKVEECG-------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +    +          +      L   ++      +       
Sbjct: 48  -PDCILMDINLPGKNGIEATELVKK--------IYPSCRVLVFTMYEHDEYLMDALQAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + Y        ++   + +L+    +I      ++           +        + ELT
Sbjct: 99  DGYLLKDSSSEQVVAAIRMLYRGDSVIHPRMTKKLIT-------YHQQKMKVESNENELT 151

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  + +G ++ EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN +V
Sbjct: 152 EREKEILFELVKGLSNKEIAKVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQLV 210


>gi|206972973|ref|ZP_03233895.1| transcriptional regulatory protein DegU [Bacillus cereus AH1134]
 gi|228924979|ref|ZP_04088109.1| DNA-binding response regulator [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|229182326|ref|ZP_04309600.1| DNA-binding response regulator [Bacillus cereus 172560W]
 gi|229194039|ref|ZP_04320933.1| DNA-binding response regulator [Bacillus cereus ATCC 10876]
 gi|206731857|gb|EDZ49057.1| transcriptional regulatory protein DegU [Bacillus cereus AH1134]
 gi|228589439|gb|EEK47364.1| DNA-binding response regulator [Bacillus cereus ATCC 10876]
 gi|228601135|gb|EEK58682.1| DNA-binding response regulator [Bacillus cereus 172560W]
 gi|228834642|gb|EEM80151.1| DNA-binding response regulator [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 213

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 39/222 (17%), Positives = 72/222 (32%), Gaps = 16/222 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL-VRWDLFQEQKLDSIVSSDWPF 84
           +    D       +   +     M  + E       L  V         +D  +      
Sbjct: 4   ILVVDDHAFLRDAIRSILEDESDMKVVGEASSGDGVLGKVEECGPDCILMDINLPGKNGI 63

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +    +     +           L   ++      +       + Y        ++   +
Sbjct: 64  EATELVKKKYPN--------CRVLVFTMYEHDEYLMDALQAGADGYLLKDSSSEQVVAAI 115

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
            +L+    +I      ++           +        + ELT RE E L  + +G ++ 
Sbjct: 116 RMLYRGDSVIHPRMTKKLIT-------YHQQKMKVESNENELTEREKEILFELVKGLSNK 168

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN +V
Sbjct: 169 EIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQLV 210


>gi|9297072|sp|P74946|VANR_VIBAN RecName: Full=Transcriptional activator protein vanR
 gi|1568660|gb|AAC45213.1| VanR [Listonella anguillarum]
          Length = 240

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 35/225 (15%), Positives = 73/225 (32%), Gaps = 15/225 (6%)

Query: 37  IPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKD 96
             +         +  L   +G   FL         +  +++V+ ++P    +    S   
Sbjct: 12  QQITSHDDLENVLNGLNNLIGHEFFLFGLSFQPTLKTSETLVTDNYPNSWRQQYDESGFM 71

Query: 97  KYYNVLQRPTELFCPVFHTLP----------ENITPPAGMDNRYCSLTFDVARIRIGLML 146
               +++     F P+                      G+   +      +      +  
Sbjct: 72  HIDPIVKYSITNFLPIRWDDAKRVNNDGRVIFEEARCNGLKAGFSIPIHGLRGEFGMISF 131

Query: 147 LFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWG---KDFELTGREVECLTWISEGK 201
                +   + +  +    L+    A+   +   +         LT REV+CL W +EGK
Sbjct: 132 ATSDTKSYDLNQQSIHTSQLIVPLLAHNIGNITRYHKDAKPRAVLTAREVQCLAWAAEGK 191

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++ EIA I+  S  TV  + ++  +K     R  AI  A+    +
Sbjct: 192 SAWEIATIINTSERTVKFHFSNACKKLGATNRYQAITKAILGGYI 236


>gi|222149185|ref|YP_002550142.1| transcriptional regulator protein [Agrobacterium vitis S4]
 gi|221736170|gb|ACM37133.1| transcriptional regulator protein [Agrobacterium vitis S4]
          Length = 243

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 42/232 (18%), Positives = 77/232 (33%), Gaps = 18/232 (7%)

Query: 32  LLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD---LFQEQKLDSIVSSDWPFDLVR 88
            L+++   D   +        T   G  + +L       +   Q++  I+ +DWP +   
Sbjct: 12  FLSQIKQTDTVKNLVDLTKHATSRYGVKNIVLGFPPEIGMLPSQQMQGILLADWPDEWSH 71

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLP-------------ENITPPAGMDNRYCSLTF 135
                        ++           +                +      + N +     
Sbjct: 72  LYFRDNLAFQDPAIRHIVSSEPSFVWSDFSKTLPISRDEKWLMDQAKEFFVSNGFTLPIL 131

Query: 136 DVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSY-DVHWGKDFELTGREVECL 194
            +   R G+                 + L+A+            +  +   LT RE E +
Sbjct: 132 SLDGRRAGVTFAGS-DIDDSPQARTGMALIASLVFARALELYGANQKQTTRLTPREREVI 190

Query: 195 TWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            WI+ GKT  EI+VI G+S   V  ++ +IM K    +RS AIA A R  ++
Sbjct: 191 GWIANGKTDWEISVIFGVSEKAVTKHVGNIMMKLGAVSRSHAIAEAFRQKLI 242


>gi|59940155|gb|AAX12616.1| LuxR-type transcriptional regulator [Aeromonas sp. 13m]
          Length = 260

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 44/238 (18%), Positives = 82/238 (34%), Gaps = 20/238 (8%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           + + L     +         +   T  +G  ++          Q+   ++ +  P   V+
Sbjct: 6   QLEYLEHFTSVTDGDRLAELIGRFTLGMGYDYYRFALIIPMSMQRPKVVLFNQCPDSWVQ 65

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLPENI--------------TPPAGMDNRYCSLT 134
               +       ++Q   +   P++    +                    G+ N      
Sbjct: 66  AYTANHMLACDPIIQLARKQTLPIYWNRLDERARFLQEGSLDVMGLAAEFGLRNGISFPL 125

Query: 135 FDVARIRIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE----LTG 188
              A     L  +  +     +L +    +  ++ Y             ++ +    LT 
Sbjct: 126 HGAAGENGILSFITAERASSDLLLESSPILSWMSNYIFEAAIRIVRVSLREDDPQEALTD 185

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE ECL   SEGKTS +IA IL I+  TVN ++  + RKT +  R  AIA  V + I+
Sbjct: 186 RETECLFCASEGKTSGDIACILRITERTVNYHLNHVTRKTVSMNRYQAIAKGVSSGIL 243


>gi|15616190|ref|NP_244495.1| two-component response regulator involved in degradative enzyme
           [Bacillus halodurans C-125]
 gi|10176252|dbj|BAB07347.1| two-component response regulator involved in degradative enzyme
           [Bacillus halodurans C-125]
          Length = 236

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 39/254 (15%), Positives = 82/254 (32%), Gaps = 29/254 (11%)

Query: 1   MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASH 60
           MN   +QVN     E++ +   +       + + R++ ++                G + 
Sbjct: 1   MN---EQVN-----ENKIQIVIIDDHQLFREGVKRILAMEPEFEVVADGE-----DGENA 47

Query: 61  FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI 120
             LV         +D  +      +  R     +  + Y  ++        +        
Sbjct: 48  VELVETYNPDVILMDINMPKVNGVEATR-----DLIQRYPDVKVL---VLSIHDDESYVT 99

Query: 121 TPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW 180
                  + Y     D   +   + ++   G  I       +        N  +      
Sbjct: 100 HVLKTGASGYLLKEMDADALIEAVKVVAQGGAYIHPKVTHNLIKEYRRLVNEDEQESSEI 159

Query: 181 G--------KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKT 232
           G            LT RE E L  +++G ++  I   L IS  TV N++++I++K     
Sbjct: 160 GFKEVEYRKPLHILTRRECEVLQLMTDGYSNRMIGEALYISEKTVKNHVSNILQKMNVND 219

Query: 233 RSGAIAYAVRNNIV 246
           R+ A+  +++N  V
Sbjct: 220 RTQAVVESIKNGWV 233


>gi|134293938|ref|YP_001117674.1| LuxR family transcriptional regulator [Burkholderia vietnamiensis
           G4]
 gi|134137095|gb|ABO58209.1| transcriptional regulator, LuxR family [Burkholderia vietnamiensis
           G4]
          Length = 239

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 75/235 (31%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       R+ A ++ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYQQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVA 138
           +         +  + ++        +                    G+       +   A
Sbjct: 63  MAHYQARNYIEIDSTVREGALSTNMIVWPDVDRIDPCPLWEDARDFGLAVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       L+    + F    +       LT RE 
Sbjct: 122 RGAFGLLSISRHADRLTPAEINMLTLQTNWLANLSHSLMSRFMLPKLSPAAGVTLTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K A   +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLAATNKVQAVVKAIAAGLI 236


>gi|312132943|ref|YP_004000282.1| response regulator [Bifidobacterium longum subsp. longum BBMN68]
 gi|311773923|gb|ADQ03411.1| Putative response regulator [Bifidobacterium longum subsp. longum
           BBMN68]
          Length = 248

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 41/261 (15%), Positives = 78/261 (29%), Gaps = 33/261 (12%)

Query: 4   EIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL 63
           E Q++ +V+  + E   +  + +      +A                      GA    L
Sbjct: 3   EEQKIRVVIADDQELVRAGFAMVIGSQPDMAVAAQARD---------------GAEAVAL 47

Query: 64  VRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQ----RPTELFCPVFHTLPEN 119
                     +D  +      +  R ++  +     +  Q        +    F      
Sbjct: 48  AETLHPDVVLMDVRMPGMDGIEATRQISALQHRFAADGTQSEVTHTKVIILTTFDLDEYV 107

Query: 120 ITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVH 179
           +       + +     +   +   +  +F    II       +         M  +    
Sbjct: 108 MAAITAGASGFLLKDTEPETLLNSIRTVFQGNAIIAPSATKRLIEKMMEGDFMAANVGRP 167

Query: 180 WGKDF--------------ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIM 225
                              ELT RE E L  I+ G ++ EIA  L IS  TV  ++A I+
Sbjct: 168 ENSATTSATDSTYTDPELDELTDREREVLIEIAHGLSNQEIADKLFISLPTVKTHVAHIL 227

Query: 226 RKTATKTRSGAIAYAVRNNIV 246
            K   + R  A+ +A  N++V
Sbjct: 228 SKINARDRVQAVVFAYENHLV 248


>gi|229079676|ref|ZP_04212209.1| DNA-binding response regulator [Bacillus cereus Rock4-2]
 gi|228703516|gb|EEL55969.1| DNA-binding response regulator [Bacillus cereus Rock4-2]
          Length = 213

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 43/217 (19%), Positives = 78/217 (35%), Gaps = 16/217 (7%)

Query: 36  MIPLDCTVSWTMRMYALTEY------VGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRC 89
           ++ +D        + ++ E       VG +          +E + D I+      +    
Sbjct: 4   ILVVDDHAFLRDAIRSILEDESDMKVVGEASSGDGVLGKVEECRPDCILMDINLPEKNGI 63

Query: 90  MALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFP 149
            A     K Y        L   ++      +       + Y        ++   + +L+ 
Sbjct: 64  EATELVKKKYPS---CRVLVFTMYEHDEYLMDALQAGADGYLLKDSSSDQVVAAIRMLYR 120

Query: 150 KGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVI 209
              +I      ++           +        + ELT RE E L  + +G ++ EIA +
Sbjct: 121 GDSVIHPRMTKKLIT-------YHQQKMKVESNENELTEREKEILFELVKGLSNKEIAEV 173

Query: 210 LGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L IS  TV  +I  I +K   K+RS A+ YAVRN +V
Sbjct: 174 LYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQLV 210


>gi|301052287|ref|YP_003790498.1| transcriptional regulator [Bacillus anthracis CI]
 gi|300374456|gb|ADK03360.1| transcriptional regulator [Bacillus cereus biovar anthracis str.
           CI]
          Length = 213

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 39/222 (17%), Positives = 73/222 (32%), Gaps = 16/222 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL-VRWDLFQEQKLDSIVSSDWPF 84
           +    D       +   +     M  + E       L  V         +D  +      
Sbjct: 4   ILVVDDHAFLRDAIRSILEDESDMKVVGEASSGDGVLKKVEECRPDCILMDINLPGKNGI 63

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +    +  +  +           L   ++      +       + Y        ++   +
Sbjct: 64  EATELVKKNYPN--------CRVLVFTMYEHDEYLMDALQAGADGYLLKDSSSEQVVAAI 115

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
            +L+    +I      ++           +        + ELT RE E L  + +G ++ 
Sbjct: 116 RMLYRGDSVIHPRMTKKLIT-------YHQQKMKVESNENELTEREKEILFELVKGLSNK 168

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN +V
Sbjct: 169 EIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQLV 210


>gi|229074417|ref|ZP_04207449.1| DNA-binding response regulator [Bacillus cereus Rock4-18]
 gi|229095286|ref|ZP_04226278.1| DNA-binding response regulator [Bacillus cereus Rock3-29]
 gi|229101393|ref|ZP_04232137.1| DNA-binding response regulator [Bacillus cereus Rock3-28]
 gi|228682098|gb|EEL36231.1| DNA-binding response regulator [Bacillus cereus Rock3-28]
 gi|228688145|gb|EEL42031.1| DNA-binding response regulator [Bacillus cereus Rock3-29]
 gi|228708701|gb|EEL60842.1| DNA-binding response regulator [Bacillus cereus Rock4-18]
          Length = 213

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 39/222 (17%), Positives = 72/222 (32%), Gaps = 16/222 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL-VRWDLFQEQKLDSIVSSDWPF 84
           +    D       +   +     M  + E       L  V         +D  +      
Sbjct: 4   ILVVDDHAFLRDAIRNILEDESDMKVVGEASSGDGVLGKVEECRPDCILMDINLPGKNGI 63

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +    +  +  +           L   ++      +       + Y        ++   +
Sbjct: 64  EATELVKKNYPN--------CRVLVFTMYEHDEYLMDALQAGADGYLLKDSSSEQVVAAI 115

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
            +L+    +I      ++           +        + ELT RE E L  + +G ++ 
Sbjct: 116 RMLYRGDSVIHPRMTKKLIT-------YHQQKMKLESNENELTEREKEILFELVKGLSNK 168

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA  L IS  TV  +I  I +K   K+RS A+ YAVRN +V
Sbjct: 169 EIAEALYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQLV 210


>gi|229010064|ref|ZP_04167278.1| DNA-binding response regulator [Bacillus mycoides DSM 2048]
 gi|229136711|ref|ZP_04265367.1| DNA-binding response regulator [Bacillus cereus BDRD-ST196]
 gi|228646748|gb|EEL02927.1| DNA-binding response regulator [Bacillus cereus BDRD-ST196]
 gi|228751197|gb|EEM01009.1| DNA-binding response regulator [Bacillus mycoides DSM 2048]
          Length = 213

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 39/222 (17%), Positives = 72/222 (32%), Gaps = 16/222 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL-VRWDLFQEQKLDSIVSSDWPF 84
           +    D       +   +     M  + E       L  V         +D  +      
Sbjct: 4   ILVVDDHAFLRDAIRSILEDESDMKVVGEASSGDGVLGKVEECRPDCILMDINLPGKNGI 63

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +    +  +  +           L   ++      +       + Y        ++   +
Sbjct: 64  EATELVKKNYPN--------CRVLVFTMYEHDEYLMDALQAGADGYLLKDSSSEQVIAAI 115

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
            +L+    +I      ++           +        + ELT RE E L  + +G ++ 
Sbjct: 116 RMLYRGDSVIHPRMTKKLIT-------YHQQKMKLESNENELTEREKEILFELVKGLSNK 168

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA  L IS  TV  +I  I +K   K+RS A+ YAVRN +V
Sbjct: 169 EIAEALYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQLV 210


>gi|167839488|ref|ZP_02466172.1| autoinducer-binding transcriptional regulator BpsR [Burkholderia
           thailandensis MSMB43]
          Length = 239

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 37/235 (15%), Positives = 75/235 (31%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       ++ A T+ +G  +            +    +   +P   
Sbjct: 3   LRWQDAYLQFSAAENEQQLFQQIAAYTKRLGFEYCCYGIRVPLPISRPVVAIFDTYPNGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFH--------TLPENITPPAGMDNRYCSLTFDVA 138
           +         +    ++        +          T   +     G+       +   +
Sbjct: 63  MERYQEMNYLEVDPTVREGALSSNMIVWPEASACDATSLWSDARDHGLAVGVAQ-SSWAS 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       ++    + F    +       LT RE 
Sbjct: 122 RGVFGLLTIARHTDRLTIAEINHLTLQTNWLANMSHSLMSRFLVPKLAPESGVALTHRER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W  EGKT+ EI  ILGIS  TVN ++ +++ K     +  A+  A+   +V
Sbjct: 182 EVLCWTGEGKTACEIGQILGISERTVNFHVNNVLDKLGATNKVQAVVKAIAMGLV 236


>gi|118476319|ref|YP_893470.1| DNA-binding response regulator [Bacillus thuringiensis str. Al
           Hakam]
 gi|118415544|gb|ABK83963.1| DNA-binding response regulator [Bacillus thuringiensis str. Al
           Hakam]
          Length = 216

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 75/239 (31%), Gaps = 30/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + I++  +       +  +      +  +           ++ A                
Sbjct: 5   IKILVVDDHAFLRDAIRSILEDESDMNVVGEASSGDGVLEKVEA---------------C 49

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +    +  +  +           L   ++      +       
Sbjct: 50  RPDCILMDINLPGKNGIEATELVKKNYPN--------CRVLVFTMYEHDEYLMDALQAGA 101

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + Y        ++   + +L+    +I      ++           +        + ELT
Sbjct: 102 DGYLLKDSSSEQVVAAIRMLYRGDSVIHPRMTKKLIT-------YHQQKMKVESNENELT 154

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  + +G ++ EIA  L IS  TV  +I  I +K   K+RS A+ YAVRN +V
Sbjct: 155 EREKEILFELVKGLSNKEIAEALYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQLV 213


>gi|196041819|ref|ZP_03109108.1| transcriptional regulatory protein DegU [Bacillus cereus
           NVH0597-99]
 gi|229028432|ref|ZP_04184554.1| DNA-binding response regulator [Bacillus cereus AH1271]
 gi|196027313|gb|EDX65931.1| transcriptional regulatory protein DegU [Bacillus cereus
           NVH0597-99]
 gi|228732881|gb|EEL83741.1| DNA-binding response regulator [Bacillus cereus AH1271]
          Length = 213

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 39/222 (17%), Positives = 73/222 (32%), Gaps = 16/222 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL-VRWDLFQEQKLDSIVSSDWPF 84
           +    D       +   +     M  + E       L  V         +D  +      
Sbjct: 4   ILVVDDHAFLRDAIRSILEDESDMKVVGEASSGDGVLEKVEECRPDCILMDINLPGKNGI 63

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +    +  +  +           L   ++      +       + Y        ++   +
Sbjct: 64  EATELVKKNYPN--------CRVLVFTMYEHDEYLMDALQAGADGYLLKDSSSEQVVAAI 115

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
            +L+    +I      ++           +        + ELT RE E L  + +G ++ 
Sbjct: 116 RMLYRGDSVIHPRMTKKLIT-------YHQQKMKVESNENELTEREKEILFELVKGLSNK 168

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN +V
Sbjct: 169 EIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQLV 210


>gi|157145292|ref|YP_001452611.1| DNA-binding transcriptional activator SdiA [Citrobacter koseri ATCC
           BAA-895]
 gi|157082497|gb|ABV12175.1| hypothetical protein CKO_01029 [Citrobacter koseri ATCC BAA-895]
          Length = 240

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 39/231 (16%), Positives = 71/231 (30%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   +         +   T+ +   ++ L         +    V + +P   V 
Sbjct: 10  RRSMLVRFQEMATAEDVYTELQHQTQQLEYDYYALCVRHPVPFTRPKISVHTTYPQAWVA 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVARI 140
                       VL+        +              +     G+            R 
Sbjct: 70  HYQSENYFSIDPVLKPENFRQGHLAWNDALFSEAQSLWDAARAHGLRRGATQCLMLPNRA 129

Query: 141 RI--GLMLLFPKGRIILRDRLW-EIGLLAAYQANMFKSYDV--HWGKDFELTGREVECLT 195
                +     +      D +   + LL     +     +       +   + RE E L 
Sbjct: 130 LGFLSVSRASARHAPFAHDEIELRLQLLVRESLSALTRLEDEMVMTPEMRFSKREKEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSSEIAMILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|332978068|gb|EGK14806.1| nitrate/nitrite response regulator protein NarL [Desmospora sp.
           8437]
          Length = 216

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 40/222 (18%), Positives = 79/222 (35%), Gaps = 14/222 (6%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D       L   +S    M  + +   GA   L++         +D  +      
Sbjct: 5   VLLVDDHAVLRDGLSNIISLEEDMEVVGQASSGAEALLMIEELQPDVVLMDINMPGMSGV 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           + +R +   +        Q+   L   +F                Y       + +   +
Sbjct: 65  EAIRRIRAKD--------QKVAVLVLTMFDRDEYLYESIRAGATGYLLKDAPSSDVIDAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
                    +      ++        +  K  D    +D  LT RE++ L  + +G ++ 
Sbjct: 117 RSASRGESTLHPVMARKL----LDNISGGKKTDRGSNEDS-LTPRELDVLNLMVKGLSNK 171

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA  L IS  TV  ++++I++K   K+RS AI YA+++ +V
Sbjct: 172 EIAEQLFISDKTVKIHVSNILKKLRVKSRSQAIIYAIQHELV 213


>gi|220929282|ref|YP_002506191.1| LuxR family transcriptional regulator [Clostridium cellulolyticum
           H10]
 gi|219999610|gb|ACL76211.1| two component transcriptional regulator, LuxR family [Clostridium
           cellulolyticum H10]
          Length = 216

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 36/241 (14%), Positives = 74/241 (30%), Gaps = 27/241 (11%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           + ++ I++  +       +  +    + +  +                    G     L 
Sbjct: 1   MSKIRIMIADDHAMVRQGLKTILELEEDICVVSQASN---------------GEEAVALA 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
           R        +D  +        ++ +     +           +   +            
Sbjct: 46  RRVRPDIILMDINMPVINGLQAIKTLKEETVNY--------KIIVLTLHQDREYLFKTLQ 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
                Y     + + +   +  ++     I  +   E+           +   +      
Sbjct: 98  LGCEGYVLKDAESSVLIEAIRNVYRDQTYIQPNMTGELVKEFNRVTLYEQDKSIINN--- 154

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            LT REVE L  I+EG  + EIA  L IS  TV N+I++I +K     R+ A  YA ++N
Sbjct: 155 -LTNREVEVLKLIAEGMINKEIAKALYISEKTVKNHISNIFKKLDVNDRTQAAIYAFKHN 213

Query: 245 I 245
           I
Sbjct: 214 I 214


>gi|4103042|gb|AAD12726.1| transcriptional activator [Burkholderia cepacia]
          Length = 239

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 38/235 (16%), Positives = 76/235 (32%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       R+ A ++ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYQQFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI--------TPPAGMDNRYCSLTFDVA 138
           +         +  + ++        +     + I            G+       +   A
Sbjct: 63  MAHYQAQNYIEIDSTVRDGALNTNMIVWPDVDRIDPCPLWQDARDFGLSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       L+    + F    +       LT R+ 
Sbjct: 122 RGAFGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPAAGVTLTARDR 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGATNKVQAVVKAISAGLI 236


>gi|14586749|gb|AAK70347.1|AF333002_1 N-acyl homoserine lactone transcriptional regulator [Burkholderia
           cepacia]
          Length = 239

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 38/235 (16%), Positives = 74/235 (31%), Gaps = 16/235 (6%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D        +       R+ A ++ +G  +            K    +   +P   
Sbjct: 3   LRWQDAYDEFSAAEDEQQLFQRIAAYSKRLGFEYCCYGIRVPLPVSKPAVAIFDTYPDGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI--------TPPAGMDNRYCSLTFDVA 138
           +         +  + ++        +     + I            G+       +   A
Sbjct: 63  MAHYQAQNYIEIDSTVRDGALSTNMIVWPDVDKIEPCPLWRDARDFGLSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGL-------LAAYQANMFKSYDVHWGKDFELTGREV 191
           R   GL+ +      +    +  + L       L+    + F    +        T RE 
Sbjct: 122 RGAFGLLSIARHADRLTPAEINMLTLQTNWLANLSHSLMSRFMVPKLSPEARVTQTARER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L W +EGKT+ EI  IL IS  TVN ++ +I+ K     +  A+  A+   ++
Sbjct: 182 EVLCWTAEGKTACEIGQILSISERTVNFHVNNILEKLGASNKVQAVVKAISAGLI 236


>gi|297531388|ref|YP_003672663.1| LuxR family transcriptional regulator [Geobacillus sp. C56-T3]
 gi|297254640|gb|ADI28086.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. C56-T3]
          Length = 224

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 31/231 (13%), Positives = 68/231 (29%), Gaps = 16/231 (6%)

Query: 19  RTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIV 78
           R + +       + + R++  +                G+    +V         +D  +
Sbjct: 4   RIAIIDDHQLFREGIKRILEFEGDFEVVAE-----GSDGSEALSIVETYRPDLVLMDINM 58

Query: 79  SSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVA 138
                 +  + +                 +   +       +         Y     D  
Sbjct: 59  PDINGVEATKQLIE--------AYPDTKVVVLSIHDDENYVMRALQTGATGYLLKEMDAD 110

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSY---DVHWGKDFELTGREVECLT 195
            +   + ++   G  +       +                          LT RE E L 
Sbjct: 111 TLIEAVRIVAEGGSYLHPKVTHNLIREYRRLTTEKGGAVVKQEVRRPLHLLTRRECEVLQ 170

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            +++GK++  I   L IS  TV N+++SI++K     R+ A+  A++N  V
Sbjct: 171 LLADGKSNRAIGGALYISEKTVKNHVSSILQKLNVNDRTQAVVVAIKNGWV 221


>gi|167463122|ref|ZP_02328211.1| response regulator [Paenibacillus larvae subsp. larvae BRL-230010]
          Length = 214

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 37/239 (15%), Positives = 73/239 (30%), Gaps = 30/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  + E     ++ +    D +  +                    G     L +  
Sbjct: 5   IKVLLVDDHEMVRIGLAAVLGTEDGIEVVGEASN---------------GEEGIRLTQEY 49

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++      +  R +                 +    F    +         
Sbjct: 50  KPDVVLMDLVMEGMDGIETTRKLLQL--------YPECKVIVLTSFLDDEKMYPVLEAGA 101

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y   T     I   +        I+           A    N F+          +LT
Sbjct: 102 FSYLLKTSRAQEIAQAIRAAVKGQPILESQV-------ATKIMNRFRQPKPESAPHEDLT 154

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE+E L  I+ GK++ E+A  L I   TV  ++ ++++K   + R+ A  YA ++ IV
Sbjct: 155 EREMEVLRLIASGKSNQEVADELFIGVKTVKFHVTNVLQKLGVEDRTQAAIYAFKHGIV 213


>gi|331092883|ref|ZP_04586362.2| putative LuxR family regulatory protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331125377|ref|ZP_04592751.2| putative LuxR family regulatory protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331020753|gb|EGI00810.1| putative LuxR family regulatory protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331027159|gb|EGI07214.1| putative LuxR family regulatory protein [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 235

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 42/227 (18%), Positives = 76/227 (33%), Gaps = 17/227 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           D  + +        W   +  +   +G   +LL     F   +  + + + +P D ++C 
Sbjct: 3   DDFSCLAKFLDCRDWESHLRKVLCRLGYKTYLL-SIGGFTTNEPSNRIITTYPLDWLKCY 61

Query: 91  ALSEKDKYYNVLQRPTELFCPVFH----------TLPENITPPAGMDNRYCSLTFDVARI 140
                     +++     F P+F           +            ++  S+      +
Sbjct: 62  EDENFILIDPIVKHCRRHFMPLFWGGARRRARGRSKEFWRARERHGLSQGVSIPLRCREM 121

Query: 141 RIGLMLLFPKGR--IILRDRLWEIGLLAAYQANMF----KSYDVHWGKDFELTGREVECL 194
                +  P         +     G+L      +     +       +   LT RE E L
Sbjct: 122 LGSFNVAHPVDSNEEFDDEVNVTFGVLFMLVPFLLEGSQRHLKAPGEQSCSLTMRETEVL 181

Query: 195 TWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
            W   GKT+ EI+ ILG S  TVN +IA+  RK     R  A+  A+
Sbjct: 182 KWSGAGKTTWEISRILGCSERTVNFHIANASRKLGASNRLQAVGMAL 228


>gi|229199533|ref|ZP_04326194.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           m1293]
 gi|228583938|gb|EEK42095.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           m1293]
          Length = 215

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 37/222 (16%), Positives = 72/222 (32%), Gaps = 12/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D    +  L   +S    +  + E   G    + V         +D  +      
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDIELVGEASNGKEALMKVGETNPDVVLMDLYMPEMDGV 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +   C+     D           +    F      +       + Y     +  ++   +
Sbjct: 65  EATVCIKKEYPD--------VKVIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
              +     +  D    +           +   +       LT RE E L  +++G ++ 
Sbjct: 117 RSAYKGNIQLHPDIANALLSQTLPVEEKEEEPSIQVD---VLTARENEVLQLLAKGMSNK 173

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 174 EIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGIV 215


>gi|49082134|gb|AAT50467.1| PA1430 [synthetic construct]
          Length = 240

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 42/233 (18%), Positives = 72/233 (30%), Gaps = 17/233 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           D    +      + W+  +  +   +G S  L        +   ++ +  ++P       
Sbjct: 5   DGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHY 64

Query: 91  ALSEKDKYYNVLQRPTELFCPVFH----------TLPENITPPAGMDNRYCSLTFDVARI 140
             +   +    +   T+   P+F                    AG+              
Sbjct: 65  DRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGE 124

Query: 141 RIGLMLL-----FPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWG--KDFELTGREVEC 193
              L L        +    +   L  + +L  Y               K   LT RE E 
Sbjct: 125 LGALSLSVEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAFEHPVSKPVVLTSREKEV 184

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GKTS EI+VI   S   VN ++ +I RK    +R  A   AV   ++
Sbjct: 185 LQWCAIGKTSWEISVICNCSEANVNFHMGNIRRKFGVTSRRVAAIMAVNLGLI 237


>gi|228907986|ref|ZP_04071836.1| DNA-binding response regulator [Bacillus thuringiensis IBL 200]
 gi|228851652|gb|EEM96456.1| DNA-binding response regulator [Bacillus thuringiensis IBL 200]
          Length = 213

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 39/222 (17%), Positives = 72/222 (32%), Gaps = 16/222 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL-VRWDLFQEQKLDSIVSSDWPF 84
           +    D       +   +     M  + E       L  V         +D  +      
Sbjct: 4   ILVVDDHAFLRDAIRSILEDESDMKVVGEASSGDGVLGKVEECRPDCILMDINLPGKNGI 63

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +    +     +           L   ++      +       + Y        ++   +
Sbjct: 64  EATELVKKKYPN--------CRVLVFTMYEHDEYLMDALQAGADGYLLKDSSSEQVVAAI 115

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
            +L+    +I      ++           +        + ELT RE E L  + +G ++ 
Sbjct: 116 RMLYRGDSVIHPRMTKKLIT-------YHQQKMKVESNENELTEREKEILFELVKGLSNK 168

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN +V
Sbjct: 169 EIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQLV 210


>gi|307700594|ref|ZP_07637626.1| response regulator receiver domain protein [Mobiluncus mulieris
           FB024-16]
 gi|307614239|gb|EFN93476.1| response regulator receiver domain protein [Mobiluncus mulieris
           FB024-16]
          Length = 233

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 34/255 (13%), Positives = 70/255 (27%), Gaps = 32/255 (12%)

Query: 1   MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASH 60
           M  E +++ ++L  +          +    D +  +       +    + AL        
Sbjct: 1   MREETEKIKVLLVDDQALIRMGFRMVLEACDDIEVVGEAADGKTALGMVRAL-------- 52

Query: 61  FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI 120
                        +D  + +    +    +                 L    F       
Sbjct: 53  -------QPNVVLMDVRMPNMNGIEATGEIVSEN--------PEVKVLILTTFDLDEYAF 97

Query: 121 TPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLW-EIGLLAAYQANM------- 172
                  + +         +   +  +      I        + + A    +        
Sbjct: 98  GALRAGASGFLLKDAKPEELVAAIRAVAAGDATISPRITKKMLDMFAPQLPDENAGADAA 157

Query: 173 -FKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATK 231
              +          LT RE E L  I+ G T+ E+A  L IS  TV  ++ +I+ K   +
Sbjct: 158 GAGATSADAVALASLTERETEVLKLIAHGMTNQELADKLFISMTTVKTHVGNILNKIGAR 217

Query: 232 TRSGAIAYAVRNNIV 246
            R  A+ +A  N +V
Sbjct: 218 DRVQAVIFAYENGLV 232


>gi|228942557|ref|ZP_04105092.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|228975490|ref|ZP_04136045.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228982123|ref|ZP_04142415.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis Bt407]
 gi|228777661|gb|EEM25936.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis Bt407]
 gi|228784284|gb|EEM32308.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228817150|gb|EEM63240.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|326943209|gb|AEA19105.1| two-component response regulator yhcZ [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 215

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 35/222 (15%), Positives = 72/222 (32%), Gaps = 12/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D    +  L   +S    +  + E   G    + V         +D  +      
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDLELVGEANNGKEALVKVGETNPDVILMDLYMPEMDGV 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +    +     +           +    F      +       + Y     +  ++   +
Sbjct: 65  EATAYIKKEYPN--------VKVIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
              +     +  D    +           + + +       LT RE E L  +++G ++ 
Sbjct: 117 RSAYKGNIQLHPDIANALLSQTLPVEEKEEEHSIQVD---VLTARENEVLQLLAKGMSNK 173

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 174 EIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGIV 215


>gi|196047172|ref|ZP_03114389.1| transcriptional regulatory protein DegU [Bacillus cereus 03BB108]
 gi|229182965|ref|ZP_04310198.1| DNA-binding response regulator [Bacillus cereus BGSC 6E1]
 gi|196022042|gb|EDX60732.1| transcriptional regulatory protein DegU [Bacillus cereus 03BB108]
 gi|228600589|gb|EEK58176.1| DNA-binding response regulator [Bacillus cereus BGSC 6E1]
          Length = 213

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 39/222 (17%), Positives = 73/222 (32%), Gaps = 16/222 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL-VRWDLFQEQKLDSIVSSDWPF 84
           +    D       +   +     M  + E       L  V         +D  +      
Sbjct: 4   ILVADDHAFLRDAIRSILEDESDMKVVGEASSGDGVLEKVEECRPDCILMDINLPGKNGI 63

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +    +  +  +           L   ++      +       + Y        ++   +
Sbjct: 64  EATELVKKNYPN--------CRVLVFTMYEHDEYLMDALQAGADGYLLKDSSSEQVVAAI 115

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
            +L+    +I      ++           +        + ELT RE E L  + +G ++ 
Sbjct: 116 RMLYRGDSVIHPRMTKKLIT-------YHQQKMKVESNENELTEREKEILFELVKGLSNK 168

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN +V
Sbjct: 169 EIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQLV 210


>gi|328881294|emb|CCA54533.1| DNA-binding response regulator, LuxR family [Streptomyces
           venezuelae ATCC 10712]
          Length = 225

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 33/239 (13%), Positives = 74/239 (30%), Gaps = 23/239 (9%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  +     +    +      +A +      +    ++ AL               
Sbjct: 3   IRVLLVDDQPLLRTGFRMILEAEQDIAVVGEAGDGLQAQDQVRAL--------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +  R +    +D           L    F      +       
Sbjct: 48  QPDVVLMDIRMPRMDGVEATRQITGPGRDG------PAKVLVLTTFDLDEYVVEALRAGA 101

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +         +   + ++     ++       +  L  Y A++    +        LT
Sbjct: 102 SGFLLKDAPANELVQAIRVVAAGEAMLAPSITRRL--LDKYSAHLPTGEEQVPDTLSTLT 159

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            REVE L  ++ G ++ EIA  L +S  TV  ++  ++ K   + R  A  YA  + +V
Sbjct: 160 DREVEVLKLVARGLSNAEIAADLFVSETTVKTHVGHVLTKLGLRDRVQAAVYAYESGLV 218


>gi|111220761|ref|YP_711555.1| putative protein-glutamate methylesterase [Frankia alni ACN14a]
 gi|111148293|emb|CAJ59965.1| putative Protein-glutamate methylesterase [Frankia alni ACN14a]
          Length = 237

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 41/249 (16%), Positives = 82/249 (32%), Gaps = 18/249 (7%)

Query: 1   MNFEIQQVNIVL---NREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVG 57
           M  E Q+   VL   +  +  R   V         L  ++  +  +             G
Sbjct: 1   MTVEEQRSEEVLPTPSEANPIRVLIVDDHALFRRGLEMVLGQEVDIEVVGEA-----ADG 55

Query: 58  ASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLP 117
           +    + +        +D  +      D    +           +     +   +     
Sbjct: 56  SEAVTMAKEMAPDIVLMDVRMPRRGGIDATSAIKE--------AVPSAKIVMLTISDEEA 107

Query: 118 ENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYD 177
           +           Y      +  +   +  ++    +I      ++  L+ + A +    D
Sbjct: 108 DLYDAIKAGAMGYLLKEISIDEVAADIRAVYGGQSLISPSMASKL--LSEFAAMIKNKDD 165

Query: 178 VHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
                   LT RE+E L  +++G  + +IA  L IS NTV N+I +I+ K    +R  A+
Sbjct: 166 RPQLPTPRLTDREMEVLRLVAKGMNNRDIAKQLYISENTVKNHIRNILEKLQLHSRMEAV 225

Query: 238 AYAVRNNIV 246
            YAVR  ++
Sbjct: 226 VYAVREKLL 234


>gi|229156108|ref|ZP_04284207.1| DNA-binding response regulator [Bacillus cereus ATCC 4342]
 gi|228627429|gb|EEK84157.1| DNA-binding response regulator [Bacillus cereus ATCC 4342]
          Length = 213

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 73/239 (30%), Gaps = 30/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + I++  +       +  +      +  +           ++                  
Sbjct: 2   IKILVVDDHAFLRDAIRSILEDESDMKVVGEASSGDEVLGKVEECG-------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +    +                 L   ++      +       
Sbjct: 48  -PDCILMDINLPGKNGIEATELVKK--------FHSSCRVLVFTMYEHDEYLMDALQAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + Y        ++   + +L+    +I      ++           +        + ELT
Sbjct: 99  DGYLLKDSSSEQVVAAIRMLYRGDSVIHPRMTKKLIT-------YHQQKMKVESNENELT 151

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  + +G ++ EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN +V
Sbjct: 152 EREKEILFELVKGLSNKEIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQLV 210


>gi|94984662|ref|YP_604026.1| two component LuxR family transcriptional regulator [Deinococcus
           geothermalis DSM 11300]
 gi|94554943|gb|ABF44857.1| two component transcriptional regulator, LuxR family [Deinococcus
           geothermalis DSM 11300]
          Length = 228

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 31/222 (13%), Positives = 63/222 (28%), Gaps = 16/222 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           L    D           +     +  + E   G    L  R  +     +D  +      
Sbjct: 17  LLLVDDHPVVRKGTRELLEGEADLRVVGEAESGEEAILKARQLMPDVILMDVSMPGMNGI 76

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +  R +           +          +                Y         +   +
Sbjct: 77  EATRAIKAER-----PGVGIL---VLTSYDDDAYVFALLEAGAAGYLLKNASEDELLGAV 128

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
             +      +      +           F ++      +  L+ RE+E L   + G+T+ 
Sbjct: 129 RAVAAGESALHPAVARK-------VLERFSTHQTPTPPEDALSPRELEVLRVAATGRTNK 181

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA  L IS  TV  ++A+I  K    +R+ A+ Y ++   +
Sbjct: 182 EIARDLDISPRTVQVHLANIFSKLGVGSRTEAVLYGIKRGWI 223


>gi|149193353|gb|ABR21211.1| PhzR [Pseudomonas chlororaphis subsp. aureofaciens]
          Length = 241

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 39/226 (17%), Positives = 77/226 (34%), Gaps = 16/226 (7%)

Query: 36  MIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEK 95
                    +T         +    F      +    +  + +  ++P D V+    +  
Sbjct: 17  FARTMDMQEFTAVALRALRELRFDFFAYGMCSVTPFMRPRTYMYGNYPEDWVQRYQAANY 76

Query: 96  DKYYNVLQRPTELFCPVFHT--------LPENITPPAGMDNRYCSLTFDVARIRIGLMLL 147
                 ++       P+  +           +    + + +     +F+       L L 
Sbjct: 77  AVIDPTVKHSKVSSSPILWSNELFRGCPDLWSEANDSNLRHGLAQPSFNTQGRVGVLSLA 136

Query: 148 FPKGRIILRDRLWEIGLL----AAYQANMFKSYDV---HWGKDFELTGREVECLTWISEG 200
                 I       + ++    AA         +     +  D E +GRE + L W ++G
Sbjct: 137 RKDNP-ISLQEFEALKVVTKAFAAAVHEKISELESDVRVFNTDVEFSGRECDVLRWTADG 195

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           KTS+EI VI+G+  +TVN +  +I RK     R  A++YAV    +
Sbjct: 196 KTSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAVAMGYI 241


>gi|317482273|ref|ZP_07941294.1| response regulator receiver domain-containing protein
           [Bifidobacterium sp. 12_1_47BFAA]
 gi|316916289|gb|EFV37690.1| response regulator receiver domain-containing protein
           [Bifidobacterium sp. 12_1_47BFAA]
          Length = 248

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 41/261 (15%), Positives = 78/261 (29%), Gaps = 33/261 (12%)

Query: 4   EIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL 63
           E Q++ +V+  + E   +  + +      +                       GA    L
Sbjct: 3   EEQKIRVVIADDQELVRAGFAMVIGSQPDMTVAAQARD---------------GAEAVAL 47

Query: 64  VRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQ----RPTELFCPVFHTLPEN 119
                     +D  +      +  R ++  +     +  Q        +    F      
Sbjct: 48  AETLHPDVVLMDVRMPGMDGIEATRQISSLQHRFAADGTQSEVTHTKVIILTTFDLDEYV 107

Query: 120 ITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIG-------LLAAYQANM 172
           +       + +     +   +   +  +F    II       +         +A      
Sbjct: 108 MAAITAGASGFLLKDTEPETLLNSIRTVFQGNAIIAPSATKRLIEKMMEGDFMATNVGRP 167

Query: 173 FKSYDVHWGKDF-------ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIM 225
             S                ELT RE E L  I+ G ++ EIA  L IS  TV  ++A I+
Sbjct: 168 ENSATTSATDSTYTDPELDELTDREREVLIEIAHGLSNQEIADKLFISLPTVKTHVAHIL 227

Query: 226 RKTATKTRSGAIAYAVRNNIV 246
            K   + R  A+ +A  N++V
Sbjct: 228 SKINARDRVQAVVFAYENHLV 248


>gi|320010128|gb|ADW04978.1| two component transcriptional regulator, LuxR family [Streptomyces
           flavogriseus ATCC 33331]
          Length = 219

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 42/223 (18%), Positives = 72/223 (32%), Gaps = 11/223 (4%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D +     L   +     M    E   G +   L          +D  +     
Sbjct: 6   RVLICDDQVLIRTGLATIIDAQPDMEVAGECGDGRTGVELAGKVRPDVVVMDIRMPVLDG 65

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
               R +A +              L    F+             + +        R+  G
Sbjct: 66  IAATRLLAGAGVPH------PVKVLVVTTFNLDEYVYEALRAGASGFLLKDAPPDRLLHG 119

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           +  +     ++  D   ++       A   +        D  LT RE+E L  I+EG ++
Sbjct: 120 IRTVAAGAALLDPDVTRQL---VGRYAARIRPTGG-TDPDIPLTPRELEVLRLIAEGLSN 175

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            EIA  L ISR TV  +++ I+ K   + R  A+ YA R  +V
Sbjct: 176 SEIAASLVISRETVKTFVSRILTKLGLRDRVQAVVYAYRQGLV 218


>gi|15596627|ref|NP_250121.1| transcriptional regulator LasR [Pseudomonas aeruginosa PAO1]
 gi|116049375|ref|YP_791822.1| transcriptional regulator LasR [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218892698|ref|YP_002441567.1| transcriptional regulator LasR [Pseudomonas aeruginosa LESB58]
 gi|254234529|ref|ZP_04927852.1| transcriptional regulator LasR [Pseudomonas aeruginosa C3719]
 gi|254239780|ref|ZP_04933102.1| transcriptional regulator LasR [Pseudomonas aeruginosa 2192]
 gi|313106426|ref|ZP_07792658.1| transcriptional regulator LasR [Pseudomonas aeruginosa 39016]
 gi|125980|sp|P25084|LASR_PSEAE RecName: Full=Transcriptional activator protein lasR
 gi|9947379|gb|AAG04819.1|AE004572_7 transcriptional regulator LasR [Pseudomonas aeruginosa PAO1]
 gi|151326|gb|AAA25874.1| transcriptional activator LasR [Pseudomonas aeruginosa PAO1]
 gi|115584596|gb|ABJ10611.1| transcriptional regulator LasR [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126166460|gb|EAZ51971.1| transcriptional regulator LasR [Pseudomonas aeruginosa C3719]
 gi|126193158|gb|EAZ57221.1| transcriptional regulator LasR [Pseudomonas aeruginosa 2192]
 gi|156106986|gb|ABU49653.1| LasR [Pseudomonas sp. M18]
 gi|218772926|emb|CAW28738.1| transcriptional regulator LasR [Pseudomonas aeruginosa LESB58]
 gi|310879160|gb|EFQ37754.1| transcriptional regulator LasR [Pseudomonas aeruginosa 39016]
          Length = 239

 Score =  138 bits (349), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 42/233 (18%), Positives = 72/233 (30%), Gaps = 17/233 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           D    +      + W+  +  +   +G S  L        +   ++ +  ++P       
Sbjct: 5   DGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHY 64

Query: 91  ALSEKDKYYNVLQRPTELFCPVFH----------TLPENITPPAGMDNRYCSLTFDVARI 140
             +   +    +   T+   P+F                    AG+              
Sbjct: 65  DRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGE 124

Query: 141 RIGLMLL-----FPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWG--KDFELTGREVEC 193
              L L        +    +   L  + +L  Y               K   LT RE E 
Sbjct: 125 LGALSLSVEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAFEHPVSKPVVLTSREKEV 184

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GKTS EI+VI   S   VN ++ +I RK    +R  A   AV   ++
Sbjct: 185 LQWCAIGKTSWEISVICNCSEANVNFHMGNIRRKFGVTSRRVAAIMAVNLGLI 237


>gi|302388953|ref|YP_003824774.1| two component transcriptional regulator, LuxR family
           [Thermosediminibacter oceani DSM 16646]
 gi|302199581|gb|ADL07151.1| two component transcriptional regulator, LuxR family
           [Thermosediminibacter oceani DSM 16646]
          Length = 213

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 38/242 (15%), Positives = 79/242 (32%), Gaps = 29/242 (11%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           + ++++VL  +       +  +      +  +      +     +               
Sbjct: 1   MSKISVVLADDHVLVRKGLKKILEMESDIEVVGEASNGLEAVEEVRT------------- 47

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                    +D  +      +  R +             +   +   ++      +    
Sbjct: 48  --KAPDVVLMDINMPKLNGVEATRVLKKESL--------KTKVIILTIYDDREYLLELLK 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
              + Y     D   +   +  +      I         L+A Y  N          +  
Sbjct: 98  TGISGYILKDIDPQALVEAVRAVSRGETYIQPTLTR--ALIAEY--NRLSQPISRASR-- 151

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            LT RE E + +I+EG ++ EI+  LGIS  TV N+++SI+RK     R+    YA++NN
Sbjct: 152 PLTAREKEVMAYIAEGMSNIEISEKLGISEKTVKNHVSSILRKLNLMDRTQVAVYALKNN 211

Query: 245 IV 246
           +V
Sbjct: 212 LV 213


>gi|205375039|ref|ZP_03227830.1| DegU [Bacillus coahuilensis m4-4]
          Length = 225

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 33/244 (13%), Positives = 66/244 (27%), Gaps = 28/244 (11%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           V IV+  + +     V  +         +   D                G     L    
Sbjct: 2   VKIVIIDDHQLFREGVKRILDFEPYFDVVAEGDD---------------GEQAIQLYEEH 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +  R +                 +   +               
Sbjct: 47  HPDVVIMDINMPVINGVEATRRLIDR--------YPHAKIIILSIHDDESYVSHALQTGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEI-----GLLAAYQANMFKSYDVHWGK 182
             Y     D   +   + ++   G  +       +      L+                 
Sbjct: 99  LGYLLKEMDADALVNAVKVVSEGGSYLHPKVTHNLVREYRQLIKEQHQQTVYQPVEIRRP 158

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
              LT RE E L  +++G ++  I   L IS  TV N++++I++K     R+ A+  A++
Sbjct: 159 LHLLTRRECEVLQLLADGCSNRTIGETLYISEKTVKNHVSNILQKMNVNDRTQAVVTAIK 218

Query: 243 NNIV 246
              V
Sbjct: 219 KGWV 222


>gi|326328660|ref|ZP_08195000.1| putative two-component system response regulator [Nocardioidaceae
           bacterium Broad-1]
 gi|325953621|gb|EGD45621.1| putative two-component system response regulator [Nocardioidaceae
           bacterium Broad-1]
          Length = 220

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 29/239 (12%), Positives = 71/239 (29%), Gaps = 25/239 (10%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           V IV+  +     S    L +    +  +            +                  
Sbjct: 3   VKIVVVDDQAMVRSGFVALLSTQPDIEVVGTAADGSEALQVVRRT--------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      + +R ++ +          +   +    F              
Sbjct: 48  HPDVVLMDVRMPVMDGIEALRQLSEN------PATAQTKVVMLTTFDADEYVHESLRLGA 101

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +         +   + ++     ++      ++      Q            +  +LT
Sbjct: 102 SGFLLKDASPDELASAIRVVHAGEALLSPSVTRQV----IAQFARAPRKRKQDPRLKQLT 157

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  I+ G ++ EIA  L ++  TV  +++ I+ K   + R+ A+ +A  + +V
Sbjct: 158 EREREVLENIARGSSNSEIAAELFLAEQTVKTHVSRILGKLGLRDRAQAVVFAYESGLV 216


>gi|229174002|ref|ZP_04301538.1| Response regulator [Bacillus cereus MM3]
 gi|228609334|gb|EEK66620.1| Response regulator [Bacillus cereus MM3]
          Length = 566

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 52/258 (20%), Positives = 96/258 (37%), Gaps = 15/258 (5%)

Query: 1   MNFEIQQV--NIVLNREDEQRTSFVSHLPTRSDL---LARMIPLDCTVSWTMRMYALTEY 55
           M   ++QV   + L+   EQ T  V ++P ++ L   + R++ +D     T  +  + E+
Sbjct: 312 MKDRLEQVQGTLSLHSNVEQGTFIVCNIPLQTKLAHDIIRLLVVDDQALITNSLERILEH 371

Query: 56  ------VGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELF 109
                 VG ++       L ++ + D ++      ++    AL E  + +  ++      
Sbjct: 372 QTDFIVVGKAYDGSEALKLCEQLQPDIVLMDIQMPEMNGIEALLEMKRRWPNIKIVLMTT 431

Query: 110 CPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQ 169
              F    +  T        Y   +     ++  L L++  G  I +     I      Q
Sbjct: 432 ---FEDSLQAATALEHGAEGYMLKSIHPQEMKEALKLIYNGGTWIDQSVATRIFEEMKLQ 488

Query: 170 ANMFKSYDV-HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKT 228
                          + LT RE+E L  +S G     IA  L +S  T+ NY +++  K 
Sbjct: 489 REQLAKIKSTKQTSPYGLTKREMEILEHLSNGLRYKSIAAKLFLSEGTIRNYCSNLYSKL 548

Query: 229 ATKTRSGAIAYAVRNNIV 246
               R  AI  A   NI+
Sbjct: 549 GVNNREEAIKKARTENIL 566


>gi|193890916|gb|ACF28617.1| quorum sensing regulator [Mesorhizobium tianshanense]
          Length = 275

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 39/243 (16%), Positives = 73/243 (30%), Gaps = 17/243 (6%)

Query: 21  SFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDS--IV 78
           + ++ +      L  +  L         +  + E  G      +       +       +
Sbjct: 29  ASIAAMSGLDATLEEIGQLGDAEKIPALLQRIAERYGLKTVAYLGTGTLDRRVPRQEPFI 88

Query: 79  SSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLP----------ENITPPAGMD- 127
           +  +P + V              +Q       P+                      G+  
Sbjct: 89  AVTYPPEWVERYRARGYINIDPAIQIGLRRLLPIDWDEFGKAEGDLRQFFGEASEFGLGL 148

Query: 128 NRYCSLTFDVARIRIGLMLLF----PKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKD 183
                        R    +       +     R       ++AA+        D  +   
Sbjct: 149 RGISFPVHGCGGDRALFSVTADFSKREWHWARRTAFRHFPIIAAHLHEAVLRTDGVFRSQ 208

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             L+ RE+ECL W SEGKT  E  VILG+S +TV  Y+ S   K    + + A + A ++
Sbjct: 209 PRLSPRELECLRWTSEGKTVWECGVILGLSPHTVRCYLESARHKLGASSNTHAASLATKS 268

Query: 244 NIV 246
            ++
Sbjct: 269 GLL 271


>gi|206975855|ref|ZP_03236766.1| DNA-binding response regulator [Bacillus cereus H3081.97]
 gi|217962901|ref|YP_002341479.1| DNA-binding response regulator [Bacillus cereus AH187]
 gi|222098883|ref|YP_002532941.1| DNA-binding response regulator [Bacillus cereus Q1]
 gi|229142155|ref|ZP_04270680.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           BDRD-ST26]
 gi|206745949|gb|EDZ57345.1| DNA-binding response regulator [Bacillus cereus H3081.97]
 gi|217063637|gb|ACJ77887.1| DNA-binding response regulator [Bacillus cereus AH187]
 gi|221242942|gb|ACM15652.1| DNA-binding response regulator [Bacillus cereus Q1]
 gi|228641444|gb|EEK97750.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           BDRD-ST26]
          Length = 215

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 35/222 (15%), Positives = 72/222 (32%), Gaps = 12/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D    +  L   +S    +  + E   G    + V         +D  +      
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDIELVGEASNGKEALMKVGETNPDVVLMDLYMPEMDGV 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +   C+     +           +    F      +       + Y     +  ++   +
Sbjct: 65  EATACIKKEYPN--------VKVIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
              +     +  D    +           +   +       LT RE E L  +++G ++ 
Sbjct: 117 RSAYKGNIQLHPDIANALLSQTLPVEEKEEEPSIQVD---VLTARENEVLQLLAKGMSNK 173

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L I+  TV  +++SI+ K     R+ A  YAV+N +V
Sbjct: 174 EIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGVV 215


>gi|76667926|dbj|BAE45354.1| two component response regulater [Bacillus subtilis]
          Length = 229

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 34/249 (13%), Positives = 73/249 (29%), Gaps = 30/249 (12%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           + +VNIV+  + +     V  +         +   D                G     +V
Sbjct: 1   MTKVNIVIIDDHQLFREGVKRILDFEPTFEVVAEGDD---------------GDEAARIV 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                    +D  + +    +  + +                 +   +            
Sbjct: 46  EHYHPDVVIMDINMPNVNGVEATKQLVEL--------YPESKVIILSIHDDENYVTHALK 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILR-------DRLWEIGLLAAYQANMFKSYD 177
                Y     D   +   + ++   G  +         +    +           + Y 
Sbjct: 98  TGARGYLLKEMDADTLIEAVKVVAEGGSYLHPKVTHNLVNEFRRLATSGVSAHPQHEVYP 157

Query: 178 VHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
                   LT RE E L  +++GK++  I   L IS   V N++++I++K     R+ A+
Sbjct: 158 EIRRPLHILTRRECEVLQMLADGKSNRGIGESLFISEKAVKNHVSNILQKINVNDRTQAV 217

Query: 238 AYAVRNNIV 246
             A++N  V
Sbjct: 218 VVAIKNGWV 226


>gi|297161877|gb|ADI11589.1| two-component system response regulator [Streptomyces
           bingchenggensis BCW-1]
          Length = 223

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 33/239 (13%), Positives = 74/239 (30%), Gaps = 23/239 (9%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  +     +    +      LA +      +    ++ AL               
Sbjct: 3   IRVLLVDDQPLLRTGFRMILEAEQDLAVVGEAGDGLQALDQVRAL--------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +  R +    +D           L    F      +       
Sbjct: 48  QPDVVLMDIRMPRMDGVEATRQITGPGRDG------PAKVLVLTTFDLDEYVVEALRAGA 101

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +         +   + ++     ++       +  L  Y  ++    +        LT
Sbjct: 102 SGFLLKDAPAHELVQAIRVVAAGEAMLAPSITRRL--LDKYAGHLPSGEEPVPDTLHTLT 159

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            REVE L  +++G ++ EIA  L +S  TV  ++  ++ K   + R  A  YA  + +V
Sbjct: 160 EREVEVLKLVAKGLSNAEIAADLFVSETTVKTHVGHVLTKLGLRDRVQAAVYAYESGLV 218


>gi|239828352|ref|YP_002950976.1| LuxR family transcriptional regulator [Geobacillus sp. WCH70]
 gi|239808645|gb|ACS25710.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. WCH70]
          Length = 225

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 34/232 (14%), Positives = 78/232 (33%), Gaps = 17/232 (7%)

Query: 19  RTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIV 78
           R + +       + + R++  +                G+    +V         +D  +
Sbjct: 4   RIAIIDDHQLFREGIKRILEFEEEFEVVAE-----GADGSEALSIVEEHRPDIVIMDINM 58

Query: 79  SSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVA 138
            +    +  + +  +  D           +   +       +         Y     D  
Sbjct: 59  PNINGVEATKQLIETYPD--------TKVVVLSIHDDENYVMRALQTGATGYLLKEMDAD 110

Query: 139 RIRIGLMLLFPKGRIILR----DRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECL 194
            +   + ++   G  +      + + E   LA+ +    +           LT RE E L
Sbjct: 111 TLIEAVKIVAEGGSYLHPKVTHNLIREYRRLASEKGENKERKREVRWPLHLLTRRECEVL 170

Query: 195 TWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
             +++GK++  I   L IS  TV N++++I++K     R+ A+  A++N  V
Sbjct: 171 QLLADGKSNRGIGEALYISEKTVKNHVSNILQKLNVNDRTQAVVVAIKNGWV 222


>gi|294501833|ref|YP_003565533.1| two-component response regulator DegU [Bacillus megaterium QM
           B1551]
 gi|295707182|ref|YP_003600257.1| two-component response regulator DegU [Bacillus megaterium DSM 319]
 gi|126540400|emb|CAL44587.1| DegU protein [Bacillus megaterium DSM 319]
 gi|294351770|gb|ADE72099.1| two-component response regulator DegU [Bacillus megaterium QM
           B1551]
 gi|294804841|gb|ADF41907.1| two-component response regulator DegU [Bacillus megaterium DSM 319]
          Length = 227

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 34/246 (13%), Positives = 72/246 (29%), Gaps = 29/246 (11%)

Query: 7   QVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRW 66
           Q  I++  + +     V  +         +   D                G+    LV  
Sbjct: 2   QTRIIIIDDHQLFREGVKRILDFEKDFEVVAEGDD---------------GSEVIDLVEE 46

Query: 67  DLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGM 126
                  +D  + +    +  + +     D           +   +              
Sbjct: 47  HQPDVVIMDINMPAVNGVEATKKLVEVNPD--------AKVIILSIHDDETYVTHALQTG 98

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEI------GLLAAYQANMFKSYDVHW 180
              Y     D   +   + ++   G  +       +             ++         
Sbjct: 99  ARGYLLKEMDADALIEAVKVVAEGGSYLHPKVTHSLVKEYRRLAAQGQSSSYPHEPIEIR 158

Query: 181 GKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
                LT RE E L  +++GK++  I   L IS  TV N++++I++K     R+ A+  A
Sbjct: 159 RPLHLLTRRECEVLQLLADGKSNRGIGEALYISEKTVKNHVSNILQKMNVNDRTQAVVVA 218

Query: 241 VRNNIV 246
           ++N  V
Sbjct: 219 IKNGWV 224


>gi|190890862|ref|YP_001977404.1| transcriptional regulator protein, LuxR family [Rhizobium etli CIAT
           652]
 gi|190696141|gb|ACE90226.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli CIAT 652]
          Length = 240

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 89/226 (39%), Gaps = 18/226 (7%)

Query: 37  IPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI-VSSDWPFDLVRCMALSEK 95
              +        M  LT+ +G + FL++        ++ +  + ++WP ++V        
Sbjct: 15  AGFNTHYEVFKYMKGLTQGLGMTAFLIMTLPTVDFVEIGATKIITNWPAEMVDYYDSHNL 74

Query: 96  DKYYNVLQRPTELFCPVFHTLPE--------------NITPPAGMDNRYCSLTFDVARIR 141
                V++R      P  + +                ++    GM+        D A  R
Sbjct: 75  MVDSPVIRRMLRSTSPFNYDVEAINTDRGEGKKSTVIDLFRRYGMEKGAYFPVHDAAGGR 134

Query: 142 IGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYD-VHWGKDFELTGREVECLTWISEG 200
             + +   +   +L   + +I  +A    +           K    T  E++CL   + G
Sbjct: 135 GAMSISGSRNFTML--EMAKILFIATLIYDRLSQLTLNEKHKPIAFTSSELDCLRLTAGG 192

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + S EIA +L +S N VNN+I S+++K    TR+ A+  A+R NI+
Sbjct: 193 RKSSEIAKLLDLSENAVNNHIGSVIKKLGCTTRTQAVVSALRLNII 238


>gi|269124386|ref|YP_003297756.1| LuxR family two component transcriptional regulator
           [Thermomonospora curvata DSM 43183]
 gi|268309344|gb|ACY95718.1| two component transcriptional regulator, LuxR family
           [Thermomonospora curvata DSM 43183]
          Length = 222

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 30/239 (12%), Positives = 66/239 (27%), Gaps = 25/239 (10%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  +     +    +    D +A +               L               
Sbjct: 2   IRVLLADDQRLVRAGFRSILADEDDIAVVGEAGDGEQTVEACRRL--------------- 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +  R +           L+    +    F           G  
Sbjct: 47  RPDVVLMDIRMPGMDGLEATRRITA------DPRLENVRVVILTTFDLDDYVYAALRGGA 100

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             +     +   +   + +      +I       +      +            +   LT
Sbjct: 101 CGFLVKDTEPQELIRAVRVAARGDALISPSVTRRL----IAEFTGRVKAPAPDPRLNALT 156

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E +  ++ G ++DEIA  L +S  T   +++ IM K   + RS  +  A  + +V
Sbjct: 157 EREREVMRLVAAGLSNDEIAGRLVLSPATAKTHVSRIMSKLGVRDRSQLVVLAYESGMV 215


>gi|119485648|ref|ZP_01619923.1| Two Component Transcriptional Regulator, LuxR family protein
           [Lyngbya sp. PCC 8106]
 gi|119456973|gb|EAW38100.1| Two Component Transcriptional Regulator, LuxR family protein
           [Lyngbya sp. PCC 8106]
          Length = 226

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 48/245 (19%), Positives = 84/245 (34%), Gaps = 26/245 (10%)

Query: 3   FEIQQVNIVLNREDEQ-RTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHF 61
              + +NI+L  +DE  R   V+ L    D+L  +   +                G +  
Sbjct: 1   MNSKPLNILLVEDDELFRLGLVTRLQQEGDILI-VAEAED---------------GETAV 44

Query: 62  LLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT 121
            LV    F    LD  +      +  R +   +      VL   +    P+ + + E   
Sbjct: 45  ELVSQHSFDVVILDVGLPGIGGVEACRQIKQKQ--PLLPVLVLTSHSQKPLINRIIEAK- 101

Query: 122 PPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWG 181
                   YC        + + +  +             EI                 + 
Sbjct: 102 -----AQGYCLKGIAPEALILAIRSVAAGASWWDSIATQEIQKTFGQ-FAEVPEGSEAYS 155

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
               LT RE E L  I+ GK++ EIA IL I+  TV  ++ +I++K   + R+ A   A+
Sbjct: 156 ASNPLTKREQEILALIASGKSNQEIADILYIAPGTVRVHVHTILKKLNARDRTQAALVAI 215

Query: 242 RNNIV 246
           +  +V
Sbjct: 216 QKKLV 220


>gi|86750432|ref|YP_486928.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           HaA2]
 gi|86573460|gb|ABD08017.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           HaA2]
          Length = 240

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 41/229 (17%), Positives = 74/229 (32%), Gaps = 15/229 (6%)

Query: 32  LLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQE---QKLDSIVSSDWPFDLVR 88
            +A +   +       ++  +    G S  L       +    Q++ ++V   WP     
Sbjct: 12  FVAALDRANTPDIVADKLLGVVRPFGYSQVLAGIIPTPRTSVKQQIANVVLHRWPLRWSE 71

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLPEN-----------ITPPAGMDNRYCSLTFDV 137
                        ++R +    P   +  +                 G+   +      +
Sbjct: 72  RYFSRGYLFEDPTIRRVSTSSEPFVWSELQVGPDARANEIMREAGEFGLGCGFTVPMITL 131

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
                GL  +      +       + L+A Y                 LT RE + L WI
Sbjct: 132 DGQSAGLS-IAGDRAELPPSHRGMVQLVAMYAFLRSLKLGEKPTPAITLTKREADVLHWI 190

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +EGKT  EI+ IL +S + V+     I  K     R  A+A A+R+ I+
Sbjct: 191 AEGKTDWEISKILRVSEHLVDKMARQIRTKLGAVNRIQAVALAMRSGII 239


>gi|229187725|ref|ZP_04314860.1| DNA-binding response regulator [Bacillus cereus BGSC 6E1]
 gi|228595717|gb|EEK53402.1| DNA-binding response regulator [Bacillus cereus BGSC 6E1]
          Length = 213

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 73/239 (30%), Gaps = 30/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + I++  +       +  +      +  +           ++                  
Sbjct: 2   IKILVVDDHAFLRDAIRSILEDESDMKVVGEASSGDEVLGKVEECG-------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +    +          +      L   ++      +       
Sbjct: 48  -PDCILMDINLPGKNGIEATELVKK--------IYPSCRVLVFTMYEHDEYLMDALQVGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + Y        ++   + +L+    +I      ++           +        + ELT
Sbjct: 99  DGYLLKDSSSEQVVAAIRMLYRGDSVIHPRMTKKLIT-------YHQQKMKVESNENELT 151

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  + +G ++ EIA  L IS  TV  +I  I +K   K+RS A+ YAVRN +V
Sbjct: 152 EREKEILFELVKGLSNKEIAEALYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQLV 210


>gi|269128235|ref|YP_003301605.1| LuxR family two component transcriptional regulator
           [Thermomonospora curvata DSM 43183]
 gi|268313193|gb|ACY99567.1| two component transcriptional regulator, LuxR family
           [Thermomonospora curvata DSM 43183]
          Length = 253

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 38/231 (16%), Positives = 73/231 (31%), Gaps = 14/231 (6%)

Query: 16  DEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLD 75
           D  R   V         L  ++  +  +             G     + R  L     +D
Sbjct: 34  DPIRVLIVDDHALFRRGLEMVLADEPDIEVIGE-----GGDGNEAVEMARDLLPDVLLMD 88

Query: 76  SIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTF 135
             +      +  R +           +     +   +     +         + Y     
Sbjct: 89  IRMPRRSGIEACRAIKE--------AVPSAKIVMLTISDEDTDLFEAIKAGASGYLLKEI 140

Query: 136 DVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLT 195
            +  +   +  +     +I      ++    A  A   +          +LT RE+E L 
Sbjct: 141 SIDEVPQAVRAVHGGQSLISPSMASKLITEFAALAKRSEERQQQV-PAPKLTEREMEVLR 199

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ++ G  + EIA  L IS NTV N++ +I+ K    +R  A+ YAVR  ++
Sbjct: 200 LVARGLGNREIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAVREKLL 250


>gi|205372669|ref|ZP_03225480.1| hypothetical protein Bcoam_04270 [Bacillus coahuilensis m4-4]
          Length = 223

 Score =  138 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 37/239 (15%), Positives = 76/239 (31%), Gaps = 25/239 (10%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + I++  +       +S +    + L  +           +    T              
Sbjct: 3   IRIMIVDDQALMRDGLSSILQLKEELEVVATASNGQDAFEKARKFT-------------- 48

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +  R +  +              L    F      +       
Sbjct: 49  -PDIILMDIRMPGSSGVEGTRLIHRANLP--------VKVLMLTTFKDTELILQALEEGA 99

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGL-LAAYQANMFKSYDVHWGKDFEL 186
           + Y         I   +  ++  G ++  D   ++ L       + F+       +   L
Sbjct: 100 SGYLLKDMPTDTIVQAIKTVYSGGVVLPEDLTAQLFLDKRKTPPSDFEPVGQPVDRSL-L 158

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           T RE   L+ + +G  + EIA  L I+  TV N++++I+ K   + R+ A  YAVR+ I
Sbjct: 159 TEREWGVLSELGKGLNNREIAEALYITEGTVKNHVSNIISKLEVRDRTQAAIYAVRHGI 217


>gi|326440245|ref|ZP_08214979.1| two-component system response regulator [Streptomyces clavuligerus
           ATCC 27064]
          Length = 224

 Score =  138 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 32/239 (13%), Positives = 73/239 (30%), Gaps = 23/239 (9%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  +     +    +      +A +      +    ++ AL               
Sbjct: 3   IRVLLVDDQPLLRTGFRMILEAEQDIAVVGEAGDGLQALDQVRAL--------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +  R +    +D           L    F      +       
Sbjct: 48  QPDVVLMDIRMPRMDGVEATRQITGPGRDG------PAKVLVLTTFDLDEYVVEALRAGA 101

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +         +   + ++     ++       +  L  Y  ++    +        LT
Sbjct: 102 SGFLLKDAPAHELVQAIRVVAAGEAMLAPSITRRL--LDKYAGHLPSGEEPVPDTLNSLT 159

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            REVE L  ++ G ++ EIA  L +S  TV  ++  ++ K   + R  A  YA  + +V
Sbjct: 160 DREVEVLKLVARGLSNAEIAADLFVSETTVKTHVGHVLTKLGLRDRVQAAVYAYESGLV 218


>gi|29833213|ref|NP_827847.1| two-component system response regulator [Streptomyces avermitilis
           MA-4680]
 gi|29610335|dbj|BAC74382.1| putative two-component system response regulator [Streptomyces
           avermitilis MA-4680]
          Length = 223

 Score =  138 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 33/239 (13%), Positives = 73/239 (30%), Gaps = 23/239 (9%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  +     +    +      LA +      +    ++ AL               
Sbjct: 3   IRVLLVDDQPLLRTGFRMILEAEQDLAVVGEAGDGLQALDQVRAL--------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +  R +    +D           L    F      +       
Sbjct: 48  QPDVVLMDIRMPRMDGVEATRQITGPGRDG------PAKVLVLTTFDLDEYVVEALRAGA 101

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +         +   + ++     ++       +  L  Y  ++    +        LT
Sbjct: 102 SGFLLKDAPANELVQAIRVVAAGEAMLAPSITRRL--LDKYAGHLPSGDEPVPDTLHTLT 159

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            REVE L  ++ G ++ EIA  L +S  TV  ++  ++ K   + R  A  YA  + +V
Sbjct: 160 EREVEVLKLVARGLSNAEIAADLFVSETTVKTHVGHVLTKLGLRDRVQAAVYAYESGLV 218


>gi|167037195|ref|YP_001664773.1| two component LuxR family transcriptional regulator
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|167040665|ref|YP_001663650.1| two component LuxR family transcriptional regulator
           [Thermoanaerobacter sp. X514]
 gi|166854905|gb|ABY93314.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter sp. X514]
 gi|166856029|gb|ABY94437.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
          Length = 208

 Score =  138 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 37/220 (16%), Positives = 74/220 (33%), Gaps = 21/220 (9%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWP 83
            L    D       L   +     +  +++   G   + L +  +     +D  +     
Sbjct: 3   RLLVADDHALIRKGLVQLIEMEKDIKVISQASNGEEAYKLAKKFMPDLILMDVNMPVMNG 62

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
               + +   +             LF  +++     +         Y     +   +   
Sbjct: 63  IKAAKMLKEEKHP--------SKVLFLTIYNDREYLLEALKLGVEGYILKDAEYDDLIKA 114

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           +  ++  G  I    + EI  +                   +LT RE+E L  IS+G ++
Sbjct: 115 IKTIYNGGVYIHPSLMEEIDNIDQETLKK------------DLTPREIEILKLISKGYSN 162

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
            EIA  L +S  TV N++ +I +K   K R+ A  Y ++N
Sbjct: 163 KEIAQKLFLSEKTVKNHVYNIFKKLDVKDRTQAAIYMLKN 202


>gi|251799733|ref|YP_003014464.1| LuxR family transcriptional regulator [Paenibacillus sp. JDR-2]
 gi|247547359|gb|ACT04378.1| two component transcriptional regulator, LuxR family [Paenibacillus
           sp. JDR-2]
          Length = 242

 Score =  138 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 34/253 (13%), Positives = 76/253 (30%), Gaps = 36/253 (14%)

Query: 7   QVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRW 66
           ++ ++L  + +     +  +    D L  +      +                       
Sbjct: 11  KIKVLLADDHQLFREGLKRILNMEDDLEVIGECGDGIQVLE---------------FCNH 55

Query: 67  DLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGM 126
            + +   +D  +  +        +          +      +   +              
Sbjct: 56  TIPEIVLMDINMPIENGVVTTERLKT--------IFPDVKVIILSIHDDESYVFETLRKG 107

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLW-------------EIGLLAAYQANMF 173
              Y     +   +   +  +      I                   E+G+++   A M 
Sbjct: 108 ATGYLLKDMEAESLINAIRSVVNGHAYIHPKVTGKLINQLRRMTYLDEMGVISGAAAGME 167

Query: 174 KSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
                  G+D  LT RE E L  ++EGK++  I   L IS  TV N+++SI++K     R
Sbjct: 168 PGVKFVAGEDNPLTRREAEVLRLMAEGKSNKMIGEYLFISEKTVKNHVSSILQKMEVDDR 227

Query: 234 SGAIAYAVRNNIV 246
           + A+  +++   V
Sbjct: 228 TQAVIQSIKYGWV 240


>gi|329935654|ref|ZP_08285461.1| two component system response regulator [Streptomyces
           griseoaurantiacus M045]
 gi|329304915|gb|EGG48786.1| two component system response regulator [Streptomyces
           griseoaurantiacus M045]
          Length = 224

 Score =  138 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 33/224 (14%), Positives = 73/224 (32%), Gaps = 7/224 (3%)

Query: 24  SHLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDW 82
           + +    D           ++    +  + E   GA    L R        +D  +    
Sbjct: 3   TRVLIVDDQAMVRAGFAALLAAQSDIDVVGEAPDGARGVELSRRTHPDVVLMDVRMPEMD 62

Query: 83  PFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRI 142
             +  R +          V   P  L    F              + +       A +  
Sbjct: 63  GLEAARRL----LTPPAGVTHVPRVLMLTTFDIDDYVYEALRAGASGFLLKDAPPADLIA 118

Query: 143 GLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKT 202
            + ++     ++       +  +A +  +          +   LT RE E LT ++ G +
Sbjct: 119 AVRVVASGDALLAPSVTRRL--IADFAKSRPGGRGGPAQRLKGLTQRETEVLTLVARGLS 176

Query: 203 SDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + EIA  L ++  TV  +++ ++ K   + R+ A+ +A  + +V
Sbjct: 177 NSEIAETLVLAEQTVKTHVSRVLTKLGLRDRAQAVVFAYESGLV 220


>gi|86739478|ref|YP_479878.1| two component LuxR family transcriptional regulator [Frankia sp.
           CcI3]
 gi|86566340|gb|ABD10149.1| two component transcriptional regulator, LuxR family [Frankia sp.
           CcI3]
          Length = 237

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 35/243 (14%), Positives = 78/243 (32%), Gaps = 25/243 (10%)

Query: 4   EIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL 63
           E   + +++  +       +  +  +   +  +                    GA    +
Sbjct: 17  EANPIRVLIVDDHALFRRGLEMVLGQEVDIEVVGEAAD---------------GAEAVTM 61

Query: 64  VRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPP 123
            +        +D  +      D    +           +     +   +     +     
Sbjct: 62  AKEMAPDIVLMDVRMPRRGGIDATSAIKE--------AVPSAKIVMLTISDEEADLYDAI 113

Query: 124 AGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKD 183
                 Y      +  +   +  ++    +I      ++  L+ + A +    D      
Sbjct: 114 KAGAMGYLLKEISIDEVAADIRAVYGGQSLISPSMASKL--LSEFAAMIKNKDDRPQLPT 171

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             LT RE+E L  +++G  + +IA  L IS NTV N+I +I+ K    +R  A+ YAVR 
Sbjct: 172 PRLTDREMEVLRLVAKGMNNRDIAKQLYISENTVKNHIRNILEKLQLHSRMEAVVYAVRE 231

Query: 244 NIV 246
            ++
Sbjct: 232 KLL 234


>gi|228950550|ref|ZP_04112691.1| DNA-binding response regulator [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228809127|gb|EEM55607.1| DNA-binding response regulator [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
          Length = 213

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 39/222 (17%), Positives = 72/222 (32%), Gaps = 16/222 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL-VRWDLFQEQKLDSIVSSDWPF 84
           +    D       +   +     M  + E       L  V         +D  +      
Sbjct: 4   ILVVDDHAFLRDAIRSILEDESDMKVVGEASSGDGVLGKVEECRPDCILMDINLPGKNGI 63

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +    +  +              L   ++      +       + Y        ++   +
Sbjct: 64  EATELVKKN--------YPSCRVLVFTMYEHDEYLMDALQAGADGYLLKDSSSEQVLAAI 115

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
            +L+    +I      ++           +        + ELT RE E L  + +G ++ 
Sbjct: 116 RMLYRGDSVIHPRMTKKLIT-------YHQQKMKVESNENELTEREKEILFELVKGLSNK 168

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L IS  TV  +I  I +K   K+RS A+ YAVRN +V
Sbjct: 169 EIAEVLYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQLV 210


>gi|189439534|ref|YP_001954615.1| putative response regulator [Bifidobacterium longum DJO10A]
 gi|189427969|gb|ACD98117.1| Putative response regulator [Bifidobacterium longum DJO10A]
          Length = 248

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 41/261 (15%), Positives = 78/261 (29%), Gaps = 33/261 (12%)

Query: 4   EIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL 63
           E Q++ +V+  + E   +  + +      +                       GA    L
Sbjct: 3   EEQKIRVVIADDQELVRAGFAMVIGSQPDMTVAAQARD---------------GAEAVAL 47

Query: 64  VRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQ----RPTELFCPVFHTLPEN 119
                     +D  +      +  R ++  +     +  Q        +    F      
Sbjct: 48  AETLHPDVVLMDVRMPGMDGIEATRQISALQHRFAADGTQSEVTHTKVIILTTFDLDEYV 107

Query: 120 ITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIG-------LLAAYQANM 172
           +       + +     +   +   +  +F    II       +         +A      
Sbjct: 108 MAAITAGASGFLLKDTEPETLLNSIRTVFQGNAIIAPSATKRLIEKMMEGDFMATNVGRP 167

Query: 173 FKSYDVHWGKDF-------ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIM 225
             S                ELT RE E L  I+ G ++ EIA  L IS  TV  ++A I+
Sbjct: 168 ENSATTSATDSTYTDPELDELTDREREVLIEIAHGLSNQEIADKLFISLPTVKTHVAHIL 227

Query: 226 RKTATKTRSGAIAYAVRNNIV 246
            K   + R  A+ +A  N++V
Sbjct: 228 SKINARDRVQAVVFAYENHLV 248


>gi|42784585|ref|NP_981832.1| DNA-binding response regulator [Bacillus cereus ATCC 10987]
 gi|42740517|gb|AAS44440.1| DNA-binding response regulator [Bacillus cereus ATCC 10987]
          Length = 215

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 37/221 (16%), Positives = 77/221 (34%), Gaps = 10/221 (4%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFD 85
           +    D    +  L   +S    +  + E       L+       E   D ++   +  +
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDIELVGEASNGKEALI----KVGETNPDVVLMDLYMPE 60

Query: 86  LVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLM 145
           +    A +   K Y  ++    +    F      +       + Y     +  ++   + 
Sbjct: 61  MDGVEATACIKKEYPDVK---VIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAIR 117

Query: 146 LLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDE 205
             +     +  D    +           +   +       LT RE E L  +++G ++ E
Sbjct: 118 SAYKGNIQLHPDIANALLSQTLPVEEKEEEPSIQVD---VLTARENEVLQLLAKGMSNKE 174

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           IA +L I+  TV  +++SI+ K     R+ A  YAV+N +V
Sbjct: 175 IASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGVV 215


>gi|229089048|ref|ZP_04220402.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock3-44]
 gi|228694270|gb|EEL47892.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock3-44]
          Length = 215

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 40/222 (18%), Positives = 74/222 (33%), Gaps = 12/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D    +  L   +S    +  + E   G    + V         +D  +      
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDLELVGEANNGQEALMKVEETQPDIVLMDLYMPEMDGI 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +   C+     +           L    F      +       + Y     +  ++   +
Sbjct: 65  EATACIKKEYPN--------VKVLVLTSFSDQAHVLPALKAGASGYILKDVEPDQLVEAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
              +     +  D      LL+            +   D  LT RE E L  +++G ++ 
Sbjct: 117 RSAYKGNIQLHPDIA--SSLLSQTLPQEEAEVPSNIHVDV-LTARENEVLQLLAKGMSNK 173

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 174 EIASVLVITEKTVKAHVSSILSKLQLSDRTQAALYAVKNGIV 215


>gi|324329359|gb|ADY24619.1| DNA-binding response regulator [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 215

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 37/222 (16%), Positives = 72/222 (32%), Gaps = 12/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D    +  L   +S    +  + E   G    + V         +D  +      
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDIELVGEASNGKEALMKVGETNPDVVLMDLYMPEMDGV 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +   C+     D           +    F      +       + Y     +  ++   +
Sbjct: 65  EATACIKKEYPD--------VKVIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
              +     +  D    +           +   +       LT RE E L  +++G ++ 
Sbjct: 117 RSAYKGNIQLHPDIANALLSQTLPVEEKEEEPSIQVD---VLTARENEVLQLLAKGMSNK 173

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 174 EIASVLVITEKTVKAHVSSILSKLHLSDRTQAALYAVKNGIV 215


>gi|228918143|ref|ZP_04081650.1| DNA-binding response regulator [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228841505|gb|EEM86641.1| DNA-binding response regulator [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 213

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 43/217 (19%), Positives = 77/217 (35%), Gaps = 16/217 (7%)

Query: 36  MIPLDCTVSWTMRMYALTEY------VGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRC 89
           ++ +D        + ++ E       VG +          +E + D I+           
Sbjct: 4   ILVVDDHAFLRDAIRSILEDESDMNVVGEASSGDGVLGKVEECRPDCILMDINLPGKNGI 63

Query: 90  MALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFP 149
            A     K Y        L   ++      +       + Y        ++   + +L+ 
Sbjct: 64  EATELVKKNYPS---CRVLVFTMYEHDEYLMDALQAGADGYLLKDSSSEQVVAAIRMLYR 120

Query: 150 KGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVI 209
              +I      ++           +        + ELT RE E L  + +G ++ EIA +
Sbjct: 121 GDSVIHPRMTKKLIT-------YHQQKMKVESNENELTEREKEILFELVKGLSNKEIAEV 173

Query: 210 LGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L IS  TV  +I  I +K   K+RS A+ YAVRN +V
Sbjct: 174 LYISDKTVKIHINKIFKKLNVKSRSQAVIYAVRNQLV 210


>gi|300087810|ref|YP_003758332.1| LuxR family two component transcriptional regulator
           [Dehalogenimonas lykanthroporepellens BL-DC-9]
 gi|299527543|gb|ADJ26011.1| two component transcriptional regulator, LuxR family
           [Dehalogenimonas lykanthroporepellens BL-DC-9]
          Length = 228

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 30/222 (13%), Positives = 67/222 (30%), Gaps = 9/222 (4%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D +         +     M  + E   G     L R        +D  + +   
Sbjct: 8   RVLLADDHIIVREGTREMLERQPDMQVVAEANDGVDAVELARIYRPDVIVMDIAMPNMNG 67

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
            +  R +           L     L    + +    +         Y        ++   
Sbjct: 68  IEATREIKK--------FLPTTAILILTAYDSDQYIMALIEAGAAGYMLKNVRGNQLIDA 119

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           +  +     I+       +    +    + +           LT RE+E L   ++G ++
Sbjct: 120 IRAVHSGESILQPSTTRRVINQLSKNNPIKREDTESDAPAHALTEREMEVLRLAAKGVSN 179

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
            + A  L +S  TV  ++++I +K    +R+ AI Y ++   
Sbjct: 180 RDTAEQLYLSSRTVQTHLSNIFKKLNVASRTEAILYGLKRGW 221


>gi|2495423|sp|Q51786|PHZR_PSEFL RecName: Full=Transcriptional activator protein phzR
 gi|1050313|gb|AAC18899.1| shows homology to luxR family; putative [Pseudomonas fluorescens]
          Length = 244

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 36/225 (16%), Positives = 78/225 (34%), Gaps = 14/225 (6%)

Query: 36  MIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEK 95
                    +T+        +    F      +    +  + +  ++P   ++    +  
Sbjct: 20  FAQAMNMEEFTVVALRALRELRFDFFAYGMCSVTPFMRPKTYMYGNYPEHWLQRYQAANY 79

Query: 96  DKYYNVLQRPTELFCPVFHT--------LPENITPPAGMDNRYCSLTFDVARIRIGLMLL 147
                 ++       P+  +           +    + + +     +F+       L L 
Sbjct: 80  ALIDPTVKHSKVSSAPILWSNELFRNCPDLWSEANDSSLCHGLAQPSFNTQGRVGVLSLA 139

Query: 148 FPKGRIILRD------RLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGK 201
                I L++              A  + +  ++    +  D E + RE + L W ++GK
Sbjct: 140 RKDNAISLQEFEALKPVTKAFAAAALEKISALETDVRAFNTDVEFSERECDVLRWTADGK 199

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           TS+EI VI+G+  +TVN +  +I RK     R  A++YAV    +
Sbjct: 200 TSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAVALGYI 244


>gi|209863456|gb|ACI88828.1| PhzR [Pseudomonas sp. G5(2008b)]
          Length = 241

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 38/225 (16%), Positives = 77/225 (34%), Gaps = 14/225 (6%)

Query: 36  MIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEK 95
                    +T         +    F      +    +  + +  ++P D V+    +  
Sbjct: 17  FARTMDMQEFTAVALRALRELRFDFFAYGMCSVTPFMRPRTYMYGNYPEDWVQRYQAANY 76

Query: 96  DKYYNVLQRPTELFCPVFHT--------LPENITPPAGMDNRYCSLTFDVARIRIGLMLL 147
                 ++       P+  +           +    + + +     +F+       L L 
Sbjct: 77  AVIDPTVKHSKVSSAPILWSNELFRGCADLWSEAKDSHLCHGLAQPSFNAQGRVGVLSLA 136

Query: 148 FPKGRIILRD------RLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGK 201
                I L++              A  + +  +S    +      +GRE + L W ++GK
Sbjct: 137 RKNNPISLQEFEALKPVTRAFAAAAHEKISELESDVRVFNTGVAFSGRECDVLRWTADGK 196

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           TS+EI VI+G+  +TVN +  +I RK     R  A++YAV    +
Sbjct: 197 TSEEIGVIMGVCTDTVNYHHRNIQRKIGASNRVQAVSYAVAMGYI 241


>gi|30265432|ref|NP_847809.1| DNA-binding response regulator [Bacillus anthracis str. Ames]
 gi|47530989|ref|YP_022338.1| DNA-binding response regulator [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49188248|ref|YP_031501.1| DNA-binding response regulator [Bacillus anthracis str. Sterne]
 gi|49481286|ref|YP_039401.1| response regulator [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|52145220|ref|YP_086677.1| response regulator [Bacillus cereus E33L]
 gi|65317392|ref|ZP_00390351.1| COG2197: Response regulator containing a CheY-like receiver domain
           and an HTH DNA-binding domain [Bacillus anthracis str.
           A2012]
 gi|118480442|ref|YP_897593.1| DNA-binding response regulator [Bacillus thuringiensis str. Al
           Hakam]
 gi|165871317|ref|ZP_02215966.1| DNA-binding response regulator [Bacillus anthracis str. A0488]
 gi|167635732|ref|ZP_02394042.1| DNA-binding response regulator [Bacillus anthracis str. A0442]
 gi|167640431|ref|ZP_02398695.1| DNA-binding response regulator [Bacillus anthracis str. A0193]
 gi|170688212|ref|ZP_02879423.1| DNA-binding response regulator [Bacillus anthracis str. A0465]
 gi|170708051|ref|ZP_02898499.1| DNA-binding response regulator [Bacillus anthracis str. A0389]
 gi|177651955|ref|ZP_02934538.1| DNA-binding response regulator [Bacillus anthracis str. A0174]
 gi|190568889|ref|ZP_03021791.1| DNA-binding response regulator [Bacillus anthracis Tsiankovskii-I]
 gi|196036150|ref|ZP_03103550.1| DNA-binding response regulator [Bacillus cereus W]
 gi|196041030|ref|ZP_03108327.1| DNA-binding response regulator [Bacillus cereus NVH0597-99]
 gi|196045422|ref|ZP_03112653.1| DNA-binding response regulator [Bacillus cereus 03BB108]
 gi|218906592|ref|YP_002454426.1| DNA-binding response regulator [Bacillus cereus AH820]
 gi|225867394|ref|YP_002752772.1| DNA-binding response regulator [Bacillus cereus 03BB102]
 gi|227818179|ref|YP_002818188.1| DNA-binding response regulator [Bacillus anthracis str. CDC 684]
 gi|228918025|ref|ZP_04081555.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228930420|ref|ZP_04093421.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228936698|ref|ZP_04099489.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228949137|ref|ZP_04111407.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|229124916|ref|ZP_04254092.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           95/8201]
 gi|229187641|ref|ZP_04314778.1| Two component transcriptional regulator, LuxR [Bacillus cereus BGSC
           6E1]
 gi|229603380|ref|YP_002869624.1| DNA-binding response regulator [Bacillus anthracis str. A0248]
 gi|254687146|ref|ZP_05151004.1| DNA-binding response regulator [Bacillus anthracis str. CNEVA-9066]
 gi|254724071|ref|ZP_05185856.1| DNA-binding response regulator [Bacillus anthracis str. A1055]
 gi|254735533|ref|ZP_05193240.1| DNA-binding response regulator [Bacillus anthracis str. Western
           North America USA6153]
 gi|254742202|ref|ZP_05199889.1| DNA-binding response regulator [Bacillus anthracis str. Kruger B]
 gi|254755887|ref|ZP_05207919.1| DNA-binding response regulator [Bacillus anthracis str. Vollum]
 gi|254761599|ref|ZP_05213619.1| DNA-binding response regulator [Bacillus anthracis str. Australia
           94]
 gi|301056878|ref|YP_003795089.1| DNA-binding response regulator [Bacillus anthracis CI]
 gi|30260110|gb|AAP29295.1| DNA-binding response regulator [Bacillus anthracis str. Ames]
 gi|47506137|gb|AAT34813.1| DNA-binding response regulator [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49182175|gb|AAT57551.1| DNA-binding response regulator [Bacillus anthracis str. Sterne]
 gi|49332842|gb|AAT63488.1| response regulator [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|51978689|gb|AAU20239.1| response regulator [Bacillus cereus E33L]
 gi|118419667|gb|ABK88086.1| DNA-binding response regulator [Bacillus thuringiensis str. Al
           Hakam]
 gi|164712984|gb|EDR18512.1| DNA-binding response regulator [Bacillus anthracis str. A0488]
 gi|167511651|gb|EDR87033.1| DNA-binding response regulator [Bacillus anthracis str. A0193]
 gi|167528841|gb|EDR91598.1| DNA-binding response regulator [Bacillus anthracis str. A0442]
 gi|170127024|gb|EDS95903.1| DNA-binding response regulator [Bacillus anthracis str. A0389]
 gi|170667905|gb|EDT18657.1| DNA-binding response regulator [Bacillus anthracis str. A0465]
 gi|172082659|gb|EDT67723.1| DNA-binding response regulator [Bacillus anthracis str. A0174]
 gi|190559956|gb|EDV13939.1| DNA-binding response regulator [Bacillus anthracis Tsiankovskii-I]
 gi|195991317|gb|EDX55285.1| DNA-binding response regulator [Bacillus cereus W]
 gi|196023629|gb|EDX62305.1| DNA-binding response regulator [Bacillus cereus 03BB108]
 gi|196028198|gb|EDX66808.1| DNA-binding response regulator [Bacillus cereus NVH0597-99]
 gi|218537324|gb|ACK89722.1| DNA-binding response regulator [Bacillus cereus AH820]
 gi|225787376|gb|ACO27593.1| DNA-binding response regulator [Bacillus cereus 03BB102]
 gi|227004175|gb|ACP13918.1| DNA-binding response regulator [Bacillus anthracis str. CDC 684]
 gi|228595795|gb|EEK53478.1| Two component transcriptional regulator, LuxR [Bacillus cereus BGSC
           6E1]
 gi|228658546|gb|EEL14210.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           95/8201]
 gi|228810578|gb|EEM56929.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228822907|gb|EEM68748.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228829267|gb|EEM74903.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228841613|gb|EEM86727.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|229267788|gb|ACQ49425.1| DNA-binding response regulator [Bacillus anthracis str. A0248]
 gi|300379047|gb|ADK07951.1| DNA-binding response regulator [Bacillus cereus biovar anthracis
           str. CI]
          Length = 215

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 38/221 (17%), Positives = 77/221 (34%), Gaps = 10/221 (4%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFD 85
           +    D    +  L   +S    +  + E       L+       E   D ++   +  +
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDIELVGEASNGKEALV----KVGETNPDVVLMDLYMPE 60

Query: 86  LVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLM 145
           +    A +   K Y  ++    +    F      +       + Y     +  ++   + 
Sbjct: 61  MDGVEATACIKKEYPDVK---VIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAIR 117

Query: 146 LLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDE 205
             +     +  D    +           +   +       LT RE E L  +++G ++ E
Sbjct: 118 SAYKGNIQLHPDIANALLSQTLPVEEKEEEPSIQVD---VLTARENEVLQLLAKGMSNKE 174

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           IA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 175 IASVLVITEKTVKAHVSSILSKLHLSDRTQAALYAVKNGIV 215


>gi|302518123|ref|ZP_07270465.1| two-component system response regulator [Streptomyces sp. SPB78]
 gi|318059111|ref|ZP_07977834.1| two-component system response regulator [Streptomyces sp. SA3_actG]
 gi|318079115|ref|ZP_07986447.1| two-component system response regulator [Streptomyces sp. SA3_actF]
 gi|333028198|ref|ZP_08456262.1| putative two-component system response regulator [Streptomyces sp.
           Tu6071]
 gi|302427018|gb|EFK98833.1| two-component system response regulator [Streptomyces sp. SPB78]
 gi|332748050|gb|EGJ78491.1| putative two-component system response regulator [Streptomyces sp.
           Tu6071]
          Length = 223

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 34/230 (14%), Positives = 71/230 (30%), Gaps = 13/230 (5%)

Query: 17  EQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDS 76
             R   V   P        ++  +  V+            G      VR        +D 
Sbjct: 2   AIRVLLVDDQPLLRTGFRMILEAEPDVAVVGEAGD-----GVQALDQVRALQPDVVLMDI 56

Query: 77  IVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFD 136
            +      +  R +  +  ++   V      L    F      +       + +      
Sbjct: 57  RMPRMDGVEATRQI--TGPERDGPV----KVLVLTTFDLDEYVVEALRAGASGFLLKDAP 110

Query: 137 VARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTW 196
              +   + ++     ++       +  L  Y  ++    +        LT REVE L  
Sbjct: 111 AHELVQAIRVVASGEAMLAPSVTRRL--LDKYAGHLPSGEEQPPSTLQTLTEREVEVLKL 168

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++ G ++ EIA  L +S  TV  ++  ++ K   + R  A  +A  + +V
Sbjct: 169 VARGLSNAEIAADLFVSETTVKTHVGHVLTKLGLRDRVQAAVFAYESGLV 218


>gi|229094522|ref|ZP_04225591.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock3-42]
 gi|228688906|gb|EEL42736.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock3-42]
          Length = 215

 Score =  138 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 37/222 (16%), Positives = 72/222 (32%), Gaps = 12/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D    +  L   +S    +  + E   G    + V         +D  +      
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDIELVGEASNGKEALVKVGETNPDVVLMDLYMPEMDGV 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +   C+            Q    +    F      +       + Y     +  ++   +
Sbjct: 65  EATACIKKE--------YQDVKVIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
              +     +  D    +           +   +       LT RE E L  +++G ++ 
Sbjct: 117 RSAYKGNIQLHPDIANALLSQTLPVEEKEEESSIQVD---VLTARENEVLQLLAKGMSNK 173

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 174 EIASVLVITEKTVKAHVSSILSKLHLSDRTQAALYAVKNGIV 215


>gi|217419193|ref|ZP_03450700.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 576]
 gi|226200253|ref|ZP_03795798.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pakistan 9]
 gi|217398497|gb|EEC38512.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 576]
 gi|225927761|gb|EEH23803.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pakistan 9]
          Length = 236

 Score =  138 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 40/226 (17%), Positives = 78/226 (34%), Gaps = 12/226 (5%)

Query: 33  LARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMAL 92
           L      +        +      +G  +        F       ++ S++P         
Sbjct: 11  LNEFSRSENPQHVISVLTRAAATLGYEYAAYGMRRPFPISNPPILMVSNYPARWQERYIE 70

Query: 93  SEKDKYYNVLQRPTELFCPVFHTLP--------ENITPPAGMDNRYCSLTFDVARIRIGL 144
           +        ++       PV  + P               G+ + + S +         L
Sbjct: 71  ARFANIDGAVKAALGSDLPVTWSAPANASKSAFWAEALSFGIAHGWSSASRGADGAIGVL 130

Query: 145 MLLFPKGRIILRDRLWE---IGLLAAYQANMFKSYDVHWGK-DFELTGREVECLTWISEG 200
            L   +  I   ++      +  LA         +     + D +LT RE + L W ++G
Sbjct: 131 TLSRTQDPIDTAEKFRNESIVHWLANVAHASMAPFLPAADEFDPDLTRRETDVLKWTADG 190

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           KT+ EIA+IL IS +TVN ++ +I+ K  +  +  A+A A    ++
Sbjct: 191 KTAYEIALILSISESTVNFHVKNIVSKLGSTNKIQAVAKAALMGML 236


>gi|229020635|ref|ZP_04177369.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH1273]
 gi|229026848|ref|ZP_04183176.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH1272]
 gi|228734456|gb|EEL85122.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH1272]
 gi|228740659|gb|EEL90923.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           AH1273]
          Length = 215

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 40/222 (18%), Positives = 74/222 (33%), Gaps = 12/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D    +  L   +S       + E   G    + V         +D  +      
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDFELVGEANNGKEALVKVGETSPDVVLMDLYMPEMDGI 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +   C+     +           +    F      +       + Y     +  ++   +
Sbjct: 65  EATACIKKEYPN--------VKVIVLTSFSDQAHVLPALKAGASGYILKDVEPDQLVEAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
              +     +  D      LL+       K  +     D  LT RE E L  +++G ++ 
Sbjct: 117 RSAYKGNIQLHPDVAN--ALLSQTLPEEEKEEEPSIQVDV-LTARENEVLQLLAKGMSNK 173

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 174 EIAAVLVITEKTVKAHVSSILSKLHLSDRTQAALYAVKNGIV 215


>gi|297198515|ref|ZP_06915912.1| two-component system response regulator [Streptomyces sviceus ATCC
           29083]
 gi|197716175|gb|EDY60209.1| two-component system response regulator [Streptomyces sviceus ATCC
           29083]
          Length = 223

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 67/223 (30%), Gaps = 9/223 (4%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D           +     +  + E   G      VR        +D  +     
Sbjct: 4   RVLLVDDQPLLRTGFRMILEAEQDLAVVGEAGDGLQAIDQVRALQPDVVLMDIRMPRMDG 63

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
            +  R +    +D           L    F      +       + +         +   
Sbjct: 64  VEATRQITGPGRDG------PAKVLVLTTFDLDEYVVEALRAGASGFLLKDAPANELVQA 117

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           + ++     ++       +  L  Y  ++    +        LT REVE L  ++ G ++
Sbjct: 118 IRVVAAGEAMLAPSITRRL--LDKYATHLPSGDEPVPDTLHTLTDREVEVLKLVARGLSN 175

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            EIA  L +S  TV  ++  ++ K   + R  A  YA  + +V
Sbjct: 176 AEIAADLFVSETTVKTHVGHVLTKLGLRDRVQAAVYAYESGLV 218


>gi|326772328|ref|ZP_08231613.1| two-component system response regulator [Actinomyces viscosus C505]
 gi|326638461|gb|EGE39362.1| two-component system response regulator [Actinomyces viscosus C505]
          Length = 240

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 29/242 (11%), Positives = 66/242 (27%), Gaps = 25/242 (10%)

Query: 7   QVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRW 66
            V++VL  +          +    + +  +                    G S     + 
Sbjct: 21  PVSVVLADDQALMRMGFRMVLEAEEDITVVGEASD---------------GTSALAQAKA 65

Query: 67  DLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGM 126
                  +D  +      +    +A                L    F             
Sbjct: 66  LHPDVILMDVRMPGMNGIEATERIAQE--------CPSTRVLILTTFDLDEYAFAGLRAG 117

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRL-WEIGLLAAYQANMFKSYDVHWGKDFE 185
            + +         +   +  +     ++        + + A    +             +
Sbjct: 118 ASGFLLKDTRPTELAEAIRTVASGEAVVSPRITQRMLEMFAGSLPSSEAPAQSSSDPRID 177

Query: 186 -LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            LT RE E L  +S+G ++ EIA  L +S  TV  ++ +++ K   + R  A+  A    
Sbjct: 178 SLTPREKEILVLMSQGMSNAEIAAHLVVSATTVKTHVGNVLAKLDVRDRVQAVVVAYETG 237

Query: 245 IV 246
           ++
Sbjct: 238 LM 239


>gi|308071115|ref|YP_003872720.1| DegU family transcriptional regulator [Paenibacillus polymyxa E681]
 gi|305860394|gb|ADM72182.1| Transcriptional regulatory protein degU [Paenibacillus polymyxa
           E681]
          Length = 240

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 29/252 (11%), Positives = 70/252 (27%), Gaps = 35/252 (13%)

Query: 7   QVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRW 66
            + ++L  + +     +  +    D +  +      +                       
Sbjct: 10  PIKVLLADDHQLFREGLKRILNMEDDIEVIGECGDGIQVLE---------------FCNV 54

Query: 67  DLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGM 126
           +      +D  +  +   +    +          +      +   +              
Sbjct: 55  EKPDIVLMDINMPIENGVEATEKLRE--------MFPDVKVIILSIHDDESYVFETLRKG 106

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQ------------ANMFK 174
            N Y     +   +   +  +      I      ++                        
Sbjct: 107 ANGYLLKDMEAESLINAIRSVHEGYAFIHPKVTGKLIQQLRRMTYLNETGAMAEGHTKEA 166

Query: 175 SYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRS 234
                 G++  LT RE E L  ++EGK++  I   L IS  TV N+++SI++K     R+
Sbjct: 167 GVKFVAGENNPLTRREAEVLRLMAEGKSNKMIGEYLFISEKTVKNHVSSILQKMEVDDRT 226

Query: 235 GAIAYAVRNNIV 246
            A+  +++   V
Sbjct: 227 QAVINSIKYGWV 238


>gi|149187186|ref|ZP_01865484.1| LuxR, transcriptional regulator [Vibrio shilonii AK1]
 gi|148838722|gb|EDL55661.1| LuxR, transcriptional regulator [Vibrio shilonii AK1]
          Length = 259

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 40/222 (18%), Positives = 78/222 (35%), Gaps = 18/222 (8%)

Query: 41  CTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYN 100
                + ++  +TE +G  H+L          + +++V ++ P    +    +E   +  
Sbjct: 22  DFEDLSGKLAEVTEVIGFEHYLFAVSVPVTVMRAENVVLTNQPLAWRQFYEDNEVMYFDQ 81

Query: 101 VLQRPTELFCPVFHTLPEN-----------ITPPAGMDNRYCSLTFDVARIRIGLMLLFP 149
           V+        P+                  +    G+ +               +     
Sbjct: 82  VVLHCRNSMLPLQWRSLLANDIPDDKNVIKLASDFGLGDGITIPLRANHGCLGLISFSNR 141

Query: 150 KGRI-ILRDRLWEIGLLAAYQANMFKSYDVHWGKD------FELTGREVECLTWISEGKT 202
           KG   I  +       + +  A+       H  +         LT RE  CL W++EGK+
Sbjct: 142 KGTRKIDHESTILSTYVGSLVADYINDIRNHVCEKQFGQVKSSLTLREQICLAWVAEGKS 201

Query: 203 SDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           S E+A I+G S  TVN +I +   K    +R+ A++ A+   
Sbjct: 202 SWEVAQIIGCSERTVNFHIQNASEKLNAFSRTQAVSKALLTG 243


>gi|312199837|ref|YP_004019898.1| LuxR family transcriptional regulator [Frankia sp. EuI1c]
 gi|311231173|gb|ADP84028.1| two component transcriptional regulator, LuxR family [Frankia sp.
           EuI1c]
          Length = 237

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 36/234 (15%), Positives = 76/234 (32%), Gaps = 15/234 (6%)

Query: 13  NREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQ 72
           + E+  R   V         L  ++  +  +             G+    +         
Sbjct: 16  SEENPIRVLIVDDHALFRRGLEMVLAQEPDIEVVGEA-----ADGSEAVTMAGEMAPDIV 70

Query: 73  KLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCS 132
            +D  +      D    +           +     +   +     +           Y  
Sbjct: 71  LMDVRMPRRGGIDATSAIKE--------AVPSAKIVMLTISDEEADLYDAIKAGAMGYLL 122

Query: 133 LTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVE 192
               +  +   +  ++    +I      ++  L+ + + +    D        LT RE+E
Sbjct: 123 KEISIDEVAADIRAVYNGQSLISPSMASKL--LSEFASMIKNKDDRPQLPTPRLTDREME 180

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            L  +++G  + +IA  L IS NTV N+I +I+ K    +R  A+ YAVR  ++
Sbjct: 181 VLRLVAKGLNNRDIAKQLFISENTVKNHIRNILEKLQLHSRMEAVVYAVREKLL 234


>gi|226355486|ref|YP_002785226.1| response regulator NarL [Deinococcus deserti VCD115]
          Length = 218

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 29/222 (13%), Positives = 64/222 (28%), Gaps = 16/222 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           L    D           +     ++ + E   G    +  R        +D  +      
Sbjct: 7   LLLVDDHPVVRKGTRELLEGETDLHVIGEAGSGEEAVVKARDLQPDVILMDVSMPGMNGI 66

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +  + +                 L    +                Y         +   +
Sbjct: 67  EATKAIKAER--------PGVGVLVLTSYDDDAYIFALLEAGAAGYLLKNASEDDLLGAV 118

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
             +      +      +           F ++      + +L+ RE+E L   + G+T+ 
Sbjct: 119 RAVAAGESALHPSVARK-------VLERFSTHTTPTPPEDDLSPRELEVLRVAATGRTNK 171

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA  L IS  TV  ++A+I  K    +R+ A+ + ++   +
Sbjct: 172 EIARDLDISPRTVQVHLANIFSKLGVGSRTEAVLHGIKRGWI 213


>gi|302550305|ref|ZP_07302647.1| two-component system response regulator [Streptomyces
           viridochromogenes DSM 40736]
 gi|302467923|gb|EFL31016.1| two-component system response regulator [Streptomyces
           viridochromogenes DSM 40736]
          Length = 223

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 33/239 (13%), Positives = 73/239 (30%), Gaps = 23/239 (9%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  +     +    +      LA +      +    ++ AL               
Sbjct: 3   IRVLLVDDQPLLRTGFRMILEAEQDLAVVGEAGDGLQALDQVRAL--------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +  R +    +D           L    F      +       
Sbjct: 48  QPDVVLMDIRMPRMDGVEATRQITGPGRDG------PAKVLVLTTFDLDEYVVEALRAGA 101

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +         +   + ++     ++       +  L  Y  ++    +        LT
Sbjct: 102 SGFLLKDAPANELVQAIRVVAAGEAMLAPSITRRL--LDKYATHLPSGDEPVPDTLDTLT 159

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            REVE L  ++ G ++ EIA  L +S  TV  ++  ++ K   + R  A  YA  + +V
Sbjct: 160 DREVEVLKLVARGLSNAEIAADLFVSETTVKTHVGHVLTKLGLRDRVQAAVYAYESGLV 218


>gi|310644345|ref|YP_003949104.1| two component transcriptional regulator, luxr family [Paenibacillus
           polymyxa SC2]
 gi|309249296|gb|ADO58863.1| Two component transcriptional regulator, LuxR family [Paenibacillus
           polymyxa SC2]
          Length = 240

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 31/259 (11%), Positives = 73/259 (28%), Gaps = 37/259 (14%)

Query: 2   NFEIQ--QVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGAS 59
           N E+    + ++L  + +     +  +    D +  +      +                
Sbjct: 3   NQEMSNAPIKVLLADDHQLFREGLKRILNMEDDIEVIGECGDGIQVLE------------ 50

Query: 60  HFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPEN 119
                  +      +D  +  +   +    +          +      +   +       
Sbjct: 51  ---FCNVEKPDIVLMDINMPIENGVEATEKLRE--------MFPDVKVIILSIHDDESYV 99

Query: 120 ITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQ---------- 169
                   N Y     +   +   +  +      I      ++                 
Sbjct: 100 FETLRKGANGYLLKDMEAESLINAIRSVHEGYAFIHPKVTGKLIQQLRRMTYLNETGAMA 159

Query: 170 --ANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRK 227
                        G++  LT RE E L  ++EGK++  I   L IS  TV N+++SI++K
Sbjct: 160 EGHTKEAGVKFVAGENNPLTRREAEVLRLMAEGKSNKMIGEYLFISEKTVKNHVSSILQK 219

Query: 228 TATKTRSGAIAYAVRNNIV 246
                R+ A+  +++   V
Sbjct: 220 MEVDDRTQAVINSIKYGWV 238


>gi|228911248|ref|ZP_04075053.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis IBL 200]
 gi|228848424|gb|EEM93273.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis IBL 200]
          Length = 215

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 37/222 (16%), Positives = 76/222 (34%), Gaps = 12/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D    +  L   +S    +  + E   G    + V         +D  +      
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDLALVGEANNGKEALVKVGETNPDVVLMDLYMPEMDGV 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +   C+     +           +    F      +       + Y     +  ++   +
Sbjct: 65  EATACIKKEYPN--------VKVIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
              +     +  D       L +    + +  +  + +   LT RE E L  +++G ++ 
Sbjct: 117 RSAYKGNIQLHPDIAN---TLLSQTLPVEEKEEEPFLQVGVLTARENEVLQLLAKGMSNK 173

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 174 EIASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGIV 215


>gi|329939099|ref|ZP_08288473.1| two-component response regulator [Streptomyces griseoaurantiacus
           M045]
 gi|329301984|gb|EGG45877.1| two-component response regulator [Streptomyces griseoaurantiacus
           M045]
          Length = 223

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 34/239 (14%), Positives = 73/239 (30%), Gaps = 23/239 (9%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           V ++L  +     +    +      LA +      +    ++ AL               
Sbjct: 3   VRVLLVDDQPLLRTGFRMILEAEQDLAVVGEAGDGLQALDQVRAL--------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +  R +    +D           L    F      +       
Sbjct: 48  QPDVVLMDIRMPRMDGVEATRQITGPGRDG------PAKVLVLTTFDLDEYVVEALRAGA 101

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +         +   + ++     ++       +  L  Y  ++    +        LT
Sbjct: 102 SGFLLKDAPANELVQAIRVVAAGEAMLAPSITRRL--LDKYATHLPSGDEPVPDTLHTLT 159

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            REVE L  ++ G ++ EIA  L +S  TV  ++  ++ K   + R  A  YA  + +V
Sbjct: 160 DREVEVLKLVARGLSNAEIAADLFVSETTVKTHVGHVLTKLGLRDRVQAAVYAYESGLV 218


>gi|328552560|gb|AEB23052.1| two-component response regulator (YhcY) [Bacillus amyloliquefaciens
           TA208]
 gi|328910960|gb|AEB62556.1| two-component response regulator [Bacillus amyloliquefaciens LL3]
          Length = 214

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 39/218 (17%), Positives = 70/218 (32%), Gaps = 16/218 (7%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
             D       L    +    +  + E   GA               +D  +      +  
Sbjct: 6   ADDHHVVRKGLRYFFATQEDIEVVGEASTGAEALQQAEKTGPDIILMDLSMPDMDGIEAA 65

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLL 147
             +A         V+          +      I         Y         +   L  +
Sbjct: 66  N-IAAERFPDISIVV-------LTSYSDREHVIPALKAGAKAYQLKDAQPDDLVKTLREV 117

Query: 148 FPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIA 207
           +     +  D       +  +  N     D +  K ++LT RE + L  I++GK++ EIA
Sbjct: 118 YSGRYRLSAD-------IVPHVLNHMVQDDQNKEKYYQLTPREKDVLQEIAKGKSNKEIA 170

Query: 208 VILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
             L IS  TV  ++++++ K     R+ A  YAV+ NI
Sbjct: 171 ASLFISEKTVKTHVSNLLSKLNLSDRTQAALYAVKYNI 208


>gi|290961675|ref|YP_003492857.1| two-component response regulator [Streptomyces scabiei 87.22]
 gi|260651201|emb|CBG74322.1| putative two-component response regulator [Streptomyces scabiei
           87.22]
          Length = 223

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 33/239 (13%), Positives = 73/239 (30%), Gaps = 23/239 (9%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           V ++L  +     +    +      +A +      +    ++ AL               
Sbjct: 3   VRVLLVDDQPLLRTGFRMILEAEQDIAVVGEAGDGLQALDQVRAL--------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +  R +    +D           L    F      +       
Sbjct: 48  QPDVVLMDIRMPRMDGVEATRQITGPGRDG------PAKVLVLTTFDLDEYVVEALRAGA 101

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +         +   + ++     ++       +  L  Y  ++    +        LT
Sbjct: 102 SGFLLKDAPANELVQAIRVVAGGEAMLAPSITRRL--LDKYAEHLPSGDEQVPDTLHTLT 159

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            REVE L  ++ G ++ EIA  L +S  TV  ++  ++ K   + R  A  YA  + +V
Sbjct: 160 DREVEVLKLVARGLSNAEIAADLFVSETTVKTHVGHVLTKLGLRDRVQAAVYAYESGLV 218


>gi|323489900|ref|ZP_08095122.1| transcriptional regulatory protein degU (protease production
           enhancer protein) [Planococcus donghaensis MPA1U2]
 gi|323396407|gb|EGA89231.1| transcriptional regulatory protein degU (protease production
           enhancer protein) [Planococcus donghaensis MPA1U2]
          Length = 224

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 31/229 (13%), Positives = 67/229 (29%), Gaps = 13/229 (5%)

Query: 23  VSHLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSD 81
           ++ +    D       +   + +      + E   G     L   +      +D  +   
Sbjct: 1   MTKIIIIDDHQLFREGVKRILDFESSFEVVAEGGDGGEVIKLYEENRPDVVLMDINMPQK 60

Query: 82  WPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIR 141
              +    +                 +   +                 Y     D   I 
Sbjct: 61  NGVEATAELIAQ--------FPDAKVIMLSIHDDESYVTHALKTGALGYMLKEMDADAII 112

Query: 142 IGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYD----VHWGKDFELTGREVECLTWI 197
             + ++   G  +       + +     +                   LT RE E L  +
Sbjct: 113 QAIKVVAKGGSYLHPKVTRNLVMEFRRLSERENKGSFHQTEIRRPYHLLTKRESEVLQLL 172

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++G+++  I   L IS  TV N+++SI++K     R+ A+  A++N  V
Sbjct: 173 TDGQSNRVIGETLFISEKTVKNHVSSILQKMQVNDRTQAVVTAIKNGWV 221


>gi|253732505|ref|ZP_04866670.1| response regulator [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253723786|gb|EES92515.1| response regulator [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
          Length = 207

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 35/226 (15%), Positives = 77/226 (34%), Gaps = 21/226 (9%)

Query: 23  VSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFL--LVRWDLFQEQKLDSIVSS 80
           ++ +    D       L   +S    +  L ++     FL  L   +      LD ++  
Sbjct: 1   MNKVILVDDHYIVRQGLRFLLSTIENIEVLQDFADGETFLEYLKEHEHPDIVLLDLVMPG 60

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARI 140
               + +     +              L    +      I+      + Y     +  ++
Sbjct: 61  MNGIE-ITEYIKAHYPDI-------KVLVLTSYVDDEHVISAINKGADGYEMKDIEPQQL 112

Query: 141 RIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEG 200
              +  +    ++I                ++F++         +L+ RE+E L  + +G
Sbjct: 113 IETIRRVMNGEKMIHP-----------KAQDVFETVSQKPHYTNKLSKREIEVLREMVKG 161

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           KT+ EIA  L +S  T+  +++ I  K     R+ A  YA+ N ++
Sbjct: 162 KTNKEIAETLFVSEKTIKTHVSHIFSKLQVSDRTQAAIYAMENKLI 207


>gi|541657|dbj|BAA06489.1| LasR [Pseudomonas aeruginosa]
          Length = 239

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 42/233 (18%), Positives = 72/233 (30%), Gaps = 17/233 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           D    +      + W+  +  +   +G S  L        +   ++ +  ++P       
Sbjct: 5   DGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHY 64

Query: 91  ALSEKDKYYNVLQRPTELFCPVFH----------TLPENITPPAGMDNRYCSLTFDVARI 140
             +   +    +   T+   P+F                    AG+              
Sbjct: 65  DRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGE 124

Query: 141 RIGLMLL-----FPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWG--KDFELTGREVEC 193
              L L        +    +   L  + +L  Y               K   LT RE E 
Sbjct: 125 LGALSLSVEAENRAEANRFIESVLPTLWMLKDYALQSGAGLAFEHPVSKPVVLTSREKEV 184

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GKTS EI+VI   S   VN ++ +I RK    +R  A   AV   ++
Sbjct: 185 LQWCAIGKTSWEISVICNCSEANVNFHMGNIRRKFGVTSRRVAAIMAVNLGLI 237


>gi|261420594|ref|YP_003254276.1| LuxR family transcriptional regulator [Geobacillus sp. Y412MC61]
 gi|319768265|ref|YP_004133766.1| LuxR family transcriptional regulator [Geobacillus sp. Y412MC52]
 gi|261377051|gb|ACX79794.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. Y412MC61]
 gi|317113131|gb|ADU95623.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. Y412MC52]
          Length = 224

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 31/231 (13%), Positives = 69/231 (29%), Gaps = 16/231 (6%)

Query: 19  RTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIV 78
           R + +       + + R++  +                G+    +V         +D  +
Sbjct: 4   RIAIIDDHQLFREGIKRILEFEGDFEVVAE-----GSDGSEALSIVETYRPDLVLMDINM 58

Query: 79  SSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVA 138
                 +  + +                 +   +       +         Y     D  
Sbjct: 59  PDINGVEATKQLIE--------AYPDTKVVVLSIHDDENYVMRALQTGAAGYLLKEMDAD 110

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSY---DVHWGKDFELTGREVECLT 195
            +   + ++   G  +       +                          LT RE E L 
Sbjct: 111 TLIEAVRIVAEGGSYLHPKVTHNLIREYRRLTTEKGGAVVKQEVRRPLHLLTRRECEVLQ 170

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            +++GK++  I   L IS  TV N+++SI++K +   R+ A+  A++N  V
Sbjct: 171 LLADGKSNRAIGEALYISEKTVKNHVSSILQKLSVNDRTQAVVVAIKNGWV 221


>gi|83716885|ref|YP_439427.1| ATP-dependent transcription regulator LuxR [Burkholderia
           thailandensis E264]
 gi|257142551|ref|ZP_05590813.1| ATP-dependent transcription regulator LuxR [Burkholderia
           thailandensis E264]
 gi|83650710|gb|ABC34774.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia thailandensis E264]
          Length = 234

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 39/226 (17%), Positives = 78/226 (34%), Gaps = 12/226 (5%)

Query: 33  LARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMAL 92
           L      +        +      +G  +        F       ++ S++P         
Sbjct: 9   LNEFSRSENPQHVNSVLTRAAATLGYEYAAYGMRRPFPISNPQILMVSNYPDRWQERYIE 68

Query: 93  SEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVARIRIGL 144
           +      + ++       PV  +                 G+ + + S +         L
Sbjct: 69  ARFANVDSAVKAALGSDRPVTWSASTNASKSAFWAEALSFGIAHGWSSASRGADGTIGVL 128

Query: 145 MLLFPKGRIILRDRLWE---IGLLAAYQANMFKSYDVHWGK-DFELTGREVECLTWISEG 200
            L   +  I   ++      +  LA         +     + D +LT RE + L W ++G
Sbjct: 129 SLSRRQDAIDTAEKFRNESIVHWLANVAHASMAPFLPAADEFDPDLTRRETDVLKWTADG 188

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           KT+ EIA+IL IS +TVN ++ +I+ K  +  +  A+A A    ++
Sbjct: 189 KTAYEIALILSISESTVNFHVKNIVSKLGSTNKIQAVAKAALMGML 234


>gi|21220150|ref|NP_625929.1| two-component response regulator [Streptomyces coelicolor A3(2)]
 gi|256788738|ref|ZP_05527169.1| two-component response regulator [Streptomyces lividans TK24]
 gi|289772632|ref|ZP_06532010.1| two-component system response regulator [Streptomyces lividans
           TK24]
 gi|6119696|emb|CAB59507.1| putative two-component response regulator [Streptomyces coelicolor
           A3(2)]
 gi|289702831|gb|EFD70260.1| two-component system response regulator [Streptomyces lividans
           TK24]
          Length = 223

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 34/239 (14%), Positives = 74/239 (30%), Gaps = 23/239 (9%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  +     +    +      LA +      +    ++ AL               
Sbjct: 3   IRVLLVDDQPLLRTGFRMILEAEQDLAVVGEAGDGLQALDQVRAL--------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +  R +   E+D           L    F      +       
Sbjct: 48  QPDVVLMDIRMPRMDGVEATRQITGPERDG------PAKVLVLTTFDLDEYVVEALKAGA 101

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +         +   + ++     ++       +  L  Y  ++    +        LT
Sbjct: 102 SGFLLKDAPANELVQAIRVVANGEAMLAPSITRRL--LDKYATHLPSGDEPVPDTLHTLT 159

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            REVE L  ++ G ++ EIA  L +S  TV  ++  ++ K   + R  A  YA  + +V
Sbjct: 160 DREVEVLKLVARGLSNAEIAADLFVSETTVKTHVGHVLTKLGLRDRVQAAVYAYESGLV 218


>gi|23099974|ref|NP_693440.1| two-component response regulator [Oceanobacillus iheyensis HTE831]
 gi|22778205|dbj|BAC14475.1| two-component response regulator involved in degradative enzyme
           [Oceanobacillus iheyensis HTE831]
          Length = 230

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/245 (15%), Positives = 76/245 (31%), Gaps = 28/245 (11%)

Query: 7   QVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRW 66
           +V IVL  + +     V  +         +   D                G+    LV+ 
Sbjct: 6   EVRIVLIDDHKLFREGVKRILDFEPSFEVVAEGDD---------------GSMASKLVKE 50

Query: 67  DLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGM 126
           +      +D  +           +                 +   +              
Sbjct: 51  NAPDVVLMDINMPEINGVQATADLVRY--------FPNSKVIILSIHDDESYVTHALKTG 102

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIG----LLAAYQANMFKSYDVHWGK 182
              Y     D   +   + ++   G  +       +      LA   ++      + + K
Sbjct: 103 AQGYLLKEMDSDALIDAIKVVSDGGSYLHPRVTHNLVKEYRRLAKENSSSIADKGIEYRK 162

Query: 183 DFE-LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
               LT RE + L  +++GK++  +A  L IS  TV N++++I++K     R+ A+  A+
Sbjct: 163 PLHLLTKRECQVLQLLADGKSNRAVAETLYISEKTVKNHVSNILQKMNVNDRTQAVVSAI 222

Query: 242 RNNIV 246
           R   V
Sbjct: 223 RKGWV 227


>gi|302552997|ref|ZP_07305339.1| two-component system regulator [Streptomyces viridochromogenes DSM
           40736]
 gi|302470615|gb|EFL33708.1| two-component system regulator [Streptomyces viridochromogenes DSM
           40736]
          Length = 227

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 28/231 (12%), Positives = 66/231 (28%), Gaps = 15/231 (6%)

Query: 16  DEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLD 75
           D  R   V            ++     +             G                +D
Sbjct: 7   DPIRVLIVDDQAMVRQGFTVLLGTQPDIEVVGEAKD-----GEGGVAKAAETAPDVVLMD 61

Query: 76  SIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTF 135
             +      +    +  +  D           L    F              + +     
Sbjct: 62  IRMPGIGGIEATERITAAHPDI--------RVLVLTTFDLDEYVYDALRAGASGFLLKDA 113

Query: 136 DVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLT 195
              ++   + ++     ++      ++    +   +  +       +  +LT RE E L 
Sbjct: 114 SSDQLAEAVRVIAAGDALLAPVITRKLIAEFSRLDDRPR--APLKERIGDLTERETEVLA 171

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            I++G ++ EIA  L ++  TV  ++  I+ K   + R+ A  +A  + +V
Sbjct: 172 LIAQGLSNAEIARHLFVAEQTVKTHVGRILVKLGLRDRTQAAVFAYESGLV 222


>gi|283471119|emb|CAQ50330.1| two-component response regulator [Staphylococcus aureus subsp.
           aureus ST398]
          Length = 207

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 35/226 (15%), Positives = 77/226 (34%), Gaps = 21/226 (9%)

Query: 23  VSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFL--LVRWDLFQEQKLDSIVSS 80
           ++ +    D       L   +S    +  L ++     FL  L   +      LD ++  
Sbjct: 1   MNKVILVDDHYIVRQGLRFLLSTIENIEVLQDFADGETFLEYLKEHEHPDIVLLDLVMPG 60

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARI 140
               + +     +              L    +      I+      + Y     +  ++
Sbjct: 61  MNGIE-ITEYIKAHYPHI-------KVLVLTSYVDDEHVISAINKGADGYEMKDVEPQQL 112

Query: 141 RIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEG 200
              +  +    ++I                ++F++         +L+ RE+E L  + +G
Sbjct: 113 IETIRRVMNGEKMIHP-----------KAQDVFETVSQKPHYTNKLSKREIEVLREMVKG 161

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           KT+ EIA  L +S  T+  +++ I  K     R+ A  YA+ N ++
Sbjct: 162 KTNKEIAETLFVSEKTIKTHVSHIFSKLQVSDRTQAAIYAMENKLI 207


>gi|229000199|ref|ZP_04159768.1| Two component transcriptional regulator, LuxR [Bacillus mycoides
           Rock3-17]
 gi|229007721|ref|ZP_04165313.1| Two component transcriptional regulator, LuxR [Bacillus mycoides
           Rock1-4]
 gi|228753589|gb|EEM03035.1| Two component transcriptional regulator, LuxR [Bacillus mycoides
           Rock1-4]
 gi|228759531|gb|EEM08508.1| Two component transcriptional regulator, LuxR [Bacillus mycoides
           Rock3-17]
          Length = 215

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/221 (19%), Positives = 81/221 (36%), Gaps = 10/221 (4%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFD 85
           +    D    +  L   +S    +  + E       L+      QE + D ++   +  +
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDLELVGEANNGKEALV----KVQEVQPDIVLMDLYMPE 60

Query: 86  LVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLM 145
           +    A +   K Y  ++         F      +       + Y     +  ++   + 
Sbjct: 61  MDGIEATACIKKEYPNVKVL---VLTSFSDQAHVLPALKAGASGYILKDVEPDQLVEAIR 117

Query: 146 LLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDE 205
             +     +  D      LL+       +    +   D  LT RE E L  +++G ++ E
Sbjct: 118 SAYKGNIQLHPDIA--SALLSQTFPQEEQQESSNIHVDV-LTARENEVLQLLAKGMSNKE 174

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           IA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 175 IASVLVITEKTVKAHVSSILGKLNLSDRTQAALYAVKNGIV 215


>gi|167839810|ref|ZP_02466494.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis MSMB43]
          Length = 236

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 79/226 (34%), Gaps = 12/226 (5%)

Query: 33  LARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMAL 92
           L      +        +      +G  +        F       ++ S++P         
Sbjct: 11  LNEFSRSENPKHVISVLTRAAATLGYEYAAYGMRRPFPISNPQILMVSNYPARWQERYIE 70

Query: 93  SEKDKYYNVLQRPTELFCPVFHTLP--------ENITPPAGMDNRYCSLTFDVARIRIGL 144
           +        ++       PV  + P               G+ + + S +         L
Sbjct: 71  ARFANVDGAVKAALGSDRPVTWSAPANASKSAFWAEALSFGIAHGWSSASRGADGAIGVL 130

Query: 145 MLLFPKGRIILRDRLWE---IGLLAAYQANMFKSYDVHWGK-DFELTGREVECLTWISEG 200
            L   +G I   ++      +  LA         +     + D +LT RE + L W ++G
Sbjct: 131 SLSRTQGPIDTAEKFRNESIVHWLANVAHASMAPFLPAADEFDPDLTRRETDVLKWTADG 190

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           KT+ EIA+IL IS +TVN ++ +I+ K  +  +  A+A A    ++
Sbjct: 191 KTAYEIALILSISESTVNFHVKNIVSKLGSTNKIQAVAKAALMGML 236


>gi|167577870|ref|ZP_02370744.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia thailandensis TXDOH]
          Length = 236

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 39/226 (17%), Positives = 78/226 (34%), Gaps = 12/226 (5%)

Query: 33  LARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMAL 92
           L      +        +      +G  +        F       ++ S++P         
Sbjct: 11  LNEFSRSENPQHVNSVLTRAAATLGYEYAAYGMRRPFPISNPQILMVSNYPDRWQERYIE 70

Query: 93  SEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVARIRIGL 144
           +      + ++       PV  +                 G+ + + S +         L
Sbjct: 71  ARFANVDSAVKAALGSDRPVTWSASTNASKSAFWAEALSFGIAHGWSSASRGADGTIGVL 130

Query: 145 MLLFPKGRIILRDRLWE---IGLLAAYQANMFKSYDVHWGK-DFELTGREVECLTWISEG 200
            L   +  I   ++      +  LA         +     + D +LT RE + L W ++G
Sbjct: 131 SLSRRQDAIDTAEKFRNESIVHWLANVAHASMAPFLPAADEFDPDLTRRETDVLKWTADG 190

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           KT+ EIA+IL IS +TVN ++ +I+ K  +  +  A+A A    ++
Sbjct: 191 KTAYEIALILSISESTVNFHVKNIVSKLGSTNKIQAVAKAALMGML 236


>gi|288922222|ref|ZP_06416420.1| two component transcriptional regulator, LuxR family [Frankia sp.
           EUN1f]
 gi|288346413|gb|EFC80744.1| two component transcriptional regulator, LuxR family [Frankia sp.
           EUN1f]
          Length = 239

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 39/234 (16%), Positives = 72/234 (30%), Gaps = 10/234 (4%)

Query: 13  NREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQE 71
              D  R      +    D    +  L   +     +  +     G    +L        
Sbjct: 11  ADADPTRNGAPIRVLVVDDHELFLQGLQVVLDTEDDISVVGRAADGQEALVLASGTAPDI 70

Query: 72  QKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYC 131
             +D  +           +  S        + R   +   V     +           Y 
Sbjct: 71  VLMDVRMPGRDGIAAAGAIKRS--------VPRVRVVMLTVSDEESDLFEAIKAGAVGYL 122

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREV 191
             +     +   +  +     +I      ++ ++           D        LT RE+
Sbjct: 123 LKSIPPHEVADAVRAVHSGQSLISPSMASKL-MVEFATMARGGGEDRPRAHAPHLTAREL 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           E L  ++EG+ + EIA  L IS NTV N++ +I+ K    +R  A+ YAVR  +
Sbjct: 182 EVLKLVAEGRANREIARKLFISENTVKNHVRNILDKLQLHSRMEAVMYAVRQGL 235


>gi|160882054|ref|YP_001561022.1| two component LuxR family transcriptional regulator [Clostridium
           phytofermentans ISDg]
 gi|160430720|gb|ABX44283.1| two component transcriptional regulator, LuxR family [Clostridium
           phytofermentans ISDg]
          Length = 213

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/243 (15%), Positives = 81/243 (33%), Gaps = 34/243 (13%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           +  + +V+  + +     +  L      +  +                    G      V
Sbjct: 1   MGTIRVVIADDHKMVREGLKQLLELDGDIQVVGEASD---------------GEQCIQKV 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                    LD  + +      ++ +  +   +          L   + + +   +    
Sbjct: 46  VDTNPDVLLLDINMPTMNGLQTLQELRRNNNKQ--------KVLMLTIHNEIEYLLRAVD 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
              N Y     + + ++  +  ++     I      E+           +        + 
Sbjct: 98  IGVNGYVLKDSESSVLKKAIYTIYQGETYIEPSLTPEL----------KERMQSPSSSNT 147

Query: 185 E-LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           E LT RE++ L  ++EG  + EIA  L IS  TV N++++I +K +   R+ A  YA++N
Sbjct: 148 EILTRREIDVLKLLAEGLFNKEIAYRLSISEKTVKNHVSNIFKKISVSDRTQAAVYAIKN 207

Query: 244 NIV 246
           N V
Sbjct: 208 NFV 210


>gi|295401191|ref|ZP_06811164.1| two component transcriptional regulator, LuxR family [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312109465|ref|YP_003987781.1| LuxR family transcriptional regulator [Geobacillus sp. Y4.1MC1]
 gi|294976784|gb|EFG52389.1| two component transcriptional regulator, LuxR family [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311214566|gb|ADP73170.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. Y4.1MC1]
          Length = 226

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 31/233 (13%), Positives = 74/233 (31%), Gaps = 18/233 (7%)

Query: 19  RTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIV 78
           R + +       + + R++  +                G+    +V         +D  +
Sbjct: 4   RIAIIDDHQLFREGMKRILEFEEEFEVVAE-----GADGSEALAIVEQHRPDIVIMDINM 58

Query: 79  SSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVA 138
            +    +  R +          +      +   +       +         Y     D  
Sbjct: 59  PNTNGVEATRQLVE--------MYPDTKIVVLSIHDDENYVMRALQMGATGYLLKDMDAD 110

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-----LTGREVEC 193
            +   + ++   G  +       +       +      +    ++       LT RE E 
Sbjct: 111 TLIEAVKIVAEGGSYLHPKITHNLIREYRRLSAGKNEKEGEGKREARWPLHLLTRRECEV 170

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L  +++GK++  I   L IS  TV N++++I++K     R+ A+  A++N  V
Sbjct: 171 LQLLADGKSNRGIGEALYISEKTVKNHVSNILQKLNVNDRTQAVIVAIKNGWV 223


>gi|297560440|ref|YP_003679414.1| LuxR family transcriptional regulator [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296844888|gb|ADH66908.1| two component transcriptional regulator, LuxR family [Nocardiopsis
           dassonvillei subsp. dassonvillei DSM 43111]
          Length = 234

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 36/240 (15%), Positives = 75/240 (31%), Gaps = 21/240 (8%)

Query: 7   QVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRW 66
            V+++L  +     +    +   +  L+ +                    G       R 
Sbjct: 2   PVSVLLVDDQPLVRAGFRMILESAPHLSVVGEASD---------------GREAVRATRG 46

Query: 67  DLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGM 126
            L     +D  +      +  R +          +  R   L    F      +      
Sbjct: 47  LLPDVVLMDVRMPGMDGIEATRQIVS----WARPLGHRVRVLALTTFDLDEYAVEVLRAG 102

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFEL 186
            + +       A +   + ++      I    L  +  L  +   +  +       +  L
Sbjct: 103 ASGFLLKDAPPAELVSAVEVVADGAAAISPAVLNRL--LDRFAPLLPSASPATEPAEDTL 160

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T RE E L  ++ G ++ EIA  L +   TV +++ SI+ K   + R  A+ YA  + +V
Sbjct: 161 TAREHEVLRLLARGWSNAEIAAHLVLGETTVKSHVGSILTKLELRDRVQAVVYAYEHGLV 220


>gi|53722204|ref|YP_111189.1| N-acyl-homoserine lactone dependent regulatory protein
           [Burkholderia pseudomallei K96243]
 gi|76817623|ref|YP_335301.1| N-acyl-homoserine lactone dependent regulatory protein
           [Burkholderia pseudomallei 1710b]
 gi|126444655|ref|YP_001062648.1| ATP-dependent transcriptional regulator LuxR [Burkholderia
           pseudomallei 668]
 gi|52212618|emb|CAH38644.1| N-acyl-homoserine lactone dependent regulatory protein
           [Burkholderia pseudomallei K96243]
 gi|76582096|gb|ABA51570.1| N-acyl-homoserine lactone dependent regulatory protein
           [Burkholderia pseudomallei 1710b]
 gi|126224146|gb|ABN87651.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 668]
          Length = 234

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 40/226 (17%), Positives = 78/226 (34%), Gaps = 12/226 (5%)

Query: 33  LARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMAL 92
           L      +        +      +G  +        F       ++ S++P         
Sbjct: 9   LNEFSRSENPQHVISVLTRAAATLGYEYAAYGMRRPFPISNPPILMVSNYPARWQERYIE 68

Query: 93  SEKDKYYNVLQRPTELFCPVFHTLP--------ENITPPAGMDNRYCSLTFDVARIRIGL 144
           +        ++       PV  + P               G+ + + S +         L
Sbjct: 69  ARFANIDGAVKAALGSDRPVTWSAPANASKSAFWAEALSFGIAHGWSSASRGADGAIGVL 128

Query: 145 MLLFPKGRIILRDRLWE---IGLLAAYQANMFKSYDVHWGK-DFELTGREVECLTWISEG 200
            L   +  I   ++      +  LA         +     + D +LT RE + L W ++G
Sbjct: 129 TLSRTQDPIDTAEKFRNESIVHWLANVAHASMAPFLPAADEFDPDLTRRETDVLKWTADG 188

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           KT+ EIA+IL IS +TVN ++ +I+ K  +  +  A+A A    ++
Sbjct: 189 KTAYEIALILSISESTVNFHVKNIVSKLGSTNKIQAVAKAALMGML 234


>gi|300693708|ref|YP_003749681.1| transcriptional activator of quorum sensing autoinducer synthesis
           transcription regulator protein (luxr family) [Ralstonia
           solanacearum PSI07]
 gi|299075745|emb|CBJ35050.1| transcriptional activator of quorum sensing autoinducer synthesis
           transcription regulator protein (LuxR family) [Ralstonia
           solanacearum PSI07]
          Length = 238

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 40/223 (17%), Positives = 78/223 (34%), Gaps = 14/223 (6%)

Query: 38  PLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDK 97
               T      + A    +G  H            +   I+ +++P         +    
Sbjct: 15  AATSTSDVFAHIEAAALALGFEHVAYGFRAPLPLSEPKIILLNNYPQAWRERYLEAGYLH 74

Query: 98  YYNVLQRPTELFCPVFHTLP--------ENITPPAGMDNRYCSLTFDVARIRIGLML--- 146
               +        PV  + P         +     G+   +   + D   +   L L   
Sbjct: 75  VDPSVAHACRSQAPVIWSDPLFQYTPALWDEAQAQGLRVGWAQSSLDSLGVGGMLSLSRS 134

Query: 147 ---LFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
              L  +       R+  +  +A    +     D+    D  LTGREVE + W ++GK++
Sbjct: 135 CEPLTARELADNTRRMQWLTHMAHLALSRLLRADLAGDSDDSLTGREVEVMKWTADGKSA 194

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            +IA IL IS+NTV+ ++ + ++K     ++ A+  A     +
Sbjct: 195 QDIADILAISKNTVDFHVKNAVKKLQAVNKTAAVVRAAMLGYL 237


>gi|322381417|ref|ZP_08055416.1| two-component response regulator YvqE responding to cell wall
           stress-like protein [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321154644|gb|EFX46919.1| two-component response regulator YvqE responding to cell wall
           stress-like protein [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 208

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/237 (15%), Positives = 72/237 (30%), Gaps = 30/237 (12%)

Query: 10  IVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLF 69
           ++L  + E     ++ +    D +  +                    G     L +    
Sbjct: 1   MLLVDDHEMVRIGLAAVLGTEDGIEVVGEASN---------------GEEGIRLTQEYKP 45

Query: 70  QEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNR 129
               +D ++      +  R +                 +    F    +           
Sbjct: 46  DVVLMDLVMEGMDGIETTRKLLQL--------YPECKVIVLTSFLDDEKMYPVLEAGAFS 97

Query: 130 YCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGR 189
           Y   T     I   +        I+           A    N F+          +LT R
Sbjct: 98  YLLKTSRAQEIAQAIRAAVKGQPILESQV-------ATKIMNRFRQPKPESAPHEDLTER 150

Query: 190 EVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E+E L  I+ GK++ E+A  L I   TV  ++ ++++K   + R+ A  YA ++ IV
Sbjct: 151 EMEVLRLIASGKSNQEVADELFIGVKTVKFHVTNVLQKLGVEDRTQAAIYAFKHGIV 207


>gi|302521432|ref|ZP_07273774.1| two-component system response regulator [Streptomyces sp. SPB78]
 gi|302430327|gb|EFL02143.1| two-component system response regulator [Streptomyces sp. SPB78]
          Length = 264

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 38/235 (16%), Positives = 78/235 (33%), Gaps = 12/235 (5%)

Query: 14  REDEQRTSFVS-HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQE 71
            EDE R       +    D       L+  ++    +  + E   G+         L   
Sbjct: 37  DEDEPRPRAEPIRVLVVDDHALFRRGLEIVLATEEDIEVVGEAGDGSEAVEKATDLLPDI 96

Query: 72  QKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYC 131
             +D  +      +    +          V      +   +     +           Y 
Sbjct: 97  VLMDVRMPKRGGIEACTAIKE--------VAPSAKIIMLTISDEEADLYDAIKAGATGYL 148

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREV 191
                   +   +  +      I      ++  L+ +++ + ++ +        LT RE+
Sbjct: 149 LKEISTDEVATAIRAVADGQSQISPSMASKL--LSEFKSMIQRTDERRLVPAPRLTDREM 206

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I+
Sbjct: 207 EVLKLVATGMNNKDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKIL 261


>gi|315271266|gb|ACO45472.2| putative response regulator, NarL [Deinococcus deserti VCD115]
          Length = 231

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 29/222 (13%), Positives = 64/222 (28%), Gaps = 16/222 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           L    D           +     ++ + E   G    +  R        +D  +      
Sbjct: 20  LLLVDDHPVVRKGTRELLEGETDLHVIGEAGSGEEAVVKARDLQPDVILMDVSMPGMNGI 79

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +  + +                 L    +                Y         +   +
Sbjct: 80  EATKAIKAER--------PGVGVLVLTSYDDDAYIFALLEAGAAGYLLKNASEDDLLGAV 131

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
             +      +      +           F ++      + +L+ RE+E L   + G+T+ 
Sbjct: 132 RAVAAGESALHPSVARK-------VLERFSTHTTPTPPEDDLSPRELEVLRVAATGRTNK 184

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA  L IS  TV  ++A+I  K    +R+ A+ + ++   +
Sbjct: 185 EIARDLDISPRTVQVHLANIFSKLGVGSRTEAVLHGIKRGWI 226


>gi|126458323|ref|YP_001075604.1| ATP-dependent transcriptional regulator LuxR [Burkholderia
           pseudomallei 1106a]
 gi|134283391|ref|ZP_01770091.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 305]
 gi|167723653|ref|ZP_02406889.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei DM98]
 gi|167819785|ref|ZP_02451465.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 91]
 gi|167849631|ref|ZP_02475139.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei B7210]
 gi|167898230|ref|ZP_02485632.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 7894]
 gi|167906588|ref|ZP_02493793.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei NCTC 13177]
 gi|237510070|ref|ZP_04522785.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei MSHR346]
 gi|242312988|ref|ZP_04812005.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106b]
 gi|254190270|ref|ZP_04896779.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pasteur 52237]
 gi|254193498|ref|ZP_04899932.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei S13]
 gi|254262913|ref|ZP_04953778.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1710a]
 gi|254300529|ref|ZP_04967975.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 406e]
 gi|126232091|gb|ABN95504.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106a]
 gi|134245140|gb|EBA45234.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 305]
 gi|156105358|gb|ABU49178.1| BpsR2 [Burkholderia pseudomallei]
 gi|157810414|gb|EDO87584.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 406e]
 gi|157937947|gb|EDO93617.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei Pasteur 52237]
 gi|169650251|gb|EDS82944.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei S13]
 gi|235002275|gb|EEP51699.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei MSHR346]
 gi|242136227|gb|EES22630.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1106b]
 gi|254213915|gb|EET03300.1| autoinducer-binding transcriptional regulator, LuxR family
           [Burkholderia pseudomallei 1710a]
          Length = 236

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 40/226 (17%), Positives = 78/226 (34%), Gaps = 12/226 (5%)

Query: 33  LARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMAL 92
           L      +        +      +G  +        F       ++ S++P         
Sbjct: 11  LNEFSRSENPQHVISVLTRAAATLGYEYAAYGMRRPFPISNPPILMVSNYPARWQERYIE 70

Query: 93  SEKDKYYNVLQRPTELFCPVFHTLP--------ENITPPAGMDNRYCSLTFDVARIRIGL 144
           +        ++       PV  + P               G+ + + S +         L
Sbjct: 71  ARFANIDGAVKAALGSDRPVTWSAPANASKSAFWAEALSFGIAHGWSSASRGADGAIGVL 130

Query: 145 MLLFPKGRIILRDRLWE---IGLLAAYQANMFKSYDVHWGK-DFELTGREVECLTWISEG 200
            L   +  I   ++      +  LA         +     + D +LT RE + L W ++G
Sbjct: 131 TLSRTQDPIDTAEKFRNESIVHWLANVAHASMAPFLPAADEFDPDLTRRETDVLKWTADG 190

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           KT+ EIA+IL IS +TVN ++ +I+ K  +  +  A+A A    ++
Sbjct: 191 KTAYEIALILSISESTVNFHVKNIVSKLGSTNKIQAVAKAALMGML 236


>gi|13625780|gb|AAK35156.1|AF296284_2 transcriptional activator BviR [Burkholderia cepacia]
 gi|116878313|gb|ABK32010.1| transcriptional regulator [Burkholderia vietnamiensis]
 gi|116878322|gb|ABK32016.1| transcriptional regulator [Burkholderia vietnamiensis]
          Length = 237

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 36/225 (16%), Positives = 67/225 (29%), Gaps = 14/225 (6%)

Query: 36  MIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEK 95
                      +   A    +G  H            K   ++ S++P   V        
Sbjct: 12  FATAKSEADVFLEFSADVRALGFDHCSFGLRIPLPISKPQFMLQSNYPQTWVERYVSQNY 71

Query: 96  DKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVARIRIGLMLL 147
                 ++       P+                    G+ + +C  +         + ++
Sbjct: 72  FAVDPTVRHGLSRMSPLIWRADSQTQCVQFWEEAGQHGLRHGWCMPSVSRTGAIGLITMV 131

Query: 148 FPKGRIILRDRLWE------IGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGK 201
                I  R+   +      +   A Y  +M     +      ELT RE E L W + GK
Sbjct: 132 RSGEPIEERELAEKGYQMSWLANTANYAMSMHLLQRLVPEYTVELTVREREALQWSAAGK 191

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T  EI  I+ +   TV  ++ + MRK     ++ A   A    ++
Sbjct: 192 TYAEIGKIMHVDDRTVKFHLVNAMRKLNAANKTEAAVKATMLGLL 236


>gi|289642814|ref|ZP_06474951.1| two component transcriptional regulator, LuxR family [Frankia
           symbiont of Datisca glomerata]
 gi|289507383|gb|EFD28345.1| two component transcriptional regulator, LuxR family [Frankia
           symbiont of Datisca glomerata]
          Length = 233

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 33/242 (13%), Positives = 73/242 (30%), Gaps = 24/242 (9%)

Query: 4   EIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL 63
           + + + +++  + E     +  +    + +  +                    G     +
Sbjct: 12  QSEPIRVLVVDDHELFLQGLETVLDLEEDITVVGRAGD---------------GRQAVTI 56

Query: 64  VRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPP 123
                     +D  +      D    +           +     +   V     +     
Sbjct: 57  ATGTTPDIVLMDVRMPYRDGIDAASAIKRE--------VPTAKIVMLTVSDDEADLFEAI 108

Query: 124 AGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKD 183
                 Y   +     +   +  +     +I      ++ ++                  
Sbjct: 109 KAGAVGYLLKSIPPHEVASAVRAVHNGLSLISPSMASKL-IVEFAALARGSDDRPSRVPA 167

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             LT RE+E L  ++EG+ + EIA  L IS NTV N++ +I+ K    +R  A+ YAVR 
Sbjct: 168 PHLTARELEVLKLVAEGRANREIARKLFISENTVKNHVRNILDKLQLHSRMEAVMYAVRQ 227

Query: 244 NI 245
            +
Sbjct: 228 GL 229


>gi|291300839|ref|YP_003512117.1| LuxR family two component transcriptional regulator [Stackebrandtia
           nassauensis DSM 44728]
 gi|290570059|gb|ADD43024.1| two component transcriptional regulator, LuxR family
           [Stackebrandtia nassauensis DSM 44728]
          Length = 219

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/230 (17%), Positives = 73/230 (31%), Gaps = 15/230 (6%)

Query: 16  DEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLD 75
           +  R              A +I     +             G +   L R        +D
Sbjct: 3   EPIRVLICDDQALIRAGFATIIGAQPDLDVVGEC-----ADGRAAVELSRHLNPDIVVMD 57

Query: 76  SIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTF 135
             +      +  R +A +       V      L    F+             + +     
Sbjct: 58  VRMPVLDGIEATRQLAGAGV--EDPV----KVLVVTTFNLDKYVYEALRAGASGFLLKDA 111

Query: 136 DVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLT 195
             A++  G+  +     ++  D   ++       A   +  +     D  LT RE+E L 
Sbjct: 112 PPAQLLHGIRTVASGAALLDPDVTRQL---VGRYAARIRPAEDTPD-DTALTPRELEVLR 167

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
            I+ G ++ EIA  L IS  TV  Y++ I+ K   + R  A+ YA R  +
Sbjct: 168 HIANGLSNSEIAATLVISHETVKTYVSRILTKLGLRDRVQAVVYAYRRGL 217


>gi|297195362|ref|ZP_06912760.1| two-component system response regulator [Streptomyces
           pristinaespiralis ATCC 25486]
 gi|197719268|gb|EDY63176.1| two-component system response regulator [Streptomyces
           pristinaespiralis ATCC 25486]
          Length = 224

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 32/239 (13%), Positives = 73/239 (30%), Gaps = 23/239 (9%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  +     +    +      +A +      +    ++ AL               
Sbjct: 3   IRVLLVDDQPLLRTGFRMILEAEQDIAVVGEAGDGLQALDQVRAL--------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +  R +    +D           L    F      +       
Sbjct: 48  QPDVVLMDIRMPRMDGVEATRQITGPGRDG------PAKVLVLTTFDLDEYVVEALRAGA 101

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +         +   + ++     ++       +  L  Y  ++    +        LT
Sbjct: 102 SGFLLKDAPANELVQAIRVVAAGEAMLAPSITRRL--LDKYADHLPSGEEPVPDTLHTLT 159

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            REVE L  ++ G ++ EIA  L +S  TV  ++  ++ K   + R  A  YA  + +V
Sbjct: 160 DREVEVLKLVARGLSNAEIAADLFVSETTVKTHVGHVLTKLGLRDRVQAAVYAYESGLV 218


>gi|229158972|ref|ZP_04287029.1| Two component transcriptional regulator, LuxR [Bacillus cereus ATCC
           4342]
 gi|228624583|gb|EEK81353.1| Two component transcriptional regulator, LuxR [Bacillus cereus ATCC
           4342]
          Length = 215

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 36/222 (16%), Positives = 72/222 (32%), Gaps = 12/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D    +  L   +S    +  + E   G    + V         +D  +      
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDIELVGEASNGKEALVKVGETNPDVVLMDLYMPEMNGV 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +   C+            +    +    F      +       + Y     +  ++   +
Sbjct: 65  EATACIKKE--------YRDVKVIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
              +     +  D    +           +   +       LT RE E L  +++G ++ 
Sbjct: 117 RSAYKGNIQLHPDIANALLSQTLPVEEKEEEPFIQVD---VLTARENEVLQLLAKGMSNK 173

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 174 EIASVLVITEKTVKAHVSSILSKLHLSDRTQAALYAVKNGIV 215


>gi|228955660|ref|ZP_04117658.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|229072878|ref|ZP_04206076.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           F65185]
 gi|229082623|ref|ZP_04215086.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock4-2]
 gi|229153573|ref|ZP_04281751.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           m1550]
 gi|228630177|gb|EEK86828.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           m1550]
 gi|228701055|gb|EEL53578.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock4-2]
 gi|228710221|gb|EEL62197.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           F65185]
 gi|228804029|gb|EEM50650.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
          Length = 215

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 34/222 (15%), Positives = 71/222 (31%), Gaps = 12/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D    +  L   +S    +  + E   G    + V         +D  +      
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDLELVGEANNGKEALVKVGETTPDVILMDLYMPEMDGV 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +    +     +           +    F      +       + Y     +  ++   +
Sbjct: 65  EATAYIKKEYPN--------VKVIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
              +     +  D    +           +   +       LT RE E L  +++G ++ 
Sbjct: 117 RSAYKGNIQLHPDIANALLSQTLPVEEKEEEPSIQVD---VLTARENEVLQLLAKGMSNK 173

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E+A +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 174 EVASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGIV 215


>gi|167628890|ref|YP_001679389.1| transcriptional regulator, luxr family, putative [Heliobacterium
           modesticaldum Ice1]
 gi|167591630|gb|ABZ83378.1| transcriptional regulator, luxr family, putative [Heliobacterium
           modesticaldum Ice1]
          Length = 214

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/242 (16%), Positives = 77/242 (31%), Gaps = 30/242 (12%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           ++ + ++L  +       V  +         +               L            
Sbjct: 1   MEPIRLILADDHTLLRQGVRKILELDPRFQVLEEAGDGQGAINLARRL------------ 48

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                    +D  +      +  R +   +         +   L         + I    
Sbjct: 49  ---KPDVILMDIHMPGVDGVEATRVLKREQ--------PQTAILVLTAHEEEDQIIRLIE 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
              + Y         +   ++ +   G ++    + ++  LA  + N             
Sbjct: 98  AGVDGYLLKDVSPETLYGAIVTVARGGSVLNPAIVQKV--LAKRRFNR-----TVAHSGD 150

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E L  I++G T+ +IA  L IS  TV N+I +I RK   K R+ A  YA++N 
Sbjct: 151 ELTEREKEVLGLIAQGSTNADIASALFISEKTVKNHITNIFRKLQVKDRTQAALYAIKNR 210

Query: 245 IV 246
           +V
Sbjct: 211 LV 212


>gi|239932265|ref|ZP_04689218.1| two-component response regulator [Streptomyces ghanaensis ATCC
           14672]
 gi|291440629|ref|ZP_06580019.1| two-component system response regulator [Streptomyces ghanaensis
           ATCC 14672]
 gi|291343524|gb|EFE70480.1| two-component system response regulator [Streptomyces ghanaensis
           ATCC 14672]
          Length = 223

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 33/239 (13%), Positives = 74/239 (30%), Gaps = 23/239 (9%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  +     +    +      +A +      +    ++ AL               
Sbjct: 3   IRVLLVDDQPLLRTGFRMILEAEQDIAVVGEAGDGLQALDQVRAL--------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +  R +   E+D           L    F      +       
Sbjct: 48  QPDVVLMDIRMPRMDGVEATRQITGPERDG------PAKVLVLTTFDLDEYVVEALRAGA 101

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +         +   + ++     ++       +  L  Y  ++    +        LT
Sbjct: 102 SGFLLKDAPANELVQAIRVVAAGEAMLAPSITRRL--LDKYATHLPSGDEPVPDTLHTLT 159

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            REVE L  ++ G ++ EIA  L +S  TV  ++  ++ K   + R  A  YA  + +V
Sbjct: 160 EREVEVLKLVARGLSNAEIAADLFVSETTVKTHVGHVLTKLGLRDRVQAAVYAYESGLV 218


>gi|261340314|ref|ZP_05968172.1| regulatory protein SdiA [Enterobacter cancerogenus ATCC 35316]
 gi|288317405|gb|EFC56343.1| regulatory protein SdiA [Enterobacter cancerogenus ATCC 35316]
          Length = 240

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/225 (18%), Positives = 73/225 (32%), Gaps = 13/225 (5%)

Query: 35  RMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSE 94
           R   L C       +   T+ +   +F L         +    V S +P   +       
Sbjct: 16  RFQELTCADEVYQELQQQTQALEFDYFSLCVRHPVPFTRPKISVHSSYPDRWMAQYKSEN 75

Query: 95  KDKYYNVLQR--PTELFCPVFHTLPENITPPAGMDNR----------YCSLTFDVARIRI 142
                 VL+     +   P    L  +     G                     +  + +
Sbjct: 76  YFAVDPVLKPENFIQGHLPWTDELFADAQELWGGAQDHGIRKGITQCLMLPNHALGFLSV 135

Query: 143 GLMLLFPKGRIILRDRLWEIGLLAAYQANMFK-SYDVHWGKDFELTGREVECLTWISEGK 201
               L           L    L+     ++ +  ++     + + + RE E L W +EGK
Sbjct: 136 SRTSLRENAIHHEEIELRLQMLVQMALTSLLRFEHETVMPPEMKFSKREREILKWTAEGK 195

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           TS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 196 TSAEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|218463347|ref|ZP_03503438.1| transcriptional regulator, LuxR family protein [Rhizobium etli Kim
           5]
          Length = 240

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 43/226 (19%), Positives = 86/226 (38%), Gaps = 18/226 (7%)

Query: 37  IPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI-VSSDWPFDLVRCMALSEK 95
                       M  LT+ +G + FL +        ++ +  + ++WP ++V        
Sbjct: 15  AGFKTHYEVFKYMKGLTQDLGMNAFLFMTLPTVDIVEIGATKIITNWPAEMVDYYDAHNL 74

Query: 96  DKYYNVLQRPTELFCPVFHTLPE--------------NITPPAGMDNRYCSLTFDVARIR 141
                V++R      P  + +                 +    GM+        D A  R
Sbjct: 75  MIDSPVIRRMMRSTSPFNYDVEAINTNRGGGKKSTVIELFNRYGMEKGAYFPVHDAAGGR 134

Query: 142 IGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYD-VHWGKDFELTGREVECLTWISEG 200
             + +   +   +    + ++  +A    +           K  E T  E++CL   + G
Sbjct: 135 GSMSISGSRNFSM--IEMAKLLFIATLIYDRLSQLTLNEKHKPIEFTRSELDCLRLTAGG 192

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +  +EIA +L ++ N VNN+I S+++K    TR+ A+  A+R NI+
Sbjct: 193 RKGNEIAKLLDLTENAVNNHIGSVIKKLGCTTRTQAVVSALRLNII 238


>gi|239940109|ref|ZP_04692046.1| putative two-component system response regulator [Streptomyces
           roseosporus NRRL 15998]
 gi|239986597|ref|ZP_04707261.1| putative two-component system response regulator [Streptomyces
           roseosporus NRRL 11379]
 gi|291443540|ref|ZP_06582930.1| two-component system response regulator [Streptomyces roseosporus
           NRRL 15998]
 gi|291346487|gb|EFE73391.1| two-component system response regulator [Streptomyces roseosporus
           NRRL 15998]
          Length = 223

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/230 (15%), Positives = 70/230 (30%), Gaps = 13/230 (5%)

Query: 17  EQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDS 76
             R   V   P        ++  +  ++            G      VR        +D 
Sbjct: 2   AIRVLLVDDQPLLRTGFRMILEAEGDLAVVGEAGD-----GLQAIDQVRALQPDVVLMDI 56

Query: 77  IVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFD 136
            +      +  R +    KD           L    F      +       + +      
Sbjct: 57  RMPRMDGVEATRQITGPGKDG------PAKVLVLTTFDLDEYVVEALRAGASGFLLKDAP 110

Query: 137 VARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTW 196
            A +   + ++     ++       +  L  Y  ++    +        LT REVE L  
Sbjct: 111 AAELVQAIRVVAAGEAMLAPSITRRL--LDKYADHLPSGEEPVPDALHTLTDREVEVLKL 168

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++ G ++ EIA  L +S  TV  ++  ++ K   + R  A  YA  + +V
Sbjct: 169 VARGLSNAEIAAELFVSETTVKTHVGHVLTKLGLRDRVQAAVYAYESGLV 218


>gi|307328232|ref|ZP_07607410.1| two component transcriptional regulator, LuxR family [Streptomyces
           violaceusniger Tu 4113]
 gi|306886066|gb|EFN17074.1| two component transcriptional regulator, LuxR family [Streptomyces
           violaceusniger Tu 4113]
          Length = 219

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/223 (16%), Positives = 77/223 (34%), Gaps = 11/223 (4%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D +     L   +     +  + E   G +   L      +   +D  +     
Sbjct: 6   RVLVCDDQVLVRTGLVTIIDAQRDLEVVGECGDGQTAVELAGRLRPEVVVMDVRMPVLDG 65

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
            +  R +A +              L    F+             + +       +++  G
Sbjct: 66  IEATRLLAGAGVPH------PVKVLVVTTFNLDEYVYEALRAGASGFLLKDAPPSQLLHG 119

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           +  +     ++  +   ++       A   +  +    +D  LT RE+E L  I+ G ++
Sbjct: 120 IRTVATGAALLDPEVTRQL---VGTYAARIRPAEGP-PRDIPLTPRELEVLRLIANGLSN 175

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            EIA  L IS+ TV  +++ I+ K   + R  A+ YA R  +V
Sbjct: 176 SEIAATLVISQETVKTFVSRILAKLGLRDRVQAVVYAYRQGLV 218


>gi|307331341|ref|ZP_07610462.1| two component transcriptional regulator, LuxR family [Streptomyces
           violaceusniger Tu 4113]
 gi|306883019|gb|EFN14084.1| two component transcriptional regulator, LuxR family [Streptomyces
           violaceusniger Tu 4113]
          Length = 249

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 32/241 (13%), Positives = 76/241 (31%), Gaps = 25/241 (10%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVR 65
           + + +++  +       +  +  + + +  +                    GA       
Sbjct: 31  EPIRVLVVDDHALFRRGLEIVLAQEEDIQVVGEAGD---------------GAEAVDKAA 75

Query: 66  WDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
             L     +D  +      +    +          V      +   +     +       
Sbjct: 76  DLLPDIVLMDVRMPKRGGIEACTAIKE--------VAPSAKIIMLTISDEEADLYDAIKA 127

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE 185
               Y         +   +  +      I      ++  L  +++ + ++ +        
Sbjct: 128 GATGYLLKEISTDEVSTAIRAVADGQSQISPSMAAKL--LTEFKSMIQRTDERRLVPAPR 185

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I
Sbjct: 186 LTDRELEVLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKI 245

Query: 246 V 246
           +
Sbjct: 246 L 246


>gi|229181658|ref|ZP_04308983.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           172560W]
 gi|228601854|gb|EEK59350.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           172560W]
          Length = 215

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 34/222 (15%), Positives = 71/222 (31%), Gaps = 12/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D    +  L   +S    +  + E   G    + V         +D  +      
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDLELVGEANNGKEALVKVGETTPDVILMDLYMPEMDGV 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +    +     +           +    F      +       + Y     +  ++   +
Sbjct: 65  EATAYIKKEYPN--------GKVIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
              +     +  D    +           +   +       LT RE E L  +++G ++ 
Sbjct: 117 RSAYKGNIQLHPDIANALLSQTLPVEEKEEEPSIQVD---VLTARENEVLQLLAKGMSNK 173

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E+A +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 174 EVASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGIV 215


>gi|317122051|ref|YP_004102054.1| LuxR family transcriptional regulator [Thermaerobacter marianensis
           DSM 12885]
 gi|315592031|gb|ADU51327.1| two component transcriptional regulator, LuxR family
           [Thermaerobacter marianensis DSM 12885]
          Length = 218

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/230 (16%), Positives = 69/230 (30%), Gaps = 15/230 (6%)

Query: 17  EQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDS 76
             R           + L +++ L+  +             GA               +D 
Sbjct: 2   PIRVLIADDHALLREGLRQVLHLEPDIEVVGEART-----GAEAVRQAARLRPDIVVMDI 56

Query: 77  IVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFD 136
            +      +  R +  +              L   +       +   A   + +     +
Sbjct: 57  NLPDMSGIEATREIRSASASTQ--------VLVLTIHDQEEYLLEAIAAGASGFVLKDVE 108

Query: 137 VARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTW 196
              +   + L       +       +  L   +   +        +   LT RE E L  
Sbjct: 109 PRTLVEAVRLCCRGEGYVHPTLSARVLNLGTRRRERWTPLGGGIPE--PLTRREFEVLQL 166

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++EG ++ EI   L IS  TV N+I SI RK     R+ A+ +A+R   V
Sbjct: 167 VAEGVSNREIGQRLFISEKTVKNHITSIFRKLGVADRTQAVIHAIREGWV 216


>gi|302533532|ref|ZP_07285874.1| two-component system response regulator [Streptomyces sp. C]
 gi|302442427|gb|EFL14243.1| two-component system response regulator [Streptomyces sp. C]
          Length = 223

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 31/239 (12%), Positives = 72/239 (30%), Gaps = 23/239 (9%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  +     +    +      L  +      +    ++ AL               
Sbjct: 3   IRVLLVDDQPLLRTGFRMILEAEGDLVVVGEAGDGLQALEQVRAL--------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +  R +   +++           L    F      +       
Sbjct: 48  QPDVVLMDIRMPRMDGVEATRQITGPDRNG------PAKVLVLTTFDLDEYVVEALRAGA 101

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +         +   + ++     ++       +  L  Y  ++             LT
Sbjct: 102 SGFLLKDAPANELVQAIRVVAAGEAMLAPSITRRL--LDKYAGHLPSGEQSLPDTLGTLT 159

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            REVE L  ++ G ++ EIA  L +S  TV  ++  ++ K   + R  A  YA  + +V
Sbjct: 160 EREVEVLKLVARGLSNAEIAADLFVSETTVKTHVGHVLTKLGLRDRVQAAVYAYESGLV 218


>gi|21283518|ref|NP_646606.1| hypothetical protein MW1789 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49484090|ref|YP_041314.1| response regulator [Staphylococcus aureus subsp. aureus MRSA252]
 gi|49486665|ref|YP_043886.1| putative response regulator [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57650637|ref|YP_186730.1| LuxR family DNA-binding response regulator [Staphylococcus aureus
           subsp. aureus COL]
 gi|87161726|ref|YP_494481.1| DNA-binding response regulator [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88195671|ref|YP_500477.1| DNA-binding response regulator [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|151221952|ref|YP_001332774.1| DNA-binding response regulator [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|161510065|ref|YP_001575724.1| response regulator [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221142169|ref|ZP_03566662.1| response regulator [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|253735272|ref|ZP_04869437.1| response regulator [Staphylococcus aureus subsp. aureus TCH130]
 gi|257425960|ref|ZP_05602384.1| response regulator [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257428625|ref|ZP_05605023.1| response regulator [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257431262|ref|ZP_05607639.1| DNA-binding response regulator [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257433942|ref|ZP_05610300.1| response regulator [Staphylococcus aureus subsp. aureus E1410]
 gi|257436858|ref|ZP_05612902.1| response regulator [Staphylococcus aureus subsp. aureus M876]
 gi|258452662|ref|ZP_05700661.1| DNA-binding response regulator [Staphylococcus aureus A5948]
 gi|262050140|ref|ZP_06022994.1| hypothetical protein SAD30_1104 [Staphylococcus aureus D30]
 gi|262052678|ref|ZP_06024870.1| hypothetical protein SA930_0814 [Staphylococcus aureus 930918-3]
 gi|282904423|ref|ZP_06312311.1| DNA-binding response regulator, LuxR family [Staphylococcus aureus
           subsp. aureus C160]
 gi|282906246|ref|ZP_06314101.1| two-component system NarL family response regulator [Staphylococcus
           aureus subsp. aureus Btn1260]
 gi|282909165|ref|ZP_06316983.1| response regulator [Staphylococcus aureus subsp. aureus WW2703/97]
 gi|282911471|ref|ZP_06319273.1| response regulator [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282914643|ref|ZP_06322429.1| DNA-binding response regulator, LuxR family [Staphylococcus aureus
           subsp. aureus M899]
 gi|282917116|ref|ZP_06324874.1| two-component system, NarL family, response regulator
           [Staphylococcus aureus subsp. aureus D139]
 gi|282919609|ref|ZP_06327344.1| two-component system, NarL family, response regulator
           [Staphylococcus aureus subsp. aureus C427]
 gi|282924179|ref|ZP_06331854.1| two-component system, NarL family, response regulator
           [Staphylococcus aureus A9765]
 gi|282924989|ref|ZP_06332655.1| two-component system, NarL family, response regulator
           [Staphylococcus aureus subsp. aureus C101]
 gi|283770932|ref|ZP_06343824.1| two-component system NarL family response regulator [Staphylococcus
           aureus subsp. aureus H19]
 gi|283958601|ref|ZP_06376052.1| DNA-binding response regulator, LuxR family [Staphylococcus aureus
           subsp. aureus A017934/97]
 gi|284024894|ref|ZP_06379292.1| DNA-binding response regulator [Staphylococcus aureus subsp. aureus
           132]
 gi|293503715|ref|ZP_06667562.1| two-component system, NarL family, response regulator
           [Staphylococcus aureus subsp. aureus 58-424]
 gi|293510736|ref|ZP_06669441.1| two-component system, NarL family, response regulator
           [Staphylococcus aureus subsp. aureus M809]
 gi|293537278|ref|ZP_06671958.1| DNA-binding response regulator, LuxR family [Staphylococcus aureus
           subsp. aureus M1015]
 gi|294850276|ref|ZP_06791011.1| two-component system [Staphylococcus aureus A9754]
 gi|295428426|ref|ZP_06821055.1| two-component system [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297207436|ref|ZP_06923873.1| DNA-binding response regulator [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|297590607|ref|ZP_06949245.1| DNA-binding response regulator [Staphylococcus aureus subsp. aureus
           MN8]
 gi|300911520|ref|ZP_07128965.1| DNA-binding response regulator [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|304380550|ref|ZP_07363225.1| DNA-binding response regulator [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|21204959|dbj|BAB95654.1| MW1789 [Staphylococcus aureus subsp. aureus MW2]
 gi|49242219|emb|CAG40926.1| putative response regulator [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49245108|emb|CAG43574.1| putative response regulator [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57284823|gb|AAW36917.1| DNA-binding response regulator, LuxR family [Staphylococcus aureus
           subsp. aureus COL]
 gi|87127700|gb|ABD22214.1| DNA-binding response regulator [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87203229|gb|ABD31039.1| DNA-binding response regulator, putative [Staphylococcus aureus
           subsp. aureus NCTC 8325]
 gi|150374752|dbj|BAF68012.1| DNA-binding response regulator [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|160368874|gb|ABX29845.1| response regulator [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253726679|gb|EES95408.1| response regulator [Staphylococcus aureus subsp. aureus TCH130]
 gi|257271654|gb|EEV03800.1| response regulator [Staphylococcus aureus subsp. aureus 55/2053]
 gi|257275466|gb|EEV06953.1| response regulator [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257278210|gb|EEV08858.1| DNA-binding response regulator [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257282035|gb|EEV12172.1| response regulator [Staphylococcus aureus subsp. aureus E1410]
 gi|257284209|gb|EEV14332.1| response regulator [Staphylococcus aureus subsp. aureus M876]
 gi|257859637|gb|EEV82486.1| DNA-binding response regulator [Staphylococcus aureus A5948]
 gi|259159427|gb|EEW44479.1| hypothetical protein SA930_0814 [Staphylococcus aureus 930918-3]
 gi|259161765|gb|EEW46353.1| hypothetical protein SAD30_1104 [Staphylococcus aureus D30]
 gi|282313355|gb|EFB43751.1| two-component system, NarL family, response regulator
           [Staphylococcus aureus subsp. aureus C101]
 gi|282317419|gb|EFB47793.1| two-component system, NarL family, response regulator
           [Staphylococcus aureus subsp. aureus C427]
 gi|282319603|gb|EFB49955.1| two-component system, NarL family, response regulator
           [Staphylococcus aureus subsp. aureus D139]
 gi|282321824|gb|EFB52149.1| DNA-binding response regulator, LuxR family [Staphylococcus aureus
           subsp. aureus M899]
 gi|282325166|gb|EFB55476.1| response regulator [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282327429|gb|EFB57724.1| response regulator [Staphylococcus aureus subsp. aureus WW2703/97]
 gi|282331538|gb|EFB61052.1| two-component system NarL family response regulator [Staphylococcus
           aureus subsp. aureus Btn1260]
 gi|282592974|gb|EFB97976.1| two-component system, NarL family, response regulator
           [Staphylococcus aureus A9765]
 gi|282596041|gb|EFC01005.1| DNA-binding response regulator, LuxR family [Staphylococcus aureus
           subsp. aureus C160]
 gi|283461079|gb|EFC08169.1| two-component system NarL family response regulator [Staphylococcus
           aureus subsp. aureus H19]
 gi|283790750|gb|EFC29567.1| DNA-binding response regulator, LuxR family [Staphylococcus aureus
           subsp. aureus A017934/97]
 gi|290920123|gb|EFD97191.1| DNA-binding response regulator, LuxR family [Staphylococcus aureus
           subsp. aureus M1015]
 gi|291095381|gb|EFE25646.1| two-component system, NarL family, response regulator
           [Staphylococcus aureus subsp. aureus 58-424]
 gi|291466627|gb|EFF09148.1| two-component system, NarL family, response regulator
           [Staphylococcus aureus subsp. aureus M809]
 gi|294822892|gb|EFG39326.1| two-component system [Staphylococcus aureus A9754]
 gi|295127826|gb|EFG57463.1| two-component system [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|296887899|gb|EFH26795.1| DNA-binding response regulator [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|297575493|gb|EFH94209.1| DNA-binding response regulator [Staphylococcus aureus subsp. aureus
           MN8]
 gi|300887152|gb|EFK82352.1| DNA-binding response regulator [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|302333513|gb|ADL23706.1| two-component response regulator receiver protein [Staphylococcus
           aureus subsp. aureus JKD6159]
 gi|302751657|gb|ADL65834.1| two-component response regulator receiver protein [Staphylococcus
           aureus subsp. aureus str. JKD6008]
 gi|304340879|gb|EFM06804.1| DNA-binding response regulator [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|312437687|gb|ADQ76758.1| DNA-binding response regulator [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|315195759|gb|EFU26146.1| response regulator [Staphylococcus aureus subsp. aureus CGS00]
 gi|315196803|gb|EFU27147.1| response regulator [Staphylococcus aureus subsp. aureus CGS01]
 gi|320141302|gb|EFW33147.1| response regulator receiver domain protein [Staphylococcus aureus
           subsp. aureus MRSA131]
 gi|320143570|gb|EFW35350.1| response regulator receiver domain protein [Staphylococcus aureus
           subsp. aureus MRSA177]
 gi|323438857|gb|EGA96594.1| two-component response regulator protein [Staphylococcus aureus
           O11]
 gi|323441701|gb|EGA99346.1| two-component response regulator protein [Staphylococcus aureus
           O46]
 gi|329314524|gb|AEB88937.1| DNA-binding response regulator [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329729501|gb|EGG65903.1| putative oxygen regulatory protein NreC [Staphylococcus aureus
           subsp. aureus 21189]
 gi|329732948|gb|EGG69292.1| putative oxygen regulatory protein NreC [Staphylococcus aureus
           subsp. aureus 21193]
          Length = 207

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/226 (15%), Positives = 77/226 (34%), Gaps = 21/226 (9%)

Query: 23  VSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFL--LVRWDLFQEQKLDSIVSS 80
           ++ +    D       L   +S    +  L ++     FL  L   +      LD ++  
Sbjct: 1   MNKVILVDDHYIVRQGLRFLLSTIENIEVLQDFADGETFLEYLKEHEHPDIVLLDLVMPG 60

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARI 140
               + +     +              L    +      I+      + Y     +  ++
Sbjct: 61  MNGIE-ITEYIKAHYPDI-------KVLVLTSYVDDEHVISAINKGADGYEMKDVEPQQL 112

Query: 141 RIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEG 200
              +  +    ++I                ++F++         +L+ RE+E L  + +G
Sbjct: 113 IETIRRVMNGEKMIHP-----------KAQDVFETVSQKPHYTNKLSKREIEVLREMVKG 161

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           KT+ EIA  L +S  T+  +++ I  K     R+ A  YA+ N ++
Sbjct: 162 KTNKEIAETLFVSEKTIKTHVSHIFSKLQVSDRTQAAIYAMENKLI 207


>gi|86739750|ref|YP_480150.1| two component LuxR family transcriptional regulator [Frankia sp.
           CcI3]
 gi|86566612|gb|ABD10421.1| two component transcriptional regulator, LuxR family [Frankia sp.
           CcI3]
          Length = 238

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 38/234 (16%), Positives = 72/234 (30%), Gaps = 11/234 (4%)

Query: 13  NREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQE 71
              D    S +  +    D    +  L   +     +  +     G     L        
Sbjct: 11  AEADSVEGSALIRVLVVDDHELFLQGLQTVLEIEEDISVVGRAGNGQEALTLASGTSPDI 70

Query: 72  QKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYC 131
             +D  +           +           + R   +   V     +           Y 
Sbjct: 71  VLMDVRMPGRDGIAAAGAIKR--------AVPRTRIVMLTVSDEESDLFEAIKAGAVGYL 122

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREV 191
             +     +   +  +     +I      ++  +  +      + D        LT RE+
Sbjct: 123 LKSIPPHEVADAVRAVHNGQSLISPSMASKL--MVEFATMARGTEDRPRAHAPHLTAREL 180

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           E L  ++EG+ + EIA  L IS NTV N++ +I+ K    +R  A+ YAVR  +
Sbjct: 181 EVLKLVAEGRANREIARKLFISENTVKNHVRNILDKLQLHSRMEAVMYAVRQGL 234


>gi|311031947|ref|ZP_07710037.1| two-component response regulator DegU [Bacillus sp. m3-13]
          Length = 239

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 32/259 (12%), Positives = 66/259 (25%), Gaps = 40/259 (15%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           +    IV+  + +     V  +         +   D        M               
Sbjct: 1   MDTTKIVIIDDHQLFREGVKRILDFETNFHVVAEGDDGEEALELMEK------------- 47

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                    +D  +      +  R +  +              +   +            
Sbjct: 48  --HDPDVIIMDINMPKVNGVEATRRLVEAN--------AEAKVIVLSIHDDENYVTHALQ 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFK---------- 174
                Y     D   +   + ++   G  +       +                      
Sbjct: 98  TGARGYLLKEMDADALVDAVKVVADGGSYLHPKVTHNLVREYRRLTENGVRSGVRGGNGG 157

Query: 175 -------SYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRK 227
                             LT RE E L  +++GK++  I   L IS  TV N++++I++K
Sbjct: 158 GSTATTYQQIEIRRPLHLLTRRECEVLQLLADGKSNKAIGEALFISEKTVKNHVSNILQK 217

Query: 228 TATKTRSGAIAYAVRNNIV 246
                R+ A+  A++N  V
Sbjct: 218 MNVNDRTQAVVVAIKNGWV 236


>gi|300117929|ref|ZP_07055696.1| DNA-binding response regulator [Bacillus cereus SJ1]
 gi|298724793|gb|EFI65468.1| DNA-binding response regulator [Bacillus cereus SJ1]
          Length = 215

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/222 (16%), Positives = 71/222 (31%), Gaps = 12/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D    +  L   +S    +  + E   G    + V         +D  +      
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDIELVGEASNGKEALVKVGETNPDVVLMDLYMPEMDGV 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +   C+                 +    F      +       + Y     +  ++   +
Sbjct: 65  EATACIKKE--------YADVKVIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
              +     +  D    +           +   +       LT RE E L  +++G ++ 
Sbjct: 117 RSAYKGNIQLHPDIANALLSQTLPVEEKEEEPSIQVD---VLTARENEVLQLLAKGMSNK 173

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 174 EIASVLVITEKTVKAHVSSILSKLHLSDRTQAALYAVKNGIV 215


>gi|318056754|ref|ZP_07975477.1| two-component system response regulator [Streptomyces sp. SA3_actG]
 gi|318078616|ref|ZP_07985948.1| two-component system response regulator [Streptomyces sp. SA3_actF]
 gi|333024919|ref|ZP_08452983.1| putative two-component system response regulator [Streptomyces sp.
           Tu6071]
 gi|332744771|gb|EGJ75212.1| putative two-component system response regulator [Streptomyces sp.
           Tu6071]
          Length = 250

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 38/235 (16%), Positives = 78/235 (33%), Gaps = 12/235 (5%)

Query: 14  REDEQRTSFVS-HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQE 71
            EDE R       +    D       L+  ++    +  + E   G+         L   
Sbjct: 23  DEDEPRPRAEPIRVLVVDDHALFRRGLEIVLATEEDIEVVGEAGDGSEAVEKATDLLPDI 82

Query: 72  QKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYC 131
             +D  +      +    +          V      +   +     +           Y 
Sbjct: 83  VLMDVRMPKRGGIEACTAIKE--------VAPSAKIIMLTISDEEADLYDAIKAGATGYL 134

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREV 191
                   +   +  +      I      ++  L+ +++ + ++ +        LT RE+
Sbjct: 135 LKEISTDEVATAIRAVADGQSQISPSMASKL--LSEFKSMIQRTDERRLVPAPRLTDREM 192

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I+
Sbjct: 193 EVLKLVATGMNNKDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKIL 247


>gi|302546669|ref|ZP_07299011.1| two-component system response regulator [Streptomyces hygroscopicus
           ATCC 53653]
 gi|307330767|ref|ZP_07609903.1| two component transcriptional regulator, LuxR family [Streptomyces
           violaceusniger Tu 4113]
 gi|302464287|gb|EFL27380.1| two-component system response regulator [Streptomyces
           himastatinicus ATCC 53653]
 gi|306883570|gb|EFN14620.1| two component transcriptional regulator, LuxR family [Streptomyces
           violaceusniger Tu 4113]
          Length = 223

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 33/239 (13%), Positives = 73/239 (30%), Gaps = 23/239 (9%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  +     +    +      LA +      +    ++ AL               
Sbjct: 3   IRVLLVDDQPLLRTGFRMILEAEQDLAVVGEAGDGLQALDQVRAL--------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +  R +    +D           L    F      +       
Sbjct: 48  QPDVVLMDIRMPRMDGVEATRQITGPGRDG------PAKVLVLTTFDLDEYVVEALRAGA 101

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +         +   + ++     ++       +  L  Y  ++    +        LT
Sbjct: 102 SGFLLKDAPATELVQAIRVVAAGEAMLAPSITRRL--LDKYAGHLPSGEEPVPDTLHTLT 159

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            REVE L  ++ G ++ EIA  L +S  TV  ++  ++ K   + R  A  YA  + +V
Sbjct: 160 EREVEVLKLVARGLSNAEIAADLFVSETTVKTHVGHVLTKLGLRDRVQAAVYAYESGLV 218


>gi|229118901|ref|ZP_04248248.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock1-3]
 gi|228664557|gb|EEL20052.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock1-3]
          Length = 215

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/221 (18%), Positives = 79/221 (35%), Gaps = 10/221 (4%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFD 85
           +    D    +  L   +S    +  + E       L+       E   D ++   +  +
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDLELVGEANNGKEALV----KVGETNPDVVLMDLYMPE 60

Query: 86  LVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLM 145
           +    A +     Y  ++    +    F      +       + Y     +  ++   + 
Sbjct: 61  MDGVEATACIKNEYPDVK---VIVLTSFSDQAHVLPALKAGASGYILKDVEPDQLVEAIR 117

Query: 146 LLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDE 205
             +     +  D    +      Q    + + VH      LT RE E L  +++G ++ E
Sbjct: 118 SAYKGNIQLHPDIASTLISQTLPQEERAEEHFVHVD---VLTARENEVLQLLAKGMSNKE 174

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           IA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 175 IASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGIV 215


>gi|182439643|ref|YP_001827362.1| putative two-component system response regulator [Streptomyces
           griseus subsp. griseus NBRC 13350]
 gi|326780308|ref|ZP_08239573.1| two component transcriptional regulator, LuxR family [Streptomyces
           cf. griseus XylebKG-1]
 gi|178468159|dbj|BAG22679.1| putative two-component system response regulator [Streptomyces
           griseus subsp. griseus NBRC 13350]
 gi|326660641|gb|EGE45487.1| two component transcriptional regulator, LuxR family [Streptomyces
           cf. griseus XylebKG-1]
          Length = 223

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/230 (16%), Positives = 70/230 (30%), Gaps = 13/230 (5%)

Query: 17  EQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDS 76
             R   V   P        ++  +  ++            G      VR        +D 
Sbjct: 2   AIRVLLVDDQPLLRTGFRMILEAEGDLAVVGEAGD-----GLQAIDQVRALQPDVVLMDI 56

Query: 77  IVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFD 136
            +      +  R +    KD           L    F      +       + +      
Sbjct: 57  RMPRMDGVEATRQITGPGKDG------PAKVLVLTTFDLDEYVVEALRAGASGFLLKDAP 110

Query: 137 VARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTW 196
            A +   + ++     ++       +  L  Y  ++    D        LT REVE L  
Sbjct: 111 AAELVQAIRVVAAGEAMLAPSITRRL--LDKYADHLPSGEDPVPDALHTLTDREVEVLKL 168

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++ G ++ EIA  L +S  TV  ++  ++ K   + R  A  YA  + +V
Sbjct: 169 VARGLSNAEIAADLFVSETTVKTHVGHVLTKLGLRDRVQAAVYAYESGLV 218


>gi|270341116|emb|CAQ15948.2| vR protein [Pseudomonas fuscovaginae]
          Length = 239

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 44/237 (18%), Positives = 74/237 (31%), Gaps = 25/237 (10%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           D    ++      +W   +      +G S  L       + Q   + + S++P D  R  
Sbjct: 5   DECVELLSAIDARTWFESLVFSARKLGYSKVLYALKPNKEAQNNAAEIMSNFPDDWRRRY 64

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTL----------PENITPPAGMDNRYCSLTFDVARI 140
                      +        P+                     AG+ +            
Sbjct: 65  DNENYSIIDPTVFHSFSSSLPIPWEDKLYKTQKEKEFAEEARWAGLSHGMTLPIHGPQGQ 124

Query: 141 RIGLMLLFPKGRIILRD-------RLWEIGLLAAYQ----ANMFKSYDVHWGKDFELTGR 189
              L L      +   +        L    LL  Y      N F+    +      LT R
Sbjct: 125 VGMLSLSC--DPMSEPEYQKTLKNSLGAATLLRDYAVTSSFNHFQQGSGYTAP--HLTPR 180

Query: 190 EVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E+E L W    KT+ EI  IL +S  TV  +  +I RK    +R  A+A A++ +++
Sbjct: 181 ELEILHWAWAEKTTWEIGKILSLSEPTVEFHFKNIRRKLKVTSRRLAVARAIQLDLI 237


>gi|15597095|ref|NP_250589.1| quorum-sensing control repressor [Pseudomonas aeruginosa PAO1]
 gi|116049852|ref|YP_791341.1| putative transcriptional regulator [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218892145|ref|YP_002441012.1| quorum-sensing control repressor [Pseudomonas aeruginosa LESB58]
 gi|254234991|ref|ZP_04928314.1| quorum-sensing control repressor [Pseudomonas aeruginosa C3719]
 gi|254240292|ref|ZP_04933614.1| quorum-sensing control repressor [Pseudomonas aeruginosa 2192]
 gi|6014709|gb|AAF01471.1|AF190630_1 PhzR [Pseudomonas aeruginosa PAO1]
 gi|9947891|gb|AAG05287.1|AE004616_1 quorum-sensing control repressor [Pseudomonas aeruginosa PAO1]
 gi|115585073|gb|ABJ11088.1| probable transcriptional regulator [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126166922|gb|EAZ52433.1| quorum-sensing control repressor [Pseudomonas aeruginosa C3719]
 gi|126193670|gb|EAZ57733.1| quorum-sensing control repressor [Pseudomonas aeruginosa 2192]
 gi|218772371|emb|CAW28153.1| quorum-sensing control repressor [Pseudomonas aeruginosa LESB58]
          Length = 237

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/233 (15%), Positives = 72/233 (30%), Gaps = 14/233 (6%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            R   L  +  +     +   +  +    G   F       F          S++P +  
Sbjct: 4   EREGYLEILSRITTEEEFFSLVLEICGNYGFEFFSFGARAPFPLTAPKYHFLSNYPGEWK 63

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFH--------TLPENITPPAGMDNRYCSLTFDVAR 139
                 +      +++     + P+                    G+ + +         
Sbjct: 64  SRYISEDYTSIDPIVRHGLLEYTPLIWNGEDFQENRFFWEEALHHGIRHGWSIPVRGKYG 123

Query: 140 IRIGLMLLFPKGRIILRDRLWE------IGLLAAYQANMFKSYDVHWGKDFELTGREVEC 193
           +   L L+     I   + L +      I  +         +  +    +  LT RE E 
Sbjct: 124 LISMLSLVRSSESIAATEILEKESFLLWITSMLQATFGDLLAPRIVPESNVRLTARETEM 183

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GKT  EI +IL I + TV  +I + MRK  +  ++ A   A    ++
Sbjct: 184 LKWTAVGKTYGEIGLILSIDQRTVKFHIVNAMRKLNSSNKAEATMKAYAIGLL 236


>gi|15924838|ref|NP_372372.1| two-component response regulator-like protein [Staphylococcus
           aureus subsp. aureus Mu50]
 gi|15927422|ref|NP_374955.1| hypothetical protein SA1666 [Staphylococcus aureus subsp. aureus
           N315]
 gi|148268320|ref|YP_001247263.1| two component LuxR family transcriptional regulator [Staphylococcus
           aureus subsp. aureus JH9]
 gi|150394382|ref|YP_001317057.1| response regulator receiver [Staphylococcus aureus subsp. aureus
           JH1]
 gi|156980164|ref|YP_001442423.1| two-component response regulator-like protein [Staphylococcus
           aureus subsp. aureus Mu3]
 gi|253315179|ref|ZP_04838392.1| two-component response regulator-like protein [Staphylococcus
           aureus subsp. aureus str. CF-Marseille]
 gi|255006636|ref|ZP_05145237.2| two-component response regulator-like protein [Staphylococcus
           aureus subsp. aureus Mu50-omega]
 gi|257793793|ref|ZP_05642772.1| two-component system transcriptional regulator [Staphylococcus
           aureus A9781]
 gi|258413730|ref|ZP_05682003.1| two-component system transcriptional regulator [Staphylococcus
           aureus A9763]
 gi|258420763|ref|ZP_05683702.1| two component transcriptional regulator [Staphylococcus aureus
           A9719]
 gi|258438424|ref|ZP_05689708.1| two component transcriptional regulator [Staphylococcus aureus
           A9299]
 gi|258443869|ref|ZP_05692208.1| two component transcriptional regulator [Staphylococcus aureus
           A8115]
 gi|258447324|ref|ZP_05695471.1| response regulator receiver [Staphylococcus aureus A6300]
 gi|258448193|ref|ZP_05696320.1| response regulator receiver [Staphylococcus aureus A6224]
 gi|258453374|ref|ZP_05701357.1| conserved hypothetical protein [Staphylococcus aureus A5937]
 gi|269203485|ref|YP_003282754.1| LuxR family DNA-binding response regulator [Staphylococcus aureus
           subsp. aureus ED98]
 gi|282895146|ref|ZP_06303365.1| two-component system, NarL family, response regulator
           [Staphylococcus aureus A8117]
 gi|282928586|ref|ZP_06336185.1| two-component system, NarL family, response regulator
           [Staphylococcus aureus A10102]
 gi|295406155|ref|ZP_06815963.1| hypothetical protein SMAG_01317 [Staphylococcus aureus A8819]
 gi|296276020|ref|ZP_06858527.1| LuxR family DNA-binding response regulator [Staphylococcus aureus
           subsp. aureus MR1]
 gi|297244922|ref|ZP_06928799.1| two-component system [Staphylococcus aureus A8796]
 gi|13701641|dbj|BAB42934.1| SA1666 [Staphylococcus aureus subsp. aureus N315]
 gi|14247620|dbj|BAB58010.1| two-component response regulator homolog [Staphylococcus aureus
           subsp. aureus Mu50]
 gi|147741389|gb|ABQ49687.1| two component transcriptional regulator, LuxR family
           [Staphylococcus aureus subsp. aureus JH9]
 gi|149946834|gb|ABR52770.1| response regulator receiver [Staphylococcus aureus subsp. aureus
           JH1]
 gi|156722299|dbj|BAF78716.1| two-component response regulator homolog [Staphylococcus aureus
           subsp. aureus Mu3]
 gi|257787765|gb|EEV26105.1| two-component system transcriptional regulator [Staphylococcus
           aureus A9781]
 gi|257839517|gb|EEV63988.1| two-component system transcriptional regulator [Staphylococcus
           aureus A9763]
 gi|257843367|gb|EEV67777.1| two component transcriptional regulator [Staphylococcus aureus
           A9719]
 gi|257848468|gb|EEV72459.1| two component transcriptional regulator [Staphylococcus aureus
           A9299]
 gi|257851275|gb|EEV75218.1| two component transcriptional regulator [Staphylococcus aureus
           A8115]
 gi|257853911|gb|EEV76867.1| response regulator receiver [Staphylococcus aureus A6300]
 gi|257858432|gb|EEV81308.1| response regulator receiver [Staphylococcus aureus A6224]
 gi|257864466|gb|EEV87211.1| conserved hypothetical protein [Staphylococcus aureus A5937]
 gi|262075775|gb|ACY11748.1| LuxR family DNA-binding response regulator [Staphylococcus aureus
           subsp. aureus ED98]
 gi|282589795|gb|EFB94880.1| two-component system, NarL family, response regulator
           [Staphylococcus aureus A10102]
 gi|282762490|gb|EFC02631.1| two-component system, NarL family, response regulator
           [Staphylococcus aureus A8117]
 gi|285817528|gb|ADC38015.1| Two-component response regulator-like protein [Staphylococcus
           aureus 04-02981]
 gi|294969152|gb|EFG45173.1| hypothetical protein SMAG_01317 [Staphylococcus aureus A8819]
 gi|297178002|gb|EFH37250.1| two-component system [Staphylococcus aureus A8796]
 gi|312830220|emb|CBX35062.1| response regulator [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315130508|gb|EFT86494.1| hypothetical protein CGSSa03_09695 [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|329727450|gb|EGG63906.1| putative oxygen regulatory protein NreC [Staphylococcus aureus
           subsp. aureus 21172]
          Length = 207

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/226 (15%), Positives = 80/226 (35%), Gaps = 21/226 (9%)

Query: 23  VSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFL--LVRWDLFQEQKLDSIVSS 80
           ++ +    D       L   +S    +  L ++     FL  L   +      LD ++  
Sbjct: 1   MNKVILVDDHYIVRQGLRFLLSTIENIEVLQDFADGETFLEYLKEHEHPDIVLLDLVMPG 60

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARI 140
               ++   +       +Y  ++         +      I+      + Y     +  ++
Sbjct: 61  MNGIEITEYIKA-----HYPEIKVL---VLTSYVDDEHVISAINKGADGYEMKDVEPQQL 112

Query: 141 RIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEG 200
              +  +    ++I                ++F++         +L+ RE+E L  + +G
Sbjct: 113 IETIRRVMNGEKMIHP-----------KAQDVFETVSQKPHYTNKLSKREIEVLREMVKG 161

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           KT+ EIA  L +S  T+  +++ I  K     R+ A  YA+ N ++
Sbjct: 162 KTNKEIAETLFVSEKTIKTHVSHIFSKLQVSDRTQAAIYAMENKLI 207


>gi|82751502|ref|YP_417243.1| two-component response regulator protein [Staphylococcus aureus
           RF122]
 gi|82657033|emb|CAI81470.1| probable two-component response regulator protein [Staphylococcus
           aureus RF122]
          Length = 207

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/226 (15%), Positives = 77/226 (34%), Gaps = 21/226 (9%)

Query: 23  VSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFL--LVRWDLFQEQKLDSIVSS 80
           ++ +    D       L   +S    +  L ++     FL  L   +      LD ++  
Sbjct: 1   MNKVILVDDHYIVRQGLRFLLSTIENIEVLQDFADGETFLEYLKEHEHPDIVLLDLVMPG 60

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARI 140
               + +     +              L    +      I+      + Y     +  ++
Sbjct: 61  MNGIE-ITVYIKAHYPDI-------KVLVLTSYVDDEHVISAINKGADGYEMKDVEPQQL 112

Query: 141 RIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEG 200
              +  +    ++I                ++F++         +L+ RE+E L  + +G
Sbjct: 113 IETIRRVMNGEKMIHP-----------KAQDVFETVSQKPHYTNKLSKREIEVLREMVKG 161

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           KT+ EIA  L +S  T+  +++ I  K     R+ A  YA+ N ++
Sbjct: 162 KTNKEIAETLFVSEKTIKTHVSHIFSKLQVSDRTQAAIYAMENKLI 207


>gi|47568528|ref|ZP_00239227.1| DNA-binding response regulator, LuxR family [Bacillus cereus G9241]
 gi|228988639|ref|ZP_04148725.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|47554770|gb|EAL13122.1| DNA-binding response regulator, LuxR family [Bacillus cereus G9241]
 gi|228771090|gb|EEM19570.1| Two component transcriptional regulator, LuxR [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
          Length = 215

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/222 (16%), Positives = 72/222 (32%), Gaps = 12/222 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D    +  L   +S    +  + E   G    + V         +D  +      
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDIELVGEASNGKEALVKVGETNPDVVLMDLYMPEMDGV 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +   C+            +    +    F      +       + Y     +  ++   +
Sbjct: 65  EATACIKKE--------YRDVKVIVLTSFSDQAHVLPALRAGASGYILKDVEPDQLVEAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
              +     +  D    +           +   +       LT RE E L  +++G ++ 
Sbjct: 117 RSAYKGNIQLHPDIANALLSQTLPVEEKEEEPFIQVD---VLTARENEVLQLLAKGMSNK 173

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 174 EIASVLVITEKTVKAHVSSILSKLHLSDRTQAALYAVKNGIV 215


>gi|329941415|ref|ZP_08290694.1| two-component system response regulator [Streptomyces
           griseoaurantiacus M045]
 gi|329299946|gb|EGG43845.1| two-component system response regulator [Streptomyces
           griseoaurantiacus M045]
          Length = 226

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/226 (19%), Positives = 79/226 (34%), Gaps = 11/226 (4%)

Query: 21  SFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVS 79
           S  + +    D     + L   +     M  + E   G +   L R        +D  + 
Sbjct: 9   SAPTRVLVCDDQALIRMGLVTIIDAQPDMEVVGECGDGRTGVDLARKLDPDVVVMDIRMP 68

Query: 80  SDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVAR 139
                +  R +A +       V      L    F+             + +        R
Sbjct: 69  VLDGLEATRLLAGAG------VAHPVKVLVVTTFNLDEYVYEALRAGASGFLLKDAPPDR 122

Query: 140 IRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISE 199
           +  G+  +     ++  D   ++       A   +  D     D  LT RE+E L  I++
Sbjct: 123 LLHGIRTVAMGAALLDPDVTRQL---VGRYATRIRPTDGAPE-DIPLTPRELEVLRLIAD 178

Query: 200 GKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           G ++ EIA  L IS+ TV  +++ I+ K   + R  A+ YA R+ +
Sbjct: 179 GLSNSEIAATLVISQETVKTFVSRILTKLNLRDRVQAVVYAFRHGL 224


>gi|229099838|ref|ZP_04230762.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock3-29]
 gi|228683584|gb|EEL37538.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock3-29]
          Length = 215

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/221 (17%), Positives = 80/221 (36%), Gaps = 10/221 (4%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFD 85
           +    D    +  L   +S    +  + E       L+       E   D ++   +  +
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDLELVGEANNGKEALV----KVGETNPDVVLMDLYMPE 60

Query: 86  LVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLM 145
           +    A +     Y  ++    +    F      +       + Y     +  ++   + 
Sbjct: 61  MDGVEATACIKNEYPDVK---VIVLTSFSDQAHVLPALKAGASGYILKDVEPDQLVEAIR 117

Query: 146 LLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDE 205
             +     +  D      L++       ++ +     D  LT RE E L  +++G ++ E
Sbjct: 118 SAYKGNIQLHPDIA--SALISQTLPQEERAEEHFVHVDV-LTARENEVLQLLAKGMSNKE 174

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           IA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 175 IASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGIV 215


>gi|21222167|ref|NP_627946.1| two component system response regulator [Streptomyces coelicolor
           A3(2)]
 gi|256786745|ref|ZP_05525176.1| two component system response regulator [Streptomyces lividans
           TK24]
 gi|289770639|ref|ZP_06530017.1| two component system response regulator [Streptomyces lividans
           TK24]
 gi|10432460|emb|CAC10294.1| putative two component system response regulator [Streptomyces
           coelicolor A3(2)]
 gi|289700838|gb|EFD68267.1| two component system response regulator [Streptomyces lividans
           TK24]
          Length = 224

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/224 (15%), Positives = 75/224 (33%), Gaps = 7/224 (3%)

Query: 24  SHLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDW 82
           + +    D           ++    +  + E   GA    L R        +D  +    
Sbjct: 3   TRVIIVDDQAMVRAGFAALLAAQSDIDVVGEAPDGAQGVELSRRTHPDVVLMDVRMPEMD 62

Query: 83  PFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRI 142
             +  R +          V  RP  L    F              + +       A +  
Sbjct: 63  GLEAARRL----LSPPPGVTHRPRVLMLTTFDVDDYVYEALRAGASGFLLKDAPPADLIA 118

Query: 143 GLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKT 202
            + ++     ++       +  +A +      S      +   LT RE E LT ++ G++
Sbjct: 119 AVRVVASGDALLAPSVTRRL--IADFAQQRPASRGKPALRLKGLTERETEVLTLVARGQS 176

Query: 203 SDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + EIA  L ++  TV  +++ ++ K   + R+ A+ +A  + +V
Sbjct: 177 NTEIARTLVLAEQTVKTHVSRVLTKLDLRDRAQAVVFAYESGLV 220


>gi|257056663|ref|YP_003134495.1| response regulator containing a CheY-like receiver
           domain-containing protein and an HTH DNA-binding
           domain-containing protein [Saccharomonospora viridis DSM
           43017]
 gi|256586535|gb|ACU97668.1| response regulator containing a CheY-like receiver domain protein
           and an HTH DNA-binding domain protein [Saccharomonospora
           viridis DSM 43017]
          Length = 239

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 30/240 (12%), Positives = 71/240 (29%), Gaps = 25/240 (10%)

Query: 7   QVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRW 66
            + +VL  + +   +    + +  D +  +                              
Sbjct: 20  PLRVVLADDQDLVRAGFRVILSSDDGIEVVGEAGDGWEAVEVATR--------------- 64

Query: 67  DLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGM 126
                ++ D ++       L    A                +    F             
Sbjct: 65  -----ERADVVLMDVQMPKLDGLEATRRLLGPAGADHPTKVIILTTFDREDYLFEALRAG 119

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFEL 186
            + +         +   + ++     ++  +    +    +  A           +  EL
Sbjct: 120 ASGFLLKNASPEDLIESVRIVARGDALLSPEVTRRVIARFSAPA-----VTGPTRRPSEL 174

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T RE E L+ +++G ++ EIA  L +   TV  +++ I+ K   + R+ A+ +A  N IV
Sbjct: 175 TDREFEVLSLLAKGASNAEIARQLVLGETTVKTHVSRILTKLNLRDRTHAVVFAYENGIV 234


>gi|121533453|ref|ZP_01665281.1| two component transcriptional regulator, LuxR family [Thermosinus
           carboxydivorans Nor1]
 gi|121308012|gb|EAX48926.1| two component transcriptional regulator, LuxR family [Thermosinus
           carboxydivorans Nor1]
          Length = 225

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/243 (14%), Positives = 76/243 (31%), Gaps = 26/243 (10%)

Query: 7   QVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRW 66
            +NI++  +       + ++    +  A +           +   L              
Sbjct: 2   PINILVADDHALLRQGIKNVLALENDFAVIGEAGDGEETLRKAAELA------------- 48

Query: 67  DLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGM 126
                  LD  +      ++ + +  S              L   +       +      
Sbjct: 49  --PDVILLDINMPRLNGLEVTKRLRDSHPQI--------KVLILTIHDDDNYVVEVIKAG 98

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGK---D 183
              Y     + + +   +  ++     I       +      +    K           +
Sbjct: 99  AAGYLLKDVEPSMLVAAIRAVYEGESFIYPTLAKRLLDETIRRGEKKKQESAVQPARRGE 158

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             LT RE+E L  +++G ++ EIA  L +S  TV N++ +I RK     R+ A+ YA+R+
Sbjct: 159 ERLTYRELEVLQLVAQGLSNSEIAQKLYLSEKTVKNHLTNIFRKINVTDRTQALIYAIRH 218

Query: 244 NIV 246
            IV
Sbjct: 219 KIV 221


>gi|171315924|ref|ZP_02905153.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MEX-5]
 gi|171098927|gb|EDT43717.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MEX-5]
          Length = 228

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/225 (16%), Positives = 66/225 (29%), Gaps = 15/225 (6%)

Query: 36  MIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEK 95
           +            + A    +          D     +      + +P    +       
Sbjct: 4   LSRALSFDDVFEIVAAQARALDFEMCAYGARDPLPVTRPTFRTRNTYPDSWQQRYVEGNY 63

Query: 96  DKYYNVLQRPTELFCPVFH-------TLPENITPPAGMDNRYCSLTFDVARIRIGLMLLF 148
                V++       P+                   G+ + +     D    RI +  + 
Sbjct: 64  FARDPVVRYGLIYTSPLVWPVDACADAPFWEEAKAHGVAHGWSQPIRDKHG-RIAMWSVA 122

Query: 149 PKGRIILRDRLWE-------IGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGK 201
                I    L         +   A    +          +    T RE E L W ++GK
Sbjct: 123 RSADPISDLELAATEGRLIYLAHAAHAVNSRLADAPAAAMQMGPFTTREKEVLKWAADGK 182

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T+ EIA IL IS  T+  ++ +IM K  +  ++ AI  AV   I+
Sbjct: 183 TALEIASILSISERTITFHMQNIMEKLNSVNKTQAIVKAVLLGII 227


>gi|73662256|ref|YP_301037.1| two-component response regulator [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|72494771|dbj|BAE18092.1| two-component response regulator [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
          Length = 207

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/224 (17%), Positives = 77/224 (34%), Gaps = 17/224 (7%)

Query: 23  VSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDW 82
           +S +    D       L+  +S    +  +    G S        L      D ++    
Sbjct: 1   MSRIILVDDHHIVRQGLEFLLSTVEDLEVIG---GFSDGQTFLDYLENNTLPDIVLLDLV 57

Query: 83  PFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRI 142
             ++          K Y  ++         +      I+      + Y     +  ++  
Sbjct: 58  MPEMNGIEITEWMKKKYPNVKIL---VLTSYIDDEHVISAIDKGADGYEMKDVEPEQLIK 114

Query: 143 GLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKT 202
            +  +    +II           A +          +  K   L+ RE E LT +++GKT
Sbjct: 115 TIKHVLAGEKIIHPQ--------AQHVIETVSKKPHYANK---LSKRESEVLTEMAKGKT 163

Query: 203 SDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + EIA  L +S  T+  +++ I  K     R+ A  YA++NN++
Sbjct: 164 NKEIAETLFVSEKTIKTHVSHIFSKLQVTDRTQAAIYAMQNNLI 207


>gi|302561540|ref|ZP_07313882.1| two-component system response regulator [Streptomyces griseoflavus
           Tu4000]
 gi|302479158|gb|EFL42251.1| two-component system response regulator [Streptomyces griseoflavus
           Tu4000]
          Length = 223

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 75/239 (31%), Gaps = 23/239 (9%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  +     +    +      LA +      +    ++ AL               
Sbjct: 3   IRVLLVDDQPLLRTGFRMILEAEQDLAVVGEAGDGLQALDQVRAL--------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
              E  +D  +      +  R +   E+D           L    F      +       
Sbjct: 48  QPDEVLMDIRMPRMAGVEATRQITGPERDG------PAKVLVLTTFDLDEYVVEALRAGA 101

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +         +   + ++     ++       +  L  Y  ++    +        LT
Sbjct: 102 SGFLLKDAPANELVQAIRVVAAGEAMLAPSITRRL--LDKYATHLPSGDEPVPDTLHTLT 159

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            REVE L  ++ G ++ EIA  L +S  TV  ++  ++ K   + R  A  YA  + +V
Sbjct: 160 EREVEVLKLVARGLSNAEIAADLFVSETTVKTHVGHVLTKLGLRDRVQAAVYAYESGLV 218


>gi|205352355|ref|YP_002226156.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|205272136|emb|CAR36989.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|326627405|gb|EGE33748.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
          Length = 240

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 72/231 (31%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   +         +   T+ +   ++ L         +    + + +P   V 
Sbjct: 10  RRAMLLRFQEMAAAEDVYTELQYQTQRLEFDYYALCVRHPVPFTRPKISLRTTYPPAWVT 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLP--------ENITPPAGMDNRYCSLTFDVARI 140
                       VL+        +              +     G+            R 
Sbjct: 70  HYQSENYFAIDPVLKPENFRQGHLHWDDVLFHEEQAMWDAAQRFGLRRGVTQCVMLPNRA 129

Query: 141 RIGLMLLFPKGRIIL---RDRLWEIGLLAAYQANMFK--SYDVHWGKDFELTGREVECLT 195
              L       R       +    + LLA    +       D+    +   + RE E L 
Sbjct: 130 LGFLSFSRSSLRCSSFTYDEVELRLQLLARESLSALTRFEDDMVMAPEMRFSKREKEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|300741753|ref|ZP_07071774.1| two-component system response regulator [Rothia dentocariosa M567]
 gi|300380938|gb|EFJ77500.1| two-component system response regulator [Rothia dentocariosa M567]
          Length = 250

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 29/255 (11%), Positives = 74/255 (29%), Gaps = 31/255 (12%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVR 65
           +Q+ ++L  + +     +  L      L  ++  D   +       + E           
Sbjct: 12  EQITVMLVDDQQLVRGGLKMLINSQPDLQVVLEADDGAAAVDSYARMAEE---------- 61

Query: 66  WDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
               Q   +D  +      +  + +           +     +    F            
Sbjct: 62  GTAPQVVLMDVRMPIMDGLEAAKSILELN-------VPDSRVIMLTTFDVDEYVYAAVRA 114

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEI-----GLLAAYQANMFKSYDVHW 180
             + +         +   +  +     +I       +      +L  +      +     
Sbjct: 115 GASGFLLKDAPPEELLGAIRTIHRGDAVIAPSATRRLLEHMIPVLEVHSEQDSANIAPTS 174

Query: 181 GKDF---------ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATK 231
            ++           L+ RE E L  I++G ++ EI+  L +S  T+  +++ ++ K   +
Sbjct: 175 QEEPQLLHQELMQTLSPREHEVLRLIAQGLSNVEISRALVLSEATIKTHVSHVLAKLDAR 234

Query: 232 TRSGAIAYAVRNNIV 246
            R  A+  A    IV
Sbjct: 235 DRVQAVIMAYEAGIV 249


>gi|541659|dbj|BAA06490.1| LasR [Pseudomonas aeruginosa]
          Length = 239

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/233 (17%), Positives = 71/233 (30%), Gaps = 17/233 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           D    +      + W+  +  +   +G S  L        +   ++ +  ++P       
Sbjct: 5   DGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHY 64

Query: 91  ALSEKDKYYNVLQRPTELFCPVFH----------TLPENITPPAGMDNRYCSLTFDVARI 140
             +   +    +   T+   P+F                    AG+              
Sbjct: 65  DRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGE 124

Query: 141 RIGLMLL-----FPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWG--KDFELTGREVEC 193
              L L        +    +   L  + +L  Y               K   LT  E E 
Sbjct: 125 LGALSLSVEAENRAEANRFIESVLPTLWMLKDYALQSGAGLAFEHPVSKPVVLTSWEKEV 184

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GKTS EI+VI   S   VN ++ +I RK    +R  A   AV   ++
Sbjct: 185 LQWCAIGKTSWEISVICNCSEANVNFHMGNIRRKFGVTSRRVAAIMAVNLGLI 237


>gi|84624990|ref|YP_452362.1| two-component system regulatory protein [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|166711074|ref|ZP_02242281.1| two-component system regulatory protein [Xanthomonas oryzae pv.
           oryzicola BLS256]
 gi|188575549|ref|YP_001912478.1| two-component system regulatory protein [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|289665304|ref|ZP_06486885.1| two-component system regulatory protein [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|84368930|dbj|BAE70088.1| two-component system regulatory protein [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|188520001|gb|ACD57946.1| two-component system regulatory protein [Xanthomonas oryzae pv.
           oryzae PXO99A]
          Length = 213

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 30/239 (12%), Positives = 75/239 (31%), Gaps = 27/239 (11%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + + L  +       +  L    D +  +           ++  +               
Sbjct: 2   IRVCLVDDQTLVRQGIRSLLALDDGIEVVAEASDGKQAVEQIPQI--------------- 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      + ++ ++ +              +    F      +       
Sbjct: 47  QPDVVLMDMRMPVMSGLEALQMLSRNGTLP--------PTIILTTFDDDQLVLAGLKAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y      + ++   +  +   G ++       +     +  N F S      +   LT
Sbjct: 99  KGYLLKDVSLEQLVGAIRTVADGGSLVQPAVTQRLLSGLEHMRNEFVSL----DRPDPLT 154

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  ++ G ++ EIA  LG++  T+ N++++I+ K   + R+ A+  A    +V
Sbjct: 155 DRETEILRLMASGFSNKEIANSLGVAEGTIKNHVSNILSKLGVRDRTRAVLKAFELQLV 213


>gi|308172920|ref|YP_003919625.1| two-component response regulator [Bacillus amyloliquefaciens DSM 7]
 gi|307605784|emb|CBI42155.1| two-component response regulator [YhcY] [Bacillus amyloliquefaciens
           DSM 7]
          Length = 214

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 38/217 (17%), Positives = 69/217 (31%), Gaps = 16/217 (7%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
             D       L    +    +  + E   GA               +D  +      +  
Sbjct: 6   ADDHHVVRKGLRYFFATQEDIEVVGEASTGAEALQQAEKTGPDIILMDLSMPDMDGIEAA 65

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLL 147
             +A         V+          +      I         Y         +   L  +
Sbjct: 66  N-IAAERFPDISIVV-------LTSYSDREHVIPALKAGAKAYQLKDAQPDDLVKTLREV 117

Query: 148 FPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIA 207
           +     +  D       +  +  N     D +  K ++LT RE + L  I++GK++ EIA
Sbjct: 118 YSGRYRLSAD-------IVPHVLNHMVQDDQNKEKYYQLTPREKDVLQEIAKGKSNKEIA 170

Query: 208 VILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
             L IS  TV  ++++++ K     R+ A  YAV+ N
Sbjct: 171 ASLFISEKTVKTHVSNLLSKLNLSDRTQAALYAVKYN 207


>gi|315506070|ref|YP_004084957.1| two component transcriptional regulator, luxr family
           [Micromonospora sp. L5]
 gi|315412689|gb|ADU10806.1| two component transcriptional regulator, LuxR family
           [Micromonospora sp. L5]
          Length = 603

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 44/237 (18%), Positives = 79/237 (33%), Gaps = 14/237 (5%)

Query: 14  REDEQRTSFVSHLPTR---SDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLF 69
           R    R   V+         D           +     M A+ E   G +   L      
Sbjct: 376 RAHPHRERVVTAPIRVLVCDDQALIRTGFTTIIDAQPDMAAVGECGDGRAAVDLAGRLRP 435

Query: 70  QEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNR 129
               +D  +      +  R +A +       V      L    F+             + 
Sbjct: 436 DLVVMDVRMPVLDGIEATRLLAGAG------VAHPVKVLVVTTFNLDEYVYEALRAGASG 489

Query: 130 YCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGR 189
           +       A++  G+  +     ++  +   ++       A   +  +     D  LT R
Sbjct: 490 FLLKDAPPAQLLHGIRTVASGAALLAPEVTRQL---VGRYAARIRPAEG-TPADVGLTPR 545

Query: 190 EVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E+E L  I++G ++ EIA  L IS+ TV  Y++ I+ K   + R  A+ YA R  +V
Sbjct: 546 ELEVLRLIADGLSNSEIAARLVISQETVKTYVSRILTKLDLRDRVQAVVYAYRTGLV 602


>gi|116878316|gb|ABK32012.1| transcriptional regulator [Burkholderia vietnamiensis]
 gi|116878319|gb|ABK32014.1| transcriptional regulator [Burkholderia vietnamiensis]
          Length = 237

 Score =  136 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/225 (16%), Positives = 67/225 (29%), Gaps = 14/225 (6%)

Query: 36  MIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEK 95
                      +   A    +G  H            K   ++ S++P   V        
Sbjct: 12  FATAKSEADVFLEFSADVRALGFDHCSFGLRIPLPISKPQFMLQSNYPQTWVERYVSQNY 71

Query: 96  DKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVARIRIGLMLL 147
                 ++       P+                    G+ + +C  +         + ++
Sbjct: 72  FAVDPTVRHGLSRMSPLIWRADSQTQCVQFWEEADQHGLRHGWCMPSVSRTGAIGLITMV 131

Query: 148 FPKGRIILRDRLWE------IGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGK 201
                I  R+   +      +   A Y  +M     +      ELT RE E L W + GK
Sbjct: 132 RSGEPIEERELAEKGYQMSWLANTANYAMSMHLLQRLVPEYTVELTVREREALQWSAAGK 191

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T  EI  I+ +   TV  ++ + MRK     ++ A   A    ++
Sbjct: 192 TYAEIGKIMHVDDRTVKFHLVNAMRKLNAANKTEAAVKATMLGLL 236


>gi|16765288|ref|NP_460903.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|167993519|ref|ZP_02574613.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|2992525|gb|AAC08299.1| SdiA [Salmonella enterica subsp. enterica serovar Typhimurium]
 gi|16420484|gb|AAL20862.1| transcriptional regulator of ftsQAZ gene cluster [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|205328435|gb|EDZ15199.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|261247116|emb|CBG24939.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267993936|gb|ACY88821.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301158464|emb|CBW17974.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312912940|dbj|BAJ36914.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|321224593|gb|EFX49656.1| N-3-oxohexanoyl-L-homoserine lactone quorum-sensing transcriptional
           activator [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|323130228|gb|ADX17658.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|332988839|gb|AEF07822.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 240

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 72/231 (31%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   +         +   T+ +   ++ L         +    + + +P   V 
Sbjct: 10  RRAMLLRFQEMAAAEDVYTELQYQTQRLEFDYYALCVRHPVPFTRPKISLRTTYPPAWVT 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLP--------ENITPPAGMDNRYCSLTFDVARI 140
                       VL+        +              +     G+            R 
Sbjct: 70  HYQSENYFAIDPVLKPENFRQGHLHWDDVLFHEAKAMWDAAQRFGLRRGVTQCVMLPNRA 129

Query: 141 RIGLMLLFPKGRIIL---RDRLWEIGLLAAYQANMFK--SYDVHWGKDFELTGREVECLT 195
              L       R       +    + LLA    +       D+    +   + RE E L 
Sbjct: 130 LGFLSFSRSSLRCSSFTYDEVELRLQLLARESLSALTRFEDDMVMAPEMRFSKREKEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|17548999|ref|NP_522339.1| transcriptional activator of quorum sensing autoinducer synthesis
           transcription regulator protein [Ralstonia solanacearum
           GMI1000]
          Length = 248

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/221 (16%), Positives = 76/221 (34%), Gaps = 14/221 (6%)

Query: 40  DCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYY 99
             T      + A    +G  H            +   ++ +++P         +      
Sbjct: 27  ASTSDVFEHIEAAALALGFEHVAYGFKAPLPLSEPKVVLLNNYPQAWRARYLEAGYLHVD 86

Query: 100 NVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKG 151
             + +      P+  +           +     G+   +   + D   +   L L     
Sbjct: 87  PSVAQACRSQAPIVWSDRLFQDVPALWDEAKAHGLRVGWAQSSLDSLGVGGMLSLSRSCE 146

Query: 152 RIILRDRL---WEIGLLAAYQA---NMFKSYDVHWGKDFELTGREVECLTWISEGKTSDE 205
            +  R+       +  LA       +     DV    D  LT REVE + W ++GK++ +
Sbjct: 147 PLSARELAENTRRMQWLAHMAHVALSRLLRADVAGYSDDNLTNREVEVMKWTADGKSAQD 206

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           IA IL IS+NTV+ ++ + ++K     ++ A+  A     +
Sbjct: 207 IADILAISKNTVDFHVKNAVKKLHAVNKTAAVVRAAMLGYL 247


>gi|291442172|ref|ZP_06581562.1| two component system response regulator [Streptomyces ghanaensis
           ATCC 14672]
 gi|291345067|gb|EFE72023.1| two component system response regulator [Streptomyces ghanaensis
           ATCC 14672]
          Length = 224

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 34/224 (15%), Positives = 75/224 (33%), Gaps = 7/224 (3%)

Query: 24  SHLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDW 82
           + +    D           ++    +  + E   GA    L R        +D  +    
Sbjct: 3   TRVIIVDDQAMVRAGFAALLAAQSDIDVVGEAPDGAQGVELSRRTHPDVVLMDVWMPEMD 62

Query: 83  PFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRI 142
             +  R +     +    V  RP  L    F              + +       A +  
Sbjct: 63  GLEAARRL----LEPAPGVTHRPRVLMLTTFDVDDYVYEALRAGASGFLLKNAPPADLIA 118

Query: 143 GLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKT 202
            + ++     ++       +  +A +             +   LT RE E LT ++ G++
Sbjct: 119 AVRVVASGDALLAPSVTRRL--IADFAKQRPAVRGKPALRLKGLTERETEVLTLVARGQS 176

Query: 203 SDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + EIA  L ++  TV  +++ ++ K   + R+ A+ +A  + +V
Sbjct: 177 NGEIAQTLVLAEQTVKTHVSRVLTKLDLRDRAQAVVFAYESGLV 220


>gi|271964817|ref|YP_003339013.1| response regulator receiver protein [Streptosporangium roseum DSM
           43021]
 gi|270507992|gb|ACZ86270.1| response regulator receiver protein [Streptosporangium roseum DSM
           43021]
          Length = 227

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/222 (17%), Positives = 63/222 (28%), Gaps = 17/222 (7%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D       L   +        + E   G     LV         +D ++     
Sbjct: 20  RVLLVDDHPLLRHGLRALLEQVGGAEVVGEAGDGEEAIALVLSLNPDVVVMDLVMPGVTG 79

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
            +  R +     D           L   +                 Y     D       
Sbjct: 80  IEATRTLIDRRPD--------LGVLVLTMSEDDASVFAALRAGARGYVLKGADGNDFIAA 131

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           +  +     +        I          F +     G   ELT RE E L  ++ GK++
Sbjct: 132 VRAVARGEAVYGPAVARRI--------RRFLTTGPESGPFPELTQREREILDLLASGKSN 183

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
            EIA  L +S+ TV N++ SI  K     R+ A+  A R  +
Sbjct: 184 AEIARRLFLSQKTVKNHLTSIFAKLQVADRTQAVVRARRAGL 225


>gi|58583150|ref|YP_202166.1| two-component system regulatory protein [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|58427744|gb|AAW76781.1| two-component system regulatory protein [Xanthomonas oryzae pv.
           oryzae KACC10331]
          Length = 214

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 30/239 (12%), Positives = 75/239 (31%), Gaps = 27/239 (11%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + + L  +       +  L    D +  +           ++  +               
Sbjct: 3   IRVCLVDDQTLVRQGIRSLLALDDGIEVVAEASDGKQAVEQIPQI--------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      + ++ ++ +              +    F      +       
Sbjct: 48  QPDVVLMDMRMPVMSGLEALQMLSRNGTLP--------PTIILTTFDDDQLVLAGLKAGA 99

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y      + ++   +  +   G ++       +     +  N F S      +   LT
Sbjct: 100 KGYLLKDVSLEQLVGAIRTVADGGSLVQPAVTQRLLSGLEHMRNEFVSL----DRPDPLT 155

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  ++ G ++ EIA  LG++  T+ N++++I+ K   + R+ A+  A    +V
Sbjct: 156 DRETEILRLMASGFSNKEIANSLGVAEGTIKNHVSNILSKLGVRDRTRAVLKAFELQLV 214


>gi|311896318|dbj|BAJ28726.1| putative two-component system response regulator [Kitasatospora
           setae KM-6054]
          Length = 241

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/242 (14%), Positives = 71/242 (29%), Gaps = 24/242 (9%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
            + + +++  +       +  +      +  +                    GA   L  
Sbjct: 21  AEPIRVLVVDDHALFRRGLEIVLAEEQDIRVIGEAGD---------------GAEAVLKA 65

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
              L     +D  +      +    +          V+     +   +     +      
Sbjct: 66  ADLLPDIILMDVRMPRRSGIEACTAIKD--------VVPSAKIIMLTISDEEADLYEAIK 117

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
                Y         +   +  +      I      ++           +S D       
Sbjct: 118 AGATGYLLKEISTDEVATAIRAVADGQSQISPSMAAKLLTEFKSMIQR-RSDDRELLPAP 176

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            LT RE+E L  ++ G  + EIA  L IS NTV N++ +I+ K    +R  A+ YA+R  
Sbjct: 177 RLTDRELEVLKLVATGMNNREIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREK 236

Query: 245 IV 246
           I+
Sbjct: 237 IL 238


>gi|298244102|ref|ZP_06967908.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
 gi|297551583|gb|EFH85448.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
          Length = 216

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 34/240 (14%), Positives = 71/240 (29%), Gaps = 27/240 (11%)

Query: 7   QVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRW 66
           ++ I+L  +     + +  +      +  +               L              
Sbjct: 2   KIRILLADDHTILRAGLKMMLNAQPDMEVVGEAQDGKQAIQETQRL-------------- 47

Query: 67  DLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGM 126
                 + D ++      DL    A  +  K    ++        +              
Sbjct: 48  ------QPDIVLMDITMPDLNGIEATKQIKKIAPDVKIL---VLTMHEHDEYVFQALRAG 98

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFEL 186
            + Y         +   L ++      +      +  ++  Y                 L
Sbjct: 99  ASGYMLKEAADTELITALHVILSGQFYLSPAA--QSVMVGDYLQR--SKTGEEKDSYSSL 154

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T RE E L  ++EG T+++IA  L IS  TV+ +   IM K    +R+  + YA+R  ++
Sbjct: 155 TEREREILKLVAEGFTNNQIAERLVISPKTVDTHRTHIMDKLNLHSRAELVKYAMRRGLL 214


>gi|298695117|gb|ADI98339.1| probable response regulator protein [Staphylococcus aureus subsp.
           aureus ED133]
          Length = 207

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 35/226 (15%), Positives = 77/226 (34%), Gaps = 21/226 (9%)

Query: 23  VSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFL--LVRWDLFQEQKLDSIVSS 80
           ++ +    D       L   +S    +  L ++     FL  L   +      LD ++  
Sbjct: 1   MNKVILVDDHHIVRQGLRFLLSTIENIEVLQDFADGETFLEYLKEHEHPDIVLLDLVMPG 60

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARI 140
               + +     +              L    +      I+      + Y     +  ++
Sbjct: 61  MNGIE-ITEYIKAHYPDI-------KVLVLTSYVDDEHVISAINKGADGYEMKDVEPQQL 112

Query: 141 RIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEG 200
              +  +    ++I                ++F++         +L+ RE+E L  + +G
Sbjct: 113 IETIRRVMNGEKMIHP-----------KAQDVFETVSQKPHYTNKLSKREIEVLREMVKG 161

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           KT+ EIA  L +S  T+  +++ I  K     R+ A  YA+ N ++
Sbjct: 162 KTNKEIAETLFVSEKTIKTHVSHIFSKLQVSDRTQAAIYAMENKLI 207


>gi|147677779|ref|YP_001211994.1| response regulator [Pelotomaculum thermopropionicum SI]
 gi|146273876|dbj|BAF59625.1| response regulator [Pelotomaculum thermopropionicum SI]
          Length = 217

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 31/242 (12%), Positives = 75/242 (30%), Gaps = 27/242 (11%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           ++++ +++  +       +  + +    +  +   +                G     L 
Sbjct: 1   MKKIRVLIADDHALVREGLCKILSMEKSIEVVGEAEN---------------GEQAIKLA 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
              +     +D  +      +  R +           L     +   +            
Sbjct: 46  LKIIPDIILMDINMPKTKGIEATRIIKSR--------LPEVGIIALTIHDQEEYLFELIK 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
              + Y         +   ++ +      I      ++      +     +    +    
Sbjct: 98  AGISGYVLKDISPDLLIQTILGVTRGESFIPPSMTAKV----FAEFTRLSTISSRYSHPL 153

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            LT REV+ L  +++G ++  IA  L IS  TV N++ SI +K     R+ A  +AV+N 
Sbjct: 154 GLTRREVDVLRLVAQGDSNRSIAQKLFISEKTVKNHLTSIFQKLGVDDRTQAALHAVKNK 213

Query: 245 IV 246
           I+
Sbjct: 214 II 215


>gi|294627058|ref|ZP_06705648.1| two-component system regulatory protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292598720|gb|EFF42867.1| two-component system regulatory protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 213

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 31/239 (12%), Positives = 76/239 (31%), Gaps = 27/239 (11%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + + L  +       +  L    D +  +           ++  +               
Sbjct: 2   IRVCLVDDQTLVRQGIRSLLALDDGIEVVAEASDGKQAVEQIPQI--------------- 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      + ++ ++ +           P  +    F      +       
Sbjct: 47  QPDVVLMDMRMPVMSGLEALQMLSRNG--------ALPPTIILTTFDDDQLVLAGLKAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y      + ++   +  +   G ++       +     +  N F S      +   LT
Sbjct: 99  KGYLLKDVSLEQLVGAIRTVADGGSLVQPAVTQRLLSGLEHMRNEFVSL----DRPDPLT 154

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  ++ G ++ EIA  LG++  T+ N++++I+ K   + R+ A+  A    +V
Sbjct: 155 DRETEILRLMASGFSNKEIANSLGVAEGTIKNHVSNILSKLGVRDRTRAVLKAFELQLV 213


>gi|240145753|ref|ZP_04744354.1| nitrate/nitrite response regulator protein NarL [Roseburia
           intestinalis L1-82]
 gi|257202169|gb|EEV00454.1| nitrate/nitrite response regulator protein NarL [Roseburia
           intestinalis L1-82]
 gi|291536999|emb|CBL10111.1| Response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Roseburia intestinalis M50/1]
          Length = 213

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/239 (16%), Positives = 81/239 (33%), Gaps = 30/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           V +++  +       +  L         +      V    ++  +               
Sbjct: 3   VKVMIADDHSMIREGLKQLLELEGDFEVIAEACDGVDCLEKLKTVV-------------- 48

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 LD  + +    ++++ M   +      VL         V + +   +       
Sbjct: 49  -PDILLLDINMPNMNGLEVLQKMKDMKMKVKVLVL--------TVHNEVEYLLKAVDIGV 99

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           N Y     + A ++  ++ +      I    +  +        +     D    K   LT
Sbjct: 100 NGYLLKDSESAELKKAILAVVNGEDYIQPSLIPVL-------NSKMLDRDSDSSKIESLT 152

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE+E L  +S G  + EIA  L IS  TV N++++I +K     R+ A  +A+RNN++
Sbjct: 153 RRELEVLKMLSYGTYNKEIAEHLNISERTVKNHVSNIFKKIGVTDRTQAAVFAIRNNLI 211


>gi|145594985|ref|YP_001159282.1| response regulator receiver [Salinispora tropica CNB-440]
 gi|145304322|gb|ABP54904.1| response regulator receiver [Salinispora tropica CNB-440]
          Length = 220

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/223 (17%), Positives = 76/223 (34%), Gaps = 11/223 (4%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D           +     +  + E   G +   L          +D  +     
Sbjct: 6   RVLVCDDQALIRTGFATIIDAQPDLEVVGECGDGRTAVELAGRVHPDVVVMDVRMPVLDG 65

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
               R +A +       V      L    F+             + +       A++  G
Sbjct: 66  IGASRLLAGAG------VANPVKVLVVTTFNLDEYVYEALRAGASGFLLKDAPPAQLLHG 119

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           +  +     ++  +   ++       A   +  +   G D  LT RE+E L  I++G ++
Sbjct: 120 IRTVATGAALLAPEVTRQL---VGRYAARIRPAEGSSG-DIPLTPRELEVLRLIADGLSN 175

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            EIA  L IS+ TV  Y++ I+ K   + R  A+ YA R+ +V
Sbjct: 176 SEIAATLVISQETVKTYVSRILTKLDLRDRVQAVVYAYRSGLV 218


>gi|307302498|ref|ZP_07582255.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
 gi|307316172|ref|ZP_07595616.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|86278997|gb|ABC88593.1| N-acyl homoserine lactone receptor [Sinorhizobium meliloti]
 gi|306898012|gb|EFN28754.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306903168|gb|EFN33758.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
          Length = 246

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/238 (15%), Positives = 73/238 (30%), Gaps = 24/238 (10%)

Query: 32  LLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMA 91
            LA +  +            L +  G   + +VR     E  L  +++  WP    +   
Sbjct: 9   FLALLEEMKTREEILPEFERLLDRCGFDFYGIVRQPKPHENPLRLLLAGRWPEGWPQIYI 68

Query: 92  LSEKDKYYNVLQRPTELFCPVFHTL----------------PENITPPAGMDNRYCSLTF 135
             +       ++                                     G+ + Y     
Sbjct: 69  RKKYVVIDPTIRFLGHAQRGFRWRDTLVAFRSDPHRKRMESMMVEARNHGLFDGYIFPVH 128

Query: 136 DVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVH-------WGKDFELTG 188
               +   L  +  +   +    L     +A                       + ++T 
Sbjct: 129 GRRGLMGNL-TVGGRVVDLSPVELSLFDAIAKRLFWKLLELTDPEIMAELVSRVEVQMTR 187

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE+E L ++++G TS++I  +L IS +TV+ Y+  I  K   K R   +A A R  ++
Sbjct: 188 REMEALHYLADGMTSNDIGKVLDISSHTVDWYMNGIQEKLKAKNRHHVVAIAFRLGLI 245


>gi|302560338|ref|ZP_07312680.1| nitrate/nitrite response regulator [Streptomyces griseoflavus
           Tu4000]
 gi|302477956|gb|EFL41049.1| nitrate/nitrite response regulator [Streptomyces griseoflavus
           Tu4000]
          Length = 267

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 32/241 (13%), Positives = 75/241 (31%), Gaps = 25/241 (10%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVR 65
           + + +++  +       +  +    + +  +                    GA       
Sbjct: 49  EPIRVLVVDDHALFRRGLEIVLAAEEDIQVVGEAGD---------------GAEAVEKAA 93

Query: 66  WDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
             L     +D  +      +    +          V      +   +     +       
Sbjct: 94  DLLPDIVLMDVRMPKRGGIEACTSIKE--------VAPSAKIIMLTISDEEADLYDAIKA 145

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE 185
               Y         +   +  +      I      ++  L  +++ + ++ +        
Sbjct: 146 GATGYLLKEISTDEVATAIRAVADGQSQISPSMASKL--LTEFKSMIQRTDERRLVPAPR 203

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I
Sbjct: 204 LTDRELEVLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKI 263

Query: 246 V 246
           +
Sbjct: 264 L 264


>gi|294811706|ref|ZP_06770349.1| Two-component system response regulator [Streptomyces clavuligerus
           ATCC 27064]
 gi|294324305|gb|EFG05948.1| Two-component system response regulator [Streptomyces clavuligerus
           ATCC 27064]
          Length = 253

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 32/239 (13%), Positives = 73/239 (30%), Gaps = 23/239 (9%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  +     +    +      +A +      +    ++ AL               
Sbjct: 32  IRVLLVDDQPLLRTGFRMILEAEQDIAVVGEAGDGLQALDQVRAL--------------- 76

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +  R +    +D           L    F      +       
Sbjct: 77  QPDVVLMDIRMPRMDGVEATRQITGPGRDG------PAKVLVLTTFDLDEYVVEALRAGA 130

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +         +   + ++     ++       +  L  Y  ++    +        LT
Sbjct: 131 SGFLLKDAPAHELVQAIRVVAAGEAMLAPSITRRL--LDKYAGHLPSGEEPVPDTLNSLT 188

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            REVE L  ++ G ++ EIA  L +S  TV  ++  ++ K   + R  A  YA  + +V
Sbjct: 189 DREVEVLKLVARGLSNAEIAADLFVSETTVKTHVGHVLTKLGLRDRVQAAVYAYESGLV 247


>gi|228994130|ref|ZP_04154030.1| Two component transcriptional regulator, LuxR [Bacillus
           pseudomycoides DSM 12442]
 gi|228765582|gb|EEM14236.1| Two component transcriptional regulator, LuxR [Bacillus
           pseudomycoides DSM 12442]
          Length = 215

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 42/221 (19%), Positives = 81/221 (36%), Gaps = 10/221 (4%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFD 85
           +    D    +  L   +S    +  + E       L+      QE + D ++   +  +
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDLELVGEANNGKEALV----KVQEVQPDIVLMDLYMPE 60

Query: 86  LVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLM 145
           +    A +   K Y  ++         F      +       + Y     +  ++   + 
Sbjct: 61  MDGIEATACIKKEYPNVKVL---VLTSFSDQAHVLPALKAGASGYILKDVEPDQLVEAIR 117

Query: 146 LLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDE 205
             +     +  D      LL+       K    +   D  LT RE E L  +++G ++ E
Sbjct: 118 SAYKGNIQLHPDIA--SALLSQTLPQAEKQESSNIHVDV-LTARENEVLQLLAKGMSNKE 174

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           IA +L I+  TV  +++SI+ K     R+ A  YAV+N +V
Sbjct: 175 IASVLVITEKTVKAHVSSILGKLNLSDRTQAALYAVKNGVV 215


>gi|311032412|ref|ZP_07710502.1| two-component response regulator-like protein [Bacillus sp. m3-13]
          Length = 210

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 36/222 (16%), Positives = 69/222 (31%), Gaps = 16/222 (7%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D       L   +     +  + E   G     L          +D ++     
Sbjct: 3   RIVIADDHHVVRRGLLFFLKTQKDIEIVGEAKNGKEAVELAEALKPDVILMDLVMPEMDG 62

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
            +  + +                 L    F      I         Y     +  ++   
Sbjct: 63  IEATKQIVERNIP--------SKVLILTSFADQDHVIPAIRAGATGYQLKDVEPDQLIES 114

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           +  +      +            ++  + F           ELT RE+E L  I++GK++
Sbjct: 115 IRAVHRGESQLHPKVT-------SHVMSHFTKGFGSTNLHEELTKRELEVLAEIAKGKSN 167

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
            EIA  L I+  TV  ++++I+ K     R+ A  YAV++ I
Sbjct: 168 KEIASSLFITEKTVKTHVSNILAKLEVADRTQAALYAVKHGI 209


>gi|239978584|ref|ZP_04701108.1| two-component response regulator [Streptomyces albus J1074]
 gi|291450480|ref|ZP_06589870.1| two-component system response regulator [Streptomyces albus J1074]
 gi|291353429|gb|EFE80331.1| two-component system response regulator [Streptomyces albus J1074]
          Length = 225

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 36/230 (15%), Positives = 70/230 (30%), Gaps = 13/230 (5%)

Query: 17  EQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDS 76
             R   V   P        ++  +  V+            G      VR        +D 
Sbjct: 2   AIRVLLVDDQPLLRTGFRMILEAEQDVAVVGEAGD-----GLQALDQVRALQPDVVLMDI 56

Query: 77  IVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFD 136
            +      +  R +   E+D           L    F      +       + +      
Sbjct: 57  RMPRMDGVEATRQITGPERDG------PAKVLVLTTFDLDEYVVEALRAGASGFLLKDAP 110

Query: 137 VARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTW 196
              +   + ++     ++       +  L  Y  ++    +        LT REVE L  
Sbjct: 111 AHELVQAIRVVASGEAMLAPSVTRRL--LDKYAEHLPSGDEPVPDTLHTLTDREVEVLKL 168

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++ G ++ EIA  L +S  TV  ++  ++ K   + R  A  YA  + +V
Sbjct: 169 VARGLSNAEIAADLFVSETTVKTHVGHVLNKLGLRDRVQAAVYAYESGLV 218


>gi|283785661|ref|YP_003365526.1| regulatory protein [Citrobacter rodentium ICC168]
 gi|282949115|emb|CBG88722.1| regulatory protein [Citrobacter rodentium ICC168]
          Length = 240

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/231 (17%), Positives = 71/231 (30%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   +         +    + +   ++ L         +      + +P   V 
Sbjct: 10  RRSMLLRFQEMASAKDVYSELQRQAQLLEFDYYALYVRHPVPFTRPRISFQTSYPEAWVS 69

Query: 89  CMALSEKDKYYNVLQR--PTELFCPVFHTLP------ENITPPAGMDNRYCSLTFDVARI 140
                       VL+     +   P    L        +     G+            R 
Sbjct: 70  RYQAENYSAIDPVLKPENFIQGHLPWSDDLFNDAQTLWDAARAHGLRKGVTQCVMLPNRA 129

Query: 141 RIGLMLLFPK---GRIILRDRLWEIGLLAAYQANMFKSYDV--HWGKDFELTGREVECLT 195
              L ++        I   +    + LL           +       +   + RE E L 
Sbjct: 130 LGFLSVVRASLRSNPIDDDEVELRLQLLVRESLAALSRLEDEMVMAPEMRFSKREKEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSYEIAMILSISENTVNFHQKNMQKKFNAPNKTQVACYAAATGLI 240


>gi|256826588|ref|YP_003150547.1| response regulator containing a CheY-like receiver domain protein
           and an HTH DNA-binding domain protein [Cryptobacterium
           curtum DSM 15641]
 gi|256582731|gb|ACU93865.1| response regulator containing a CheY-like receiver domain protein
           and an HTH DNA-binding domain protein [Cryptobacterium
           curtum DSM 15641]
          Length = 261

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/228 (16%), Positives = 73/228 (32%), Gaps = 10/228 (4%)

Query: 20  TSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIV 78
           TS    +    D           +S    +  + E   G   +        Q   +D  +
Sbjct: 39  TSETVDVLIVDDQDLVRNGFKLILSSYDHVRVVGEASNGIEAYEQSLALRPQVVLMDIRM 98

Query: 79  SSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVA 138
             +      R +           L +   L    F              + +     +  
Sbjct: 99  PVEDGIAATRKIVG------DTALAQTRVLVLTTFDIDEYVYDALQAGASGFMLKDAEPD 152

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWIS 198
            I   +  +     +I       +  +  + ++  ++     G   +LT RE E L +++
Sbjct: 153 DIVRAVRTVAAGDALIQPSITRRL--IETFVSSRPRT-SAAAGGLVDLTDREREILRFVA 209

Query: 199 EGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            G +++EIA  L IS  TV  ++A IM K     R+  +  A  + +V
Sbjct: 210 RGMSNEEIADDLVISPATVKTHLARIMGKLDAHDRAQLVVAAYESGLV 257


>gi|52079413|ref|YP_078204.1| putative transcriptional regulator YhcZ [Bacillus licheniformis
           ATCC 14580]
 gi|52784773|ref|YP_090602.1| YhcZ [Bacillus licheniformis ATCC 14580]
 gi|52002624|gb|AAU22566.1| putative transcriptional regulator YhcZ [Bacillus licheniformis
           ATCC 14580]
 gi|52347275|gb|AAU39909.1| YhcZ [Bacillus licheniformis ATCC 14580]
          Length = 217

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 32/221 (14%), Positives = 73/221 (33%), Gaps = 17/221 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D       L            + E   G     ++R        +D  +      
Sbjct: 6   IIIADDHHIVRKGLLFFFKTKSDFDVIGEASTGIEALDVLRKREADIVLMDLSMPDMDGI 65

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +  + +        Y  ++    +    +      I         Y     +   +   +
Sbjct: 66  EATKRIKKE-----YPSVK---VIALTSYADESYVIPAIQAGACAYQLKDAEPDELVETI 117

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
             ++     +  +       + ++  +     D    K  +LT RE + L  I++GK++ 
Sbjct: 118 RAVYGGRYSLDPN-------IMSHVFHHVSQADEK-EKIHQLTNREKDVLLEITKGKSNK 169

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           EIA  L IS  TV  ++++++ K     R+ A  +AV++ +
Sbjct: 170 EIAASLFISEKTVKTHVSNLLSKLGLSDRTQAALFAVKHGL 210


>gi|21241983|ref|NP_641565.1| two-component system regulatory protein [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|21107378|gb|AAM36101.1| two-component system regulatory protein [Xanthomonas axonopodis pv.
           citri str. 306]
          Length = 214

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 31/239 (12%), Positives = 76/239 (31%), Gaps = 27/239 (11%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + + L  +       +  L    D +  +           ++  +               
Sbjct: 3   IRVCLVDDQTLVRQGIRSLLALDDGIEVVAEASDGKQAVEQIPQI--------------- 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      + ++ ++ +           P  +    F      +       
Sbjct: 48  QPDVVLMDMRMPVMSGLEALQMLSRNG--------ALPPTIILTTFDDDQLVLAGLKAGA 99

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y      + ++   +  +   G ++       +     +  N F S      +   LT
Sbjct: 100 KGYLLKDVSLEQLVGAIRTVADGGSLVQPAVTQRLLSGLEHMRNEFVSL----DRPDPLT 155

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  ++ G ++ EIA  LG++  T+ N++++I+ K   + R+ A+  A    +V
Sbjct: 156 DRETEILRLMASGFSNKEIANSLGVAEGTIKNHVSNILSKLGVRDRTRAVLKAFELQLV 214


>gi|161613489|ref|YP_001587454.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|168244797|ref|ZP_02669729.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168462512|ref|ZP_02696443.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168822990|ref|ZP_02834990.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194445102|ref|YP_002041215.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194448751|ref|YP_002046001.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|197250905|ref|YP_002146073.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|204931037|ref|ZP_03221863.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|207856536|ref|YP_002243187.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|238912477|ref|ZP_04656314.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
 gi|161362853|gb|ABX66621.1| hypothetical protein SPAB_01206 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403765|gb|ACF63987.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194407055|gb|ACF67274.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|195634505|gb|EDX52857.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197214608|gb|ACH52005.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|204320081|gb|EDZ05286.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205336361|gb|EDZ23125.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205340659|gb|EDZ27423.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|206708339|emb|CAR32642.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|320085432|emb|CBY95213.1| Regulatory protein sdiA [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 240

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 72/231 (31%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   +         +   T+ +   ++ L         +    + + +P   V 
Sbjct: 10  RRAMLLRFQEMAAAEDVYTELQYQTQRLEFDYYALCVRHPVPFTRPKISLRTTYPPAWVT 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLP--------ENITPPAGMDNRYCSLTFDVARI 140
                       VL+        +              +     G+            R 
Sbjct: 70  HYQSENYFAIDPVLKPENFRQGHLHWDDVLFHEAQAMWDAAQRFGLRRGVTQCVMLPNRA 129

Query: 141 RIGLMLLFPKGRIIL---RDRLWEIGLLAAYQANMFK--SYDVHWGKDFELTGREVECLT 195
              L       R       +    + LLA    +       D+    +   + RE E L 
Sbjct: 130 LGFLSFSRSSLRCSSFTYDEVELRLQLLARESLSALTRFEDDMVMAPEMRFSKREKEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|84498193|ref|ZP_00996990.1| putative two-component system response regulator [Janibacter sp.
           HTCC2649]
 gi|84381693|gb|EAP97576.1| putative two-component system response regulator [Janibacter sp.
           HTCC2649]
          Length = 202

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 36/209 (17%), Positives = 67/209 (32%), Gaps = 12/209 (5%)

Query: 39  LDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDK 97
           +   +     +  + E   G                LD  +  +   +    +       
Sbjct: 1   MQAVIGLEPDLEIVAEASSGGEAVEKCFEFDPDVVLLDVRMPGNSGIEACTAIKEKA--- 57

Query: 98  YYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRD 157
                 R   L         +         + Y        +I   + +      +I   
Sbjct: 58  -----PRTKILILTASDDESDLFAAIKAGASGYLLKDLPTEQIAESVRMAHTGQSMIPPH 112

Query: 158 RLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTV 217
              ++    +  +N          +   LT RE+E L  ++ GK + EIA  L IS NTV
Sbjct: 113 MASQLIAEFSRLSNEPPKEATAGPR---LTERELEVLGLVARGKANKEIATQLFISENTV 169

Query: 218 NNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            N++ +I+ K    +R  A  YA+R N++
Sbjct: 170 KNHVRNILEKLQLHSRVEAALYAMRRNLI 198


>gi|297194566|ref|ZP_06911964.1| two component system response regulator [Streptomyces
           pristinaespiralis ATCC 25486]
 gi|297152332|gb|EDY66387.2| two component system response regulator [Streptomyces
           pristinaespiralis ATCC 25486]
          Length = 227

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 35/223 (15%), Positives = 71/223 (31%), Gaps = 7/223 (3%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D           +S    +  + E   G     + R        +D  +     
Sbjct: 4   RVIIVDDQAMVRAGFAALLSAQSDIDVVGEAPDGRKGVEVSRTTHPDVVLMDVRMPEMDG 63

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
               R +     +    V+ RP  L    F              + +       A +   
Sbjct: 64  LAAAREL----LNPPTAVVHRPKVLMLTTFDVDDYVYEALRAGASGFLLKDAPPADLIAA 119

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           + ++     ++       +  +A + A           +   LT RE E L  I+ G ++
Sbjct: 120 VRIVAAGEALLAPSVTRRL--IADFAAQRPAPRRDPSLRLNGLTPRETEVLELIARGLSN 177

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            EIA  L ++  TV  +I  ++ K   + R+ A+ +A  + +V
Sbjct: 178 QEIAGHLVLAEQTVKTHIGRVLAKLDLRDRAQAVIFAYESGLV 220


>gi|182438321|ref|YP_001826040.1| putative two-component system response regulator [Streptomyces
           griseus subsp. griseus NBRC 13350]
 gi|326778972|ref|ZP_08238237.1| two component transcriptional regulator, LuxR family [Streptomyces
           cf. griseus XylebKG-1]
 gi|178466837|dbj|BAG21357.1| putative two-component system response regulator [Streptomyces
           griseus subsp. griseus NBRC 13350]
 gi|326659305|gb|EGE44151.1| two component transcriptional regulator, LuxR family [Streptomyces
           cf. griseus XylebKG-1]
          Length = 251

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 31/241 (12%), Positives = 76/241 (31%), Gaps = 25/241 (10%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVR 65
           + + +++  +       +  +  + + +  +                    G+       
Sbjct: 33  EPIRVLVVDDHALFRRGLEIVLAQEEDIQVIGEAGD---------------GSEAVDKAA 77

Query: 66  WDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
             L     +D  +      +    +          V      +   +     +       
Sbjct: 78  DLLPDIVLMDVRMPKRGGIEACTAIKE--------VAPSAKIIMLTISDEEADLYEAIKA 129

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE 185
               Y         +   +  +      I      ++  L  +++ + ++ +        
Sbjct: 130 GATGYLLKEISTDEVATAIRAVADGQSQISPSMASKL--LTEFKSMIQRTDERRLVPAPR 187

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I
Sbjct: 188 LTERELEVLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKI 247

Query: 246 V 246
           +
Sbjct: 248 L 248


>gi|269941319|emb|CBI49716.1| response regulator protein [Staphylococcus aureus subsp. aureus
           TW20]
          Length = 207

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/226 (16%), Positives = 75/226 (33%), Gaps = 21/226 (9%)

Query: 23  VSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFL--LVRWDLFQEQKLDSIVSS 80
           ++ +    D       L   +S    +  L ++     FL  L   +      LD ++  
Sbjct: 1   MNKVILVDDHYIVRQGLRFLLSTIENIEVLQDFADGETFLEYLKEHEHPDIVLLDLVMPG 60

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARI 140
               + +     +              L    +      I+      + Y     +  ++
Sbjct: 61  MNGIE-ITEYIKAHYPDI-------KVLVLTSYVDDEHVISAINKGADGYEMKDVEPQQL 112

Query: 141 RIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEG 200
              +  +    ++I         L A            +  K   L+ RE+E L  + +G
Sbjct: 113 IETIRRVMNGEKMI--------HLKAQDVFETVSQKPHYTNK---LSKREIEVLREMVKG 161

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           KT+ EIA  L +S  T+  +++ I  K     R+ A  YA+ N ++
Sbjct: 162 KTNKEIAETLFVSEKTIKTHVSHIFSKLQVSDRTQAAIYAMENKLI 207


>gi|115360781|ref|YP_777918.1| LuxR family transcriptional regulator [Burkholderia ambifaria AMMD]
 gi|172065092|ref|YP_001815804.1| LuxR family transcriptional regulator [Burkholderia ambifaria
           MC40-6]
 gi|115286109|gb|ABI91584.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           AMMD]
 gi|171997334|gb|ACB68251.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MC40-6]
          Length = 228

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/225 (16%), Positives = 66/225 (29%), Gaps = 15/225 (6%)

Query: 36  MIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEK 95
           +            + A    +          D     +      + +P    +       
Sbjct: 4   LSRALSFDDVFEIVAAQARALDFEMCAYGARDPLPVTRPTFRTRNTYPESWQQRYIEGNY 63

Query: 96  DKYYNVLQRPTELFCPVFH-------TLPENITPPAGMDNRYCSLTFDVARIRIGLMLLF 148
                V++       P+                   G+ + +     D    RI +  + 
Sbjct: 64  FARDPVVRYGLIYTSPLVWPVDACADESFWEEAKAHGVAHGWSQPIRDKHG-RIAMWSVA 122

Query: 149 PKGRIILRDRLWE-------IGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGK 201
                I    L         +   A    +          +    T RE E L W ++GK
Sbjct: 123 RSADPISDLELAATESRLIYLAHAAHAVNSRLVDAPAAAMQMGPFTTREKEVLKWAADGK 182

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T+ EIA IL IS  T+  ++ +IM K  +  ++ AI  AV   I+
Sbjct: 183 TALEIASILSISERTITFHMQNIMEKLNSVNKTQAIVKAVLLGII 227


>gi|300914706|ref|ZP_07132022.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter sp. X561]
 gi|307724060|ref|YP_003903811.1| LuxR family two component transcriptional regulator
           [Thermoanaerobacter sp. X513]
 gi|320115614|ref|YP_004185773.1| response regulator receiver [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|300889641|gb|EFK84787.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter sp. X561]
 gi|307581121|gb|ADN54520.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter sp. X513]
 gi|319928705|gb|ADV79390.1| response regulator receiver [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
          Length = 205

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 73/218 (33%), Gaps = 21/218 (9%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPFD 85
               D       L   +     +  +++   G   + L +  +     +D  +       
Sbjct: 2   LVADDHALIRKGLVQLIEMEKDIKVISQASNGEEAYKLAKKFMPDLILMDVNMPVMNGIK 61

Query: 86  LVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLM 145
             + +   +             LF  +++     +         Y     +   +   + 
Sbjct: 62  AAKMLKEEKHP--------SKVLFLTIYNDREYLLEALKLGVEGYILKDAEYDDLIKAIK 113

Query: 146 LLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDE 205
            ++  G  I    + EI  +                   +LT RE+E L  IS+G ++ E
Sbjct: 114 TIYNGGVYIHPSLMEEIDNIDQETLKK------------DLTPREIEILKLISKGYSNKE 161

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           IA  L +S  TV N++ +I +K   K R+ A  Y ++N
Sbjct: 162 IAQKLFLSEKTVKNHVYNIFKKLDVKDRTQAAIYMLKN 199


>gi|288934569|ref|YP_003438628.1| LuxR family transcriptional regulator [Klebsiella variicola At-22]
 gi|288889278|gb|ADC57596.1| transcriptional regulator, LuxR family [Klebsiella variicola At-22]
          Length = 240

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/231 (17%), Positives = 73/231 (31%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R D+L +   +         +   TE +   ++ L         +      S +P   + 
Sbjct: 10  RRDMLHQFQSVAAGEEVYNLLQRETEALEYDYYTLCVRHPVPFTRPRVTFQSTYPRAWMS 69

Query: 89  CMALSEKDKYYNVLQR--PTELFCPVFHTLPENITPPAGMDN------RYCSLTFDVARI 140
                       VL+         P    L  +                           
Sbjct: 70  HYQAENYFAIDPVLRPENFMRGHLPWEDGLFRDAAALWEGARDHGLKKGVTQCLTLPNHA 129

Query: 141 RIGLMLLFPK---GRIILRDRLWEIGLLAAYQANMFK--SYDVHWGKDFELTGREVECLT 195
           +  L +       G     +    + +L             ++    + + + RE+E L 
Sbjct: 130 QGFLSVSANNRLPGSYPDDELEMRLRMLTELSLLALLRLEDEMVMPPEMKFSRRELEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS E+A+IL IS NTVN +  ++ RK     ++    YAV   ++
Sbjct: 190 WTAEGKTSAEVAMILSISENTVNFHQKNMQRKFNAPNKTQIACYAVATGLI 240


>gi|170697389|ref|ZP_02888481.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           IOP40-10]
 gi|170137720|gb|EDT05956.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           IOP40-10]
          Length = 228

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/225 (16%), Positives = 66/225 (29%), Gaps = 15/225 (6%)

Query: 36  MIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEK 95
           +            + A    +          D     +      + +P    +       
Sbjct: 4   LSRALSFDDVFEIVAAQARALDFEMCAYGARDPLPVTRPTFRTRNTYPESWQQRYLEGNY 63

Query: 96  DKYYNVLQRPTELFCPVFH-------TLPENITPPAGMDNRYCSLTFDVARIRIGLMLLF 148
                V++       P+                   G+ + +     D    RI +  + 
Sbjct: 64  FARDPVVRYGLIYTSPLVWPVDACADEPFWEEAKAHGVAHGWSQPIRDKHG-RIAMWSVA 122

Query: 149 PKGRIILRDRLWE-------IGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGK 201
                I    L         +   A    +          +    T RE E L W ++GK
Sbjct: 123 RSADPISDLELAATESRLIYLAHAAHAVNSRLVDAPAAAMQMGPFTTREKEVLKWAADGK 182

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T+ EIA IL IS  T+  ++ +IM K  +  ++ AI  AV   I+
Sbjct: 183 TALEIASILSISERTITFHMQNIMEKLNSVNKTQAIVKAVLLGII 227


>gi|194468906|ref|ZP_03074890.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194455270|gb|EDX44109.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
          Length = 240

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 72/231 (31%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   +         +   T+ +   ++ L         +    + + +P   V 
Sbjct: 10  RRAMLLRFQEMAAAEDVYTELQYQTQRLEFDYYALCVRHPVPFTRPKISLRTTYPPAWVT 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLP--------ENITPPAGMDNRYCSLTFDVARI 140
                       VL+        +              +     G+            R 
Sbjct: 70  HYQSENYFAIDPVLKPENFRQGHLHWDDVLFHEAQAMWDAAQRFGLRRGVTQCVMLPNRA 129

Query: 141 RIGLMLLFPKGRIIL---RDRLWEIGLLAAYQANMF--KSYDVHWGKDFELTGREVECLT 195
              L       R       +    + LLA    +       D+    +   + RE E L 
Sbjct: 130 LGFLSFSRSSLRCSSFTYDEVELRLQLLARESLSALTRLEDDMVMAPEMRFSKREKEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|326334186|ref|ZP_08200409.1| nitrate/nitrite response regulator protein NarL [Nocardioidaceae
           bacterium Broad-1]
 gi|325947977|gb|EGD40094.1| nitrate/nitrite response regulator protein NarL [Nocardioidaceae
           bacterium Broad-1]
          Length = 212

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 35/236 (14%), Positives = 72/236 (30%), Gaps = 27/236 (11%)

Query: 11  VLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQ 70
           ++  + E     +  L      +  +      +  T R                      
Sbjct: 1   MVVDDQELFRRGLVALLASEPGIEVIGEATNGIEGTER---------------AAASAPD 45

Query: 71  EQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRY 130
              LD  +      +    +           +     +   V     +           Y
Sbjct: 46  VVLLDVRMPKQTGLEACSAIKE--------AVPSAKIIMLTVSDEEADLYDAIKAGAMGY 97

Query: 131 CSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGRE 190
                 + ++   + ++     +I      ++      +       D       +LT RE
Sbjct: 98  LLKDSSIDQVAQAIRVVADGQSLISPSMAAKL----MEEFKQMARPDRSPVPGPKLTDRE 153

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +E L  +++G  + EIA  L IS NTV N++ +I+ K    +R  A+ YAVR  ++
Sbjct: 154 LEVLGLVAKGLNNREIAKRLFISENTVKNHVRNILEKLQAHSRMEAVMYAVRQKLL 209


>gi|294629677|ref|ZP_06708237.1| nitrate/nitrite response regulator [Streptomyces sp. e14]
 gi|292833010|gb|EFF91359.1| nitrate/nitrite response regulator [Streptomyces sp. e14]
          Length = 267

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 37/234 (15%), Positives = 76/234 (32%), Gaps = 15/234 (6%)

Query: 13  NREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQ 72
           +R +  R   V         L  ++  +  +          E V  +  LL         
Sbjct: 46  SRAEPIRVLVVDDHALFRRGLEIVLAAEEDIQVVGEAGDGAEAVDKAADLL-----PDIV 100

Query: 73  KLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCS 132
            +D  +      +    +          V      +   +     +           Y  
Sbjct: 101 LMDVRMPKRGGIEACTSIKE--------VAPSAKIIMLTISDEEADLYDAIKAGATGYLL 152

Query: 133 LTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVE 192
                  +   +  +      I      ++  L  +++ + ++ +        LT RE+E
Sbjct: 153 KEISTDEVATAIRAVADGQSQISPSMASKL--LTEFKSMIQRTDERRLVPAPRLTDRELE 210

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I+
Sbjct: 211 VLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKIL 264


>gi|209548400|ref|YP_002280317.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534156|gb|ACI54091.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 240

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 43/226 (19%), Positives = 86/226 (38%), Gaps = 18/226 (7%)

Query: 37  IPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI-VSSDWPFDLVRCMALSEK 95
              +        M  LT+ +G + FL++        ++ +  + ++WP ++V        
Sbjct: 15  AGFNTHYEVFKYMKGLTQDLGMTAFLIMTLPTVDFAEIGATKIITNWPAEMVDYYDAHNL 74

Query: 96  DKYYNVLQRPTELFCPVFHTLPE--------------NITPPAGMDNRYCSLTFDVARIR 141
                V++R      P  + +                 +    GM+        D A  R
Sbjct: 75  MVDSPVIRRMLRSTSPFNYDVEAINTDRGEGKKSTVIELFNRYGMEKGAYFPVHDAAGGR 134

Query: 142 IGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYD-VHWGKDFELTGREVECLTWISEG 200
             + +   +   +    + ++  +A    +           K  E T  E++CL   + G
Sbjct: 135 GAMSISGSRNFSM--IEMAKLLFIATLIYDRLSQLTLNEKHKPIEFTRNELDCLRLTAGG 192

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +   EIA +L ++ N VNN+I S ++K    TR+ A+  A+R NI+
Sbjct: 193 RKGAEIAKLLDLTENAVNNHIGSAIKKLGCTTRTQAVVSALRLNIL 238


>gi|149182664|ref|ZP_01861132.1| two-component response regulator [Bacillus sp. SG-1]
 gi|148849633|gb|EDL63815.1| two-component response regulator [Bacillus sp. SG-1]
          Length = 216

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 36/242 (14%), Positives = 77/242 (31%), Gaps = 32/242 (13%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           + ++ +++  + E     +       + +  +                    G     L 
Sbjct: 1   MDKIKVMIVDDHEMVRLGMKTYLLTEERIEFLGEASS---------------GNEAVKLA 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
           +    Q   +D ++ +    +  + +           L     +    ++   +      
Sbjct: 46  KLYQPQIILMDLLMENGNGIEATQEILT--------FLPDCKIIILTSYYDDEKVFPAIE 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
              + Y   T     +   +        +I           A    N F+  +    +D 
Sbjct: 98  AGAHSYLLKTASADEVVSAVYKAVKGESVIAPKV-------ADKMMNRFRPQERKLHED- 149

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            LT RE+E L  + EG T+ EI+  L I   T   ++++I+ K     R+ A  YA RN 
Sbjct: 150 -LTTRELEVLKCLGEGMTNQEISDELFIGVKTTKTHVSNILSKLGVADRTQAAIYANRNG 208

Query: 245 IV 246
           I+
Sbjct: 209 IL 210


>gi|206576935|ref|YP_002237709.1| regulatory protein SdiA [Klebsiella pneumoniae 342]
 gi|290508769|ref|ZP_06548140.1| DNA-binding transcriptional activator SdiA [Klebsiella sp. 1_1_55]
 gi|206565993|gb|ACI07769.1| regulatory protein SdiA [Klebsiella pneumoniae 342]
 gi|289778163|gb|EFD86160.1| DNA-binding transcriptional activator SdiA [Klebsiella sp. 1_1_55]
          Length = 240

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/231 (17%), Positives = 73/231 (31%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R D+L +   +         +   TE +   ++ L         +      S +P   + 
Sbjct: 10  RRDMLHQFQSVAAGEEVYNLLQRETEALEYDYYTLCVRHPVPFTRPRVTFQSTYPRAWMS 69

Query: 89  CMALSEKDKYYNVLQR--PTELFCPVFHTLPENITPPAGMDN------RYCSLTFDVARI 140
                       VL+         P    L  +                           
Sbjct: 70  HYQAENYFAIDPVLRPENFMRGHLPWEDGLFRDAAALWDGARDHGLKKGVTQCLTLPNHA 129

Query: 141 RIGLMLLFPK---GRIILRDRLWEIGLLAAYQANMFK--SYDVHWGKDFELTGREVECLT 195
           +  L +       G     +    + +L             ++    + + + RE+E L 
Sbjct: 130 QGFLSVSANNRLPGSYPDDELEMRLRMLTELSLLALLRLEDEMVMPPEMKFSRRELEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS E+A+IL IS NTVN +  ++ RK     ++    YAV   ++
Sbjct: 190 WTAEGKTSAEVAMILSISENTVNFHQKNMQRKFNAPNKTQIACYAVATGLI 240


>gi|72162890|ref|YP_290547.1| LuxR response regulator receiver [Thermobifida fusca YX]
 gi|71916622|gb|AAZ56524.1| regulatory protein, LuxR:Response regulator receiver [Thermobifida
           fusca YX]
          Length = 242

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 35/242 (14%), Positives = 69/242 (28%), Gaps = 23/242 (9%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           ++ + +++  + E     +  +      +  +           R   L            
Sbjct: 9   VESIKVLVVDDHEFFRRGLVSVLAEEPDIEVVGEAGDGEEAVARAKEL------------ 56

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                    LD  +           +           +     +   +     +      
Sbjct: 57  ---RPDVVLLDVRMPKRSGIAACAGIKE--------AVPDAKIVMLTMSDEEEDLFEAIK 105

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
                Y      V  +   +  +      I      ++    A  A   K       K  
Sbjct: 106 AGATGYLLKEISVVELPEAVRAVCKGQSFINPSMATKLINEFAALARKGKDRRSQPTKPP 165

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            LT RE E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R+ A  YA+R  
Sbjct: 166 RLTERETEVLRLVARGLNNRDIADRLYISDNTVKNHVRNILEKLQLHSRTEAAVYAIREK 225

Query: 245 IV 246
            +
Sbjct: 226 FL 227


>gi|78046817|ref|YP_362992.1| two-component system regulatory protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|289669198|ref|ZP_06490273.1| two-component system regulatory protein [Xanthomonas campestris pv.
           musacearum NCPPB4381]
 gi|325927244|ref|ZP_08188501.1| response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Xanthomonas perforans 91-118]
 gi|78035247|emb|CAJ22892.1| two-component system regulatory protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325542364|gb|EGD13849.1| response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Xanthomonas perforans 91-118]
          Length = 213

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 30/239 (12%), Positives = 75/239 (31%), Gaps = 27/239 (11%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + + L  +       +  L    D +  +           ++  +               
Sbjct: 2   IRVCLVDDQTLVRQGIRSLLALDDGIEVVAEASDGKQAVEQIPQI--------------- 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      + ++ ++ +              +    F      +       
Sbjct: 47  QPDVVLMDMRMPVMSGLEALQMLSRNGTLP--------PTIILTTFDDDQLVLAGLKAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y      + ++   +  +   G ++       +     +  N F S      +   LT
Sbjct: 99  KGYLLKDVSLEQLVGAIRTVAEGGSLVQPAVTQRLLSGLEHMRNEFVSL----DRPDPLT 154

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  ++ G ++ EIA  LG++  T+ N++++I+ K   + R+ A+  A    +V
Sbjct: 155 DRETEILRLMASGFSNKEIANSLGVAEGTIKNHVSNILSKLGVRDRTRAVLKAFELQLV 213


>gi|320532198|ref|ZP_08033064.1| response regulator receiver domain protein [Actinomyces sp. oral
           taxon 171 str. F0337]
 gi|320135576|gb|EFW27658.1| response regulator receiver domain protein [Actinomyces sp. oral
           taxon 171 str. F0337]
          Length = 245

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 29/242 (11%), Positives = 67/242 (27%), Gaps = 25/242 (10%)

Query: 7   QVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRW 66
            +++VL  +          +    + +  +                    G S     + 
Sbjct: 26  PISVVLADDQALMRMGFRMVLEAEEDITVVGEASD---------------GTSALAQAKA 70

Query: 67  DLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGM 126
                  +D  +      +    +A                L    F             
Sbjct: 71  LHPDVILMDVRMPGMNGIEATELIARE--------CPSTRVLILTTFDLDEYAFAGLRAG 122

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRL-WEIGLLAAYQANMFKSYDVHWGKDFE 185
            + +         +   +  +     ++        + + AA   +             +
Sbjct: 123 ASGFLLKDTRPTELAEAIRTVASGEAVVSPRITQRMLEMFAASLPSSDAPAQPSSDPRID 182

Query: 186 -LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            LT RE E L  +S+G ++ EIA  L +S  TV  ++ +++ K   + R  A+  A    
Sbjct: 183 SLTPREKEILVLMSQGMSNAEIAAHLVVSATTVKTHVGNVLTKLDVRDRVQAVVVAYETG 242

Query: 245 IV 246
           ++
Sbjct: 243 LM 244


>gi|319646806|ref|ZP_08001035.1| YhcZ protein [Bacillus sp. BT1B_CT2]
 gi|317391394|gb|EFV72192.1| YhcZ protein [Bacillus sp. BT1B_CT2]
          Length = 216

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 32/221 (14%), Positives = 73/221 (33%), Gaps = 17/221 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D       L            + E   G     ++R        +D  +      
Sbjct: 6   IIIADDHHIVRKGLLFFFKTKSDFDVIGEASTGIEALDVLRKREADIVLMDLSMPDMDGI 65

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +  + +        Y  ++    +    +      I         Y     +   +   +
Sbjct: 66  EATKRIKKE-----YPSVK---VIALTSYADESYVIPAIQAGACAYQLKDAEPDELVETI 117

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
             ++     +  +       + ++  +     D    K  +LT RE + L  I++GK++ 
Sbjct: 118 RAVYGGRYSLDPN-------IMSHVFHHVSQADEK-EKIHQLTNREKDVLLEITKGKSNK 169

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           EIA  L IS  TV  ++++++ K     R+ A  +AV++ +
Sbjct: 170 EIAASLFISEKTVKTHVSNLLSKLGLSDRTQAALFAVKHGL 210


>gi|325293644|ref|YP_004279508.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
 gi|325061497|gb|ADY65188.1| transcriptional regulator, LuxR family [Agrobacterium sp. H13-3]
          Length = 238

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 43/225 (19%), Positives = 87/225 (38%), Gaps = 15/225 (6%)

Query: 36  MIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQ-KLDSIVSSDWPFDLVRCMALSE 94
           +        W   +  + +    S+  L++    +    L  +V S  P  +V  M    
Sbjct: 14  LSAAIDRPQWLAALQQVMQAFSYSYVTLLKLPSIRNAYALPIVVESSLPVWVVNAMTRDG 73

Query: 95  KDKYYNVLQRPTELFCPVFHTLPE------------NITPPAGMDNRYCSLTFDVARIRI 142
           +     V++R      P + +L +             +    G+ +        +   R 
Sbjct: 74  ELADCPVIKRGASSMMPQYWSLDDKDINCGSLLEVSTLLRGMGITSGLLVPVNGMDGNRH 133

Query: 143 GLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGK-DFELTGREVECLTWISEGK 201
            +        ++ +  L E+ ++A +    +        K    LT RE++ + W ++GK
Sbjct: 134 LMNFAG-DCDVLSQGSLNELCMIALHALEAYDRLCRAGSKLPSPLTKRELDVVRWTAQGK 192

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           TS EIA +L IS +TVN Y+ + +RK     R+  +A  +R  ++
Sbjct: 193 TSVEIAELLSISEHTVNTYMNNAIRKLDCVNRAQLVAKTIRLGLI 237


>gi|126347864|emb|CAJ89584.1| putative two component system response regulator [Streptomyces
           ambofaciens ATCC 23877]
          Length = 224

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 35/224 (15%), Positives = 76/224 (33%), Gaps = 7/224 (3%)

Query: 24  SHLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDW 82
           + +    D           ++    +  + E   GA    L R        +D  +    
Sbjct: 3   TRVIIVDDQAMVRAGFAALLAAQSDIDVVGEAPDGAKGVELSRRTRPDVVLMDVRMPEMD 62

Query: 83  PFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRI 142
             +  R +     D    V  RP  L    F              + +       A +  
Sbjct: 63  GLEAARRL----LDPPAGVTHRPRVLMLTTFDVDDYVYEALRAGASGFLLKDAPPADLIA 118

Query: 143 GLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKT 202
            + ++     ++       +  +A +      +      +   LT RE E LT ++ G++
Sbjct: 119 AVRVVASGDALLAPSVTRRL--IADFAKQRPTTRGRPALRLKGLTERETEVLTLVARGQS 176

Query: 203 SDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + EIA  L ++  TV  +++ ++ K   + R+ A+ +A  + +V
Sbjct: 177 NTEIAQTLVLAEQTVKTHVSRVLTKLDLRDRAQAVVFAYESGLV 220


>gi|23465503|ref|NP_696106.1| response regulator of two-component system [Bifidobacterium longum
           NCC2705]
 gi|239621956|ref|ZP_04664987.1| response regulator [Bifidobacterium longum subsp. infantis CCUG
           52486]
 gi|23326161|gb|AAN24742.1| response regulator of two-component system [Bifidobacterium longum
           NCC2705]
 gi|239515147|gb|EEQ55014.1| response regulator [Bifidobacterium longum subsp. infantis CCUG
           52486]
          Length = 248

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 42/261 (16%), Positives = 80/261 (30%), Gaps = 33/261 (12%)

Query: 4   EIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL 63
           E Q++ +V+  + E   +  + +      +A                      GA    L
Sbjct: 3   EEQKIRVVIADDQELVRAGFAMVIGSQPDMAVAAQARD---------------GAEAVAL 47

Query: 64  VRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNV----LQRPTELFCPVFHTLPEN 119
                     +D  +      +  R ++  +     +     + R   +    F      
Sbjct: 48  AETLHPDVVLMDVRMPGMDGIEATRQISSLQHRFAADGTQSEVARTKVIILTTFDLDEYV 107

Query: 120 ITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVH 179
           +       + +     +   +   +  +F    II       +         M  +   H
Sbjct: 108 MAAITAGASGFLLKDTEPETLLNSIRTVFQGNAIIAPSATKRLIEKMMEGDFMAANVGAH 167

Query: 180 WGKDF--------------ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIM 225
                              ELT RE E L  I+ G ++ EIA  L IS  TV  ++A I+
Sbjct: 168 GNSTASSTSDSTYTDPELDELTDREREVLIEIAHGLSNQEIADKLFISLPTVKTHVAHIL 227

Query: 226 RKTATKTRSGAIAYAVRNNIV 246
            K   + R  A+ +A  N++V
Sbjct: 228 AKINARDRVQAVVFAYENHLV 248


>gi|95108205|emb|CAD17929.2| probable transcriptional activator of quorum sensing autoinducer
           synthesis transcription regulator protein [Ralstonia
           solanacearum GMI1000]
          Length = 238

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/221 (16%), Positives = 76/221 (34%), Gaps = 14/221 (6%)

Query: 40  DCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYY 99
             T      + A    +G  H            +   ++ +++P         +      
Sbjct: 17  ASTSDVFEHIEAAALALGFEHVAYGFKAPLPLSEPKVVLLNNYPQAWRARYLEAGYLHVD 76

Query: 100 NVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKG 151
             + +      P+  +           +     G+   +   + D   +   L L     
Sbjct: 77  PSVAQACRSQAPIVWSDRLFQDVPALWDEAKAHGLRVGWAQSSLDSLGVGGMLSLSRSCE 136

Query: 152 RIILRDRL---WEIGLLAAYQA---NMFKSYDVHWGKDFELTGREVECLTWISEGKTSDE 205
            +  R+       +  LA       +     DV    D  LT REVE + W ++GK++ +
Sbjct: 137 PLSARELAENTRRMQWLAHMAHVALSRLLRADVAGYSDDNLTNREVEVMKWTADGKSAQD 196

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           IA IL IS+NTV+ ++ + ++K     ++ A+  A     +
Sbjct: 197 IADILAISKNTVDFHVKNAVKKLHAVNKTAAVVRAAMLGYL 237


>gi|167464395|ref|ZP_02329484.1| Two-component response regulator [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 241

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 32/252 (12%), Positives = 72/252 (28%), Gaps = 35/252 (13%)

Query: 7   QVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRW 66
           +V ++L  + +     +  +    D +  +      +                   L   
Sbjct: 11  RVKLILADDHQLFREGLKRIINMEDDMEVVGECGDGIQVIE---------------LCNE 55

Query: 67  DLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGM 126
                  +D  +  +        + L        +      +   +              
Sbjct: 56  IQPDVVLMDINMPLENGVVATERLKL--------IFPDIKIIILSIHDDESYVFETLRKG 107

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEI------------GLLAAYQANMFK 174
            + Y     +   +   +  +      I      ++              +A        
Sbjct: 108 ASGYLLKDMEAESLINAIRSVVAGHAYIHPKVTGKLINQLRRMTYLDHTGVAGGNPAHDS 167

Query: 175 SYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRS 234
           +          LT RE E L  ++EG+++  I   L IS  TV N+++SI++K     R+
Sbjct: 168 ALRYIDSPSSPLTKREAEVLRLMAEGRSNKSIGEYLYISEKTVKNHVSSILQKMEVDDRT 227

Query: 235 GAIAYAVRNNIV 246
            A+  A++N  V
Sbjct: 228 QAVIIAIKNGWV 239


>gi|168239186|ref|ZP_02664244.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194735895|ref|YP_002114983.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|198243442|ref|YP_002215136.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|194711397|gb|ACF90618.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197288026|gb|EDY27413.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197937958|gb|ACH75291.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|322616943|gb|EFY13851.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322618183|gb|EFY15075.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322625853|gb|EFY22672.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322626305|gb|EFY23115.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322632720|gb|EFY29465.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322639062|gb|EFY35755.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322640503|gb|EFY37156.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322645988|gb|EFY42505.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322649891|gb|EFY46312.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322655499|gb|EFY51807.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322660277|gb|EFY56515.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322662958|gb|EFY59165.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322668143|gb|EFY64302.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674097|gb|EFY70191.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322675550|gb|EFY71624.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322683038|gb|EFY79054.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322686732|gb|EFY82710.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|323195379|gb|EFZ80559.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323199270|gb|EFZ84365.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323204435|gb|EFZ89441.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323207525|gb|EFZ92473.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323211850|gb|EFZ96681.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323217510|gb|EGA02229.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323219586|gb|EGA04070.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323223588|gb|EGA07903.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323231532|gb|EGA15645.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323235975|gb|EGA20054.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323240545|gb|EGA24588.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323245437|gb|EGA29437.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323250207|gb|EGA34099.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323253982|gb|EGA37806.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323255491|gb|EGA39252.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323262088|gb|EGA45651.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323266211|gb|EGA49701.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323270680|gb|EGA54121.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
 gi|326622885|gb|EGE29230.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 240

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 72/231 (31%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   +         +   T+ +   ++ L         +    + + +P   V 
Sbjct: 10  RRAMLLRFQEMAAAEDVYTELQYQTQRLEFDYYALCVRHPVPFTRPKISLRTTYPPAWVT 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLP--------ENITPPAGMDNRYCSLTFDVARI 140
                       VL+        +              +     G+            R 
Sbjct: 70  HYQSENYFAIDPVLKPENFRQGHLHWDDMLFHEAQAMWDAAQRFGLRRGVTQCVMLPNRA 129

Query: 141 RIGLMLLFPKGRIIL---RDRLWEIGLLAAYQANMFK--SYDVHWGKDFELTGREVECLT 195
              L       R       +    + LLA    +       D+    +   + RE E L 
Sbjct: 130 LGFLSFSRSSLRCSSFTYDEVELRLQLLARESLSALTRFEDDMVMAPEMRFSKREKEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|313110609|ref|ZP_07796491.1| putative transcriptional regulator [Pseudomonas aeruginosa 39016]
 gi|310882993|gb|EFQ41587.1| putative transcriptional regulator [Pseudomonas aeruginosa 39016]
          Length = 226

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 36/225 (16%), Positives = 70/225 (31%), Gaps = 14/225 (6%)

Query: 36  MIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEK 95
           M  +     +   +  +    G   F       F          S++P +        + 
Sbjct: 1   MSRITTEEEFFSLVLEICGNYGFEFFSFGARAPFPLTAPKYHFLSNYPGEWKSRYISEDY 60

Query: 96  DKYYNVLQRPTELFCPVFH--------TLPENITPPAGMDNRYCSLTFDVARIRIGLMLL 147
                +++     + P+                    G+ + +         +   L L+
Sbjct: 61  TSIDPIVRHGLLEYTPLIWNGEDFQENRFFWEEALHHGIRHGWSIPVRGKYGLISMLSLV 120

Query: 148 FPKGRIILRDRLWE------IGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGK 201
                I   + L +      I  +         +  +    +  LT RE E L W + GK
Sbjct: 121 RSSESIAATEILEKESFLLWITSMLQATFGDLLAPRIVPESNVRLTARETEMLKWTAVGK 180

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T  EI +IL I + TV  +I + MRK  +  ++ A   A    ++
Sbjct: 181 TYGEIGLILSIDQRTVKFHIVNAMRKLNSSNKAEATMKAYAIGLL 225


>gi|239981891|ref|ZP_04704415.1| two-component system response regulator [Streptomyces albus J1074]
          Length = 243

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 32/242 (13%), Positives = 76/242 (31%), Gaps = 25/242 (10%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           ++ + +++  +       +  +    + +  +                    GA      
Sbjct: 24  VEPIRVLVVDDHALFRRGLEIVLEAEEDIEVIGEAGD---------------GAEAVEKA 68

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
              L     +D  +      +    +          V      +   +     +      
Sbjct: 69  ADLLPDIVLMDVRMPKRGGIEACTAIKE--------VAPSAKIIMLTISDEEADLYEAIK 120

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
                Y         +   +  +      I      ++  L  +++ + ++ +       
Sbjct: 121 AGATGYLLKEISTDEVATAIRAVADGQSQISPSMASKL--LTEFKSMIQRTDERRLVPAP 178

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            LT RE+E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  
Sbjct: 179 RLTDRELEVLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREK 238

Query: 245 IV 246
           I+
Sbjct: 239 IL 240


>gi|107100865|ref|ZP_01364783.1| hypothetical protein PaerPA_01001895 [Pseudomonas aeruginosa PACS2]
 gi|296390203|ref|ZP_06879678.1| transcriptional regulator LasR [Pseudomonas aeruginosa PAb1]
          Length = 223

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 41/220 (18%), Positives = 69/220 (31%), Gaps = 17/220 (7%)

Query: 44  SWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQ 103
            W+  +  +   +G S  L        +   ++ +  ++P         +   +    + 
Sbjct: 2   EWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVS 61

Query: 104 RPTELFCPVFH----------TLPENITPPAGMDNRYCSLTFDVARIRIGLMLL-----F 148
             T+   P+F                    AG+                 L L       
Sbjct: 62  HCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENR 121

Query: 149 PKGRIILRDRLWEIGLLAAYQANMFKSYDVHWG--KDFELTGREVECLTWISEGKTSDEI 206
            +    +   L  + +L  Y               K   LT RE E L W + GKTS EI
Sbjct: 122 AEANRFMESVLPTLWMLKDYALQSGAGLAFEHPVSKPVVLTSREKEVLQWCAIGKTSWEI 181

Query: 207 AVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +VI   S   VN ++ +I RK    +R  A   AV   ++
Sbjct: 182 SVICNCSEANVNFHMGNIRRKFGVTSRRVAAIMAVNLGLI 221


>gi|330684760|gb|EGG96455.1| putative response regulator protein VraR [Staphylococcus
           epidermidis VCU121]
          Length = 207

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 39/224 (17%), Positives = 76/224 (33%), Gaps = 17/224 (7%)

Query: 23  VSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDW 82
           +  +    D       L+  +S    +  +    G +   L    L   ++ D ++    
Sbjct: 1   MKKIILVDDHHIVRQGLEFLLSTVEDIEVV---QGFAEGKLFLDYLENNEQPDIVLLDLV 57

Query: 83  PFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRI 142
             D+            Y  ++         +      I+      + Y     +  ++  
Sbjct: 58  MPDMNGIEITEYLKNNYPNIKIL---VLTSYVDDEHVISALEKGADGYEMKDVEPQKLIE 114

Query: 143 GLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKT 202
            +  +    RII  D        A +  +   S      K   L+ RE E L  + +GKT
Sbjct: 115 TIHNVLDGKRIIHPD--------AKHVLDSMSSKPHFTNK---LSKRETEVLKEMVKGKT 163

Query: 203 SDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + EIA  L +S  T+  +++ I  K     R+ A  YA+ N ++
Sbjct: 164 NKEIANTLFVSEKTIKTHVSHIFSKLQVSDRTQAAIYAMENKLI 207


>gi|238027315|ref|YP_002911546.1| Autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia glumae BGR1]
 gi|237876509|gb|ACR28842.1| Autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia glumae BGR1]
          Length = 234

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 42/224 (18%), Positives = 73/224 (32%), Gaps = 12/224 (5%)

Query: 35  RMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSE 94
               ++        +  +   +G                  S+  S++P           
Sbjct: 11  EFSRIEKPQHLGATLSRVAAILGYEFVAYGIRRPLPLSNPPSLTVSNYPARWQERYQGLR 70

Query: 95  KDKYYNVLQRPTELFCPVFHT--------LPENITPPAGMDNRYCSLTFDVARIRIGLML 146
             +   V +       PV  +                 G+ + + S T         L L
Sbjct: 71  LAEIDPVARAANASDRPVVWSSQGNDSDQAFWQEASSFGLMHGWSSATRGAEGTLGVLSL 130

Query: 147 LFPKGRIILRDRLWE---IGLLAAYQANMFKSYDVHWG-KDFELTGREVECLTWISEGKT 202
                 I   +R      +  LA         +    G  +  LT RE + L W ++GKT
Sbjct: 131 ARGGDAIDEVERDRNEFIVHWLANVAHAALAPFLPAAGEPEANLTSRETDVLKWTADGKT 190

Query: 203 SDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + EI+ IL IS +TVN ++ +IM K  T  +  A+A A    ++
Sbjct: 191 AYEISRILSISESTVNFHVKNIMSKLGTSNKIQAVAKAALTGML 234


>gi|222106725|ref|YP_002547516.1| DNA-binding HTH domain-containing protein [Agrobacterium vitis S4]
 gi|221737904|gb|ACM38800.1| DNA-binding HTH domain-containing protein [Agrobacterium vitis S4]
          Length = 307

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 36/243 (14%), Positives = 77/243 (31%), Gaps = 24/243 (9%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLF----QEQKLDSIVSSDWP 83
                + R+            M +  + +G  +F              +   +   +++P
Sbjct: 44  PLDRFIMRLNAAVSAAEMKAVMESSIKSLGYKYFSYHILQTPVLNATNETRHTFGINNYP 103

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPEN-------------ITPPAGMDNRY 130
            + V   A         ++        P   +   +                  G+ N  
Sbjct: 104 EEWVERYASERYVYCDPIVGISLSRKTPFRWSDAIDSDKLTEEERCVIEDAAKRGIVNGL 163

Query: 131 CSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKS-------YDVHWGKD 183
                        + ++  +           I +++ +  +              +  + 
Sbjct: 164 TVPLMSRHGELAIMTVIPDEKFQDSLPEAHLIHIISQFFHSCALPVVMEEHLIGSYRRRR 223

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             L+ RE E + W+S+GK+S EIA ILGIS  +V  Y+ S+ RK     R+ A+  A+  
Sbjct: 224 SFLSAREKETVIWVSKGKSSWEIAKILGISEKSVEFYMESVKRKLEAVNRTQAVVKAIML 283

Query: 244 NIV 246
            ++
Sbjct: 284 GLI 286


>gi|325920818|ref|ZP_08182719.1| response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Xanthomonas gardneri ATCC 19865]
 gi|325548715|gb|EGD19668.1| response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Xanthomonas gardneri ATCC 19865]
          Length = 213

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 29/239 (12%), Positives = 75/239 (31%), Gaps = 27/239 (11%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + + L  +       +  L    + +  +           ++  +               
Sbjct: 2   IRVCLVDDQTLVRQGIRSLLALDNGIEVVAEASDGKQAVEQIPQI--------------- 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      + ++ ++ +              +    F      +       
Sbjct: 47  QPDVVLMDMRMPVMSGLEALQMLSRNGTLP--------PTIILTTFDDDQLVLAGLKAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y      + ++   +  +   G ++       +     +  N F S      +   LT
Sbjct: 99  KGYLLKDVSLEQLVGAIRTVAGGGSLVQPAVTQRLLSGLEHMRNEFVSL----DRPDPLT 154

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  ++ G ++ EIA  LG++  T+ N++++I+ K   + R+ A+  A    +V
Sbjct: 155 DRETEILRLMASGFSNKEIANSLGVAEGTIKNHVSNILSKLGVRDRTRAVLKAFELQLV 213


>gi|294340032|emb|CAZ88396.1| autoinducer-binding transcriptional regulator LuxR family
           [Thiomonas sp. 3As]
          Length = 237

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 39/229 (17%), Positives = 75/229 (32%), Gaps = 16/229 (6%)

Query: 33  LARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMAL 92
           L  +  + C       + ++   +G  H            +   ++ +++P         
Sbjct: 9   LHALQTITCDAQLFEIVVSMVHSLGFDHCSYGLRMPLPVSRPKVVLLTNYPRAWENRYTE 68

Query: 93  SEKDKYYNVLQRPTELFCPVFH--------TLPENITPPAGMDNRYCSLTFDVARIRIGL 144
                    ++  T    PV                    G+   +   + DV      L
Sbjct: 69  KGYLAVDPTVRHGTHSLQPVVWSDAFFASSRDLWEEARSFGLCVGWAQSSRDVNSTMGLL 128

Query: 145 MLLFPKGRIILRDRLWE-------IGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
             +   G  I    L +       +  +     +   +  +       LT RE+E L W 
Sbjct: 129 S-VSRSGEPISEIELRDKEMQLAWLTQMVHLGMSRILTAKLMPAVTAPLTDREIEVLRWT 187

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++GKT+ EIA IL IS  T N +IA+ + K     ++ A+  A    ++
Sbjct: 188 ADGKTASEIADILNISERTANFHIANAIAKLHAPNKTAAVIRAGMLGML 236


>gi|294666925|ref|ZP_06732155.1| two-component system regulatory protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292603297|gb|EFF46718.1| two-component system regulatory protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 213

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 31/239 (12%), Positives = 75/239 (31%), Gaps = 27/239 (11%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
             + L  +       +  L    D +  +           ++  +               
Sbjct: 2   TRVCLVDDQTLVRQGIRSLLALDDGIEVVAEASDGKQAVEQIPQI--------------- 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      + ++ ++ +           P  +    F      +       
Sbjct: 47  QPDVVLMDMRMPVMSGLEALQMLSRNG--------ALPPTIILTTFDDDQLVLAGLKAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y      + ++   +  +   G ++       +     +  N F S      +   LT
Sbjct: 99  KGYLLKDVSLEQLVGAIRTVADGGSLVQPAVTQRLLSGLEHMRNEFVSL----DRPDPLT 154

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  ++ G ++ EIA  LG++  T+ N++++I+ K   + R+ A+  A    +V
Sbjct: 155 DRETEILRLMASGFSNKEIANSLGVAEGTIKNHVSNILSKLGVRDRTRAVLKAFELQLV 213


>gi|227823797|ref|YP_002827770.1| putative transcriptional regulator, LuxR family [Sinorhizobium
           fredii NGR234]
 gi|227342799|gb|ACP27017.1| putative transcriptional regulator, LuxR family [Sinorhizobium
           fredii NGR234]
          Length = 246

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/238 (15%), Positives = 73/238 (30%), Gaps = 24/238 (10%)

Query: 32  LLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMA 91
            LA +  +            L +  G   + +VR     E  L  +++  WP    +   
Sbjct: 9   FLALLEEMKTREEILPEFERLLDRCGFDFYGVVRQPKPHENPLRLLLAGRWPESWPQIYI 68

Query: 92  LSEKDKYYNVLQRPTELFCPVFHTL----------------PENITPPAGMDNRYCSLTF 135
             +       ++                                     G+ +       
Sbjct: 69  RKKYVVIDPTIRYLGHAQRGFRWRDTLVAFRSDPHRKRMESMMVEARNHGLFDGDIFPVH 128

Query: 136 DVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVH-------WGKDFELTG 188
               +   L  +  +   +    L     +A                       + ++T 
Sbjct: 129 GRRGLMGNL-TVGGRVVDLSPVELSLFDAIAKRLFWKLLELTDPEIMAELVSRVEVQMTR 187

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE+E L ++++G TS++I  +L IS +TV+ Y+  I  K   K R  A+A A R  ++
Sbjct: 188 REMEALNYLADGMTSNDIGKVLDISSHTVDWYMNGIQEKLKAKNRHHAVAIAFRLGLI 245


>gi|150395665|ref|YP_001326132.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
 gi|150027180|gb|ABR59297.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
          Length = 246

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 46/224 (20%), Positives = 81/224 (36%), Gaps = 17/224 (7%)

Query: 39  LDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDS-IVSSDWPFDLVRCMALSEKDK 97
           ++        +  ++E  G   F+++         L +  + + WP D +R    +    
Sbjct: 23  IENEDDVRGALGRVSEGFGFRGFMVLAIPDSGSHSLTAQALMTTWPMDFLRRYDSARLID 82

Query: 98  YYNVLQRPTELFCPVFHTLPENITPP--------------AGMDNRYCSLTFDVARIRIG 143
              V+QR      P  +   +                   A M         D A  R  
Sbjct: 83  GSPVIQRLRRSTIPFTYDAHQLARGRVDGKGEAAICVFEQANMPRGVYLPVHDAAGHRAA 142

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-LTGREVECLTWISEGKT 202
           +         +  D L E+ L A    +          +    L+ RE+ECL W + GKT
Sbjct: 143 VAF-GGDRSAVSGDELQELNLWAGLLYSRLSEVRTRDRRGPGSLSRREIECLRWAAAGKT 201

Query: 203 SDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + E+A I+ +S  TVN+Y+    RK  +  R   +A A+R  ++
Sbjct: 202 TVEMARIMALSEYTVNHYLNRATRKLDSVNRVQTVAKAIRAGLI 245


>gi|313902397|ref|ZP_07835800.1| two component transcriptional regulator, LuxR family
           [Thermaerobacter subterraneus DSM 13965]
 gi|313467328|gb|EFR62839.1| two component transcriptional regulator, LuxR family
           [Thermaerobacter subterraneus DSM 13965]
          Length = 218

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/230 (16%), Positives = 69/230 (30%), Gaps = 15/230 (6%)

Query: 17  EQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDS 76
             R           + L +++ L+  +             GA               +D 
Sbjct: 2   PIRVLIADDHALLREGLRQVLHLEPDIEVVGEARN-----GAEAVRHAARLRPDLVVMDI 56

Query: 77  IVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFD 136
            +      +  R +  +              L   +       +   A   + +     +
Sbjct: 57  NLPDMSGIEATRQIRAASASTQ--------VLVLTIHDQEEYLLEAIAAGASGFVLKDVE 108

Query: 137 VARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTW 196
              +   + L       +       +  L   +   +        +   LT RE E L  
Sbjct: 109 PRTLVEAVRLCCRGEGYVHPTLSARVLNLGTRRRERWTPLGGGIPE--PLTRREFEVLQL 166

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++EG ++ EI   L IS  TV N+I SI RK     R+ A+ +A+R   V
Sbjct: 167 VAEGVSNREIGQRLFISEKTVKNHITSIFRKLGVADRTQAVIHAIREGWV 216


>gi|288733198|emb|CBI71275.1| UnaR protein [Burkholderia unamae]
          Length = 234

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 35/231 (15%), Positives = 72/231 (31%), Gaps = 17/231 (7%)

Query: 33  LARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMAL 92
           ++ ++      +W   +  L    G S  +L        +  D+ + +++     +    
Sbjct: 1   MSPVLDAPEEAAWFDAVTKLASSWGFSQLMLAILPRPGMRLEDAFIRTNYSAAWRQTYND 60

Query: 93  SEKDKYYNVLQRPTELFCPVFHTLP----------ENITPPAGMDNRYCSLTFDVARIRI 142
                +   +   T    P+  +                   G+            +   
Sbjct: 61  HGMAYFDPTVTHCTTRSSPLIWSPELFATEQQQSMYEEARAYGLRAGITLPIHGPRQEVG 120

Query: 143 GLMLL--FPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-----LTGREVECLT 195
            L  +           D    +  L   +  +  +   H     +     LT RE ECL 
Sbjct: 121 MLCFVNDASPSDGFWDDVNRALPNLVLLRDLVLDTSHRHLTDHVQSLIPKLTPREKECLK 180

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W + GK++ EI+ IL  S   VN ++ +I  K    +R  A   A +  ++
Sbjct: 181 WTALGKSTWEISHILNCSEAVVNFHMKNIRGKFGVNSRRAAAVIATQMGLI 231


>gi|269926224|ref|YP_003322847.1| two component transcriptional regulator, LuxR family [Thermobaculum
           terrenum ATCC BAA-798]
 gi|269789884|gb|ACZ42025.1| two component transcriptional regulator, LuxR family [Thermobaculum
           terrenum ATCC BAA-798]
          Length = 218

 Score =  135 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 36/223 (16%), Positives = 74/223 (33%), Gaps = 16/223 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D +     L   +     +  + E   G     L R        +D ++      
Sbjct: 3   VLIVDDHILVRDGLRSLLE-ARGIEVVGEATNGEEAVELARELKPDIVLMDLMMPKMDGI 61

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +  + ++          L     +         +         + Y     D  R    L
Sbjct: 62  EATKLISAE--------LPEIKVVVLTASEEEEDLFEAIRSGASGYIIKNIDPDRFFELL 113

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKT-S 203
              +     +  +   ++    A         +     D ELT RE E L  + +G T +
Sbjct: 114 EAAYQGEPALPPNLARKVLQEFAQP-----KIERKKRPDAELTDREREILELLVQGITSN 168

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            EIA  L +S +TV  ++ +I+ K   + R+  +AYA+++ ++
Sbjct: 169 KEIAERLFLSESTVKYHLHNILNKLHLQNRAQVVAYALQHGLI 211


>gi|51893278|ref|YP_075969.1| two-component response regulator [Symbiobacterium thermophilum IAM
           14863]
 gi|51856967|dbj|BAD41125.1| two-component response regulator [Symbiobacterium thermophilum IAM
           14863]
          Length = 197

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 32/190 (16%), Positives = 63/190 (33%), Gaps = 11/190 (5%)

Query: 57  GASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTL 116
           G     L +        +D  +      +  R +           +     +   +    
Sbjct: 17  GEEAVELTKALKPDVVIMDISLPDMSGIEATRLIKE--------AVPETRVIGLTMHEEE 68

Query: 117 PENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSY 176
           P  +       + Y       A +   +  +     ++         ++  Y +   ++ 
Sbjct: 69  PFVLEFLRAGADAYIVKRSAAADLVGAIRAVMEGQAVLDPAVTR--AVVEGYVSRPGRAV 126

Query: 177 DVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA 236
                    LT RE E L  I+EG T+ EIA  L IS  TV  + ++++ K     R+  
Sbjct: 127 GQPEEP-CPLTPREREILVLIAEGLTNAEIARRLYISEKTVQTHRSNMLDKLGIHDRTEL 185

Query: 237 IAYAVRNNIV 246
           + YA+R  +V
Sbjct: 186 VRYAIRQGLV 195


>gi|300866500|ref|ZP_07111190.1| two-component response regulator [Oscillatoria sp. PCC 6506]
 gi|300335457|emb|CBN56350.1| two-component response regulator [Oscillatoria sp. PCC 6506]
          Length = 241

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 34/258 (13%), Positives = 72/258 (27%), Gaps = 34/258 (13%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           + ++ + L  + +     +     + D +  +            + +             
Sbjct: 1   MTKIRVALVEDHDLTRVGIRTALQQRDGIEVVGDAANATEGLKLLQS------------- 47

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                    +D  +      +L +    S         +              E +   A
Sbjct: 48  --SKPDVAIVDIGLPDFDGIELTQKFKKSIATGSDPDTKVL---ILTFQDNEEEVLAAFA 102

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
              + YC       ++   + +       I       +   A  +A           K  
Sbjct: 103 AGADSYCMKDISFDQLLDVVKVTHEGNSWIDPAIARIVLKQARTEAQNPVEEQKVEHKKV 162

Query: 185 E----------------LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKT 228
                            LT RE+E L  I +G ++  IA  L I+  TV  ++ +I+ K 
Sbjct: 163 TINAAEPEFSHIIETYPLTERELEVLELIVQGYSNAAIAEKLYITVGTVKTHVRNILNKL 222

Query: 229 ATKTRSGAIAYAVRNNIV 246
               R+ A   A+R+ +V
Sbjct: 223 CADDRTQAAVLALRSGLV 240


>gi|302544912|ref|ZP_07297254.1| nitrate/nitrite response regulator [Streptomyces hygroscopicus ATCC
           53653]
 gi|302462530|gb|EFL25623.1| nitrate/nitrite response regulator [Streptomyces himastatinicus
           ATCC 53653]
          Length = 249

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 32/241 (13%), Positives = 76/241 (31%), Gaps = 25/241 (10%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVR 65
           + + +++  +       +  +  + + +  +                    GA       
Sbjct: 31  EPIRVLVVDDHALFRRGLEIVLAQEEDIQVVGEAGD---------------GAEAVDKAA 75

Query: 66  WDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
             L     +D  +      +    +          V      +   +     +       
Sbjct: 76  DLLPDIVLMDVRMPKRGGIEACTSIKE--------VAPSAKIIMLTISDEEADLYDAIKA 127

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE 185
               Y         +   +  +      I      ++  L  +++ + ++ +        
Sbjct: 128 GATGYLLKEISTDEVSTAIRAVADGQSQISPSMAAKL--LTEFKSMIQRTDERRLVPAPR 185

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I
Sbjct: 186 LTDRELEVLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKI 245

Query: 246 V 246
           +
Sbjct: 246 L 246


>gi|291299414|ref|YP_003510692.1| LuxR family two component transcriptional regulator [Stackebrandtia
           nassauensis DSM 44728]
 gi|290568634|gb|ADD41599.1| two component transcriptional regulator, LuxR family
           [Stackebrandtia nassauensis DSM 44728]
          Length = 225

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 32/230 (13%), Positives = 70/230 (30%), Gaps = 15/230 (6%)

Query: 17  EQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDS 76
             R              A ++      S            GA   +  R        +D 
Sbjct: 4   PIRVLVADDHLVVRTGFAELLGTQPDFSVVGIA-----SDGAEAVMACRTATPDVVLMDV 58

Query: 77  IVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFD 136
            + +    +  R +A + +         P  +    F              + +      
Sbjct: 59  RMPNMDGIEATRRIAATSEAT-------PRVIILTTFDLDEYVYDALRAGASGFLLKDVT 111

Query: 137 VARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTW 196
             R+   + ++     ++       +           +   V   +   LT RE E L  
Sbjct: 112 AERLFDAVRVVAAGEALLAPTVTRRLI---GEFVQSKQPRPVADARLASLTPRETEVLRL 168

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++EG ++ E+A  L +S  TV  +++ ++ K   + R+ A+  A  + +V
Sbjct: 169 VAEGLSNPELAARLTVSEETVKTHVSRVLHKLGLRDRTQAVVAAYESGLV 218


>gi|218677689|ref|ZP_03525586.1| transcriptional regulator, LuxR family protein [Rhizobium etli CIAT
           894]
          Length = 240

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 86/226 (38%), Gaps = 18/226 (7%)

Query: 37  IPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI-VSSDWPFDLVRCMALSEK 95
              +        M  LT+ +G + FL +        ++ +  + ++WP ++V        
Sbjct: 15  AGFNTHYEVFKYMKGLTQDLGMNAFLFMTLPTVDNVEIGATKIITNWPAEMVDYYDAHSL 74

Query: 96  DKYYNVLQRPTELFCPVFHTLPE--------------NITPPAGMDNRYCSLTFDVARIR 141
                V++R      P  + +                 +    GM+        D A  R
Sbjct: 75  LIDSPVIRRMLRSTSPFNYDVEAINTNRGEGKKSTVIELFFRYGMEKGAYFPVHDAAGGR 134

Query: 142 IGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYD-VHWGKDFELTGREVECLTWISEG 200
             + +  P+   +    + ++  +A    +           K  E T  E++CL   + G
Sbjct: 135 GAMSISGPRNFSM--IEMAKLLFIATLIYDRLSQLTLNEKHKPIEFTPGELDCLRLTAGG 192

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +   EIA +L ++ N VNN+I S ++K    TR+ A+  A+R NI+
Sbjct: 193 RKGSEIAKLLDLTENVVNNHIGSAIKKLGCTTRTQAVVSALRLNII 238


>gi|311069822|ref|YP_003974745.1| two-component response regulator YvqE [Bacillus atrophaeus 1942]
 gi|310870339|gb|ADP33814.1| two-component response regulator [YvqE] responding to cell wall
           stress [Bacillus atrophaeus 1942]
          Length = 211

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 38/239 (15%), Positives = 71/239 (29%), Gaps = 30/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  + E     ++        +  +                    G+    L    
Sbjct: 2   IRVLLIDDHEMVRMGLAAFLEAQADIEVIGEASD---------------GSQGVQLAVQL 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++      +  +        +   VL  P  +    F    +         
Sbjct: 47  KPDVILMDLVMEGMDGIEATK--------QICGVLDDPKIIVLTSFIDDDKVYPVIEAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y   T     I   +         +           A    +  +  +        LT
Sbjct: 99  LSYLLKTSKAGEIADAIRAASKGEPKLESKV-------AGKVLSRLRHSNDSALPHETLT 151

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE+E L  ++EGKT+ EI   L I+  TV  ++ +I+ K     R+ A  YA RN +V
Sbjct: 152 KRELEILCLVAEGKTNKEIGEELFITIKTVKTHVTNILSKLEVADRTQAAVYAHRNKLV 210


>gi|310287681|ref|YP_003938939.1| transcriptional regulator, LuxR family [Bifidobacterium bifidum
           S17]
 gi|309251617|gb|ADO53365.1| transcriptional regulator, LuxR family [Bifidobacterium bifidum
           S17]
          Length = 255

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 37/262 (14%), Positives = 79/262 (30%), Gaps = 35/262 (13%)

Query: 4   EIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL 63
           E+Q++ +V+  + E   +  + +      +  +                    GA    L
Sbjct: 10  ELQRIRVVIADDQELVRAGFAMVIGSQPDIQVVGQAGD---------------GAQAVSL 54

Query: 64  VRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPP 123
                     +D  +      +    ++  E        ++   +    F      +   
Sbjct: 55  AESLHPDVVLMDVRMPGMDGLEATSRISALEAAAGDA-PRKTRVIILTTFDLDEYVMAAI 113

Query: 124 AGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIG---LLAAYQANMFKSYDVHW 180
               + +     +   +   +  ++    II       +    +   Y  +   + D + 
Sbjct: 114 NAGASGFLLKDTEPETLLSSIRTVYQGNAIIAPSATKRLIEKMMEDGYTKHGLTATDGYA 173

Query: 181 GKDFE----------------LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASI 224
                                LT RE E L  I+ G ++ EIA  L IS  T   ++A I
Sbjct: 174 DGSSTMPGARPVAYTDPELNLLTEREREVLVEIAHGLSNQEIADKLFISLPTAKTHVAHI 233

Query: 225 MRKTATKTRSGAIAYAVRNNIV 246
           + K   + R  A+ +A  N +V
Sbjct: 234 LAKINARDRVQAVVFAYDNGLV 255


>gi|159040348|ref|YP_001539601.1| two component LuxR family transcriptional regulator [Salinispora
           arenicola CNS-205]
 gi|157919183|gb|ABW00611.1| two component transcriptional regulator, LuxR family [Salinispora
           arenicola CNS-205]
          Length = 219

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 38/223 (17%), Positives = 75/223 (33%), Gaps = 11/223 (4%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D           +     +  + E   G +   L          +D  +     
Sbjct: 6   RVLVCDDQALIRTGFATIIDAQPDLEVVGECGDGRAAVGLAGRLHPDVVVMDVRMPVLDG 65

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
               R +A +       V      L    F+             + +       A++  G
Sbjct: 66  IGATRLLAGAG------VANPVKVLVVTTFNLDEYVYEALRAGASGFLLKDAPPAQLLHG 119

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           +  +     ++  +   ++       A   +  +     +  LT RE+E L  I++G ++
Sbjct: 120 IRTVASGAALLAPEVTRQL---VGRYAARIRPAED-SSSEIPLTPRELEVLRLIADGLSN 175

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            EIA  L IS+ TV  Y++ I+ K   + R  A+ YA R+ +V
Sbjct: 176 SEIAATLVISQETVKTYVSRILTKLDLRDRVQAVVYAYRSGLV 218


>gi|311064578|ref|YP_003971303.1| two-component response regulator [Bifidobacterium bifidum PRL2010]
 gi|310866897|gb|ADP36266.1| Two-component response regulator [Bifidobacterium bifidum PRL2010]
          Length = 248

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 37/262 (14%), Positives = 79/262 (30%), Gaps = 35/262 (13%)

Query: 4   EIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL 63
           E+Q++ +V+  + E   +  + +      +  +                    GA    L
Sbjct: 3   ELQRIRVVIADDQELVRAGFAMVIGSQPDIQVVGQAGD---------------GAQAVSL 47

Query: 64  VRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPP 123
                     +D  +      +    ++  E        ++   +    F      +   
Sbjct: 48  AESLHPDVVLMDVRMPGMDGLEATSRISALEAAAGDA-PRKTRVIILTTFDLDEYVMAAI 106

Query: 124 AGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIG---LLAAYQANMFKSYDVHW 180
               + +     +   +   +  ++    II       +    +   Y  +   + D + 
Sbjct: 107 NAGASGFLLKDTEPETLLSSIRTVYQGNAIIAPSATKRLIEKMMEDGYTKHGLTATDGYA 166

Query: 181 GKDFE----------------LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASI 224
                                LT RE E L  I+ G ++ EIA  L IS  T   ++A I
Sbjct: 167 DGSSTIPGARPVAYTDPELNLLTEREREVLVEIAHGLSNQEIADKLFISLPTAKTHVAHI 226

Query: 225 MRKTATKTRSGAIAYAVRNNIV 246
           + K   + R  A+ +A  N +V
Sbjct: 227 LAKINARDRVQAVVFAYDNGLV 248


>gi|111221195|ref|YP_711989.1| putative two-component system response regulator [Frankia alni
           ACN14a]
 gi|111148727|emb|CAJ60403.1| Putative two-component system response regulator [Frankia alni
           ACN14a]
          Length = 213

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 68/218 (31%), Gaps = 11/218 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
             D    +  L   +     +  +     G     L          +D  +         
Sbjct: 2   VDDHELFLQGLQTVLEIEEDISVVGRAGDGQEALTLASGTSPDIVLMDVRMPGRDGIAAA 61

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLL 147
             +           + R   +   V     +           Y   +     +   +  +
Sbjct: 62  GAIKR--------AVPRTRIVMLTVSDEESDLFEAIKAGAVGYLLKSIPPHEVADAVRAV 113

Query: 148 FPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIA 207
                +I      ++  +  +      + D        LT RE+E L  ++EG+ + EIA
Sbjct: 114 HNGQSLISPSMASKL--MVEFATMARGTEDRPRVNAPHLTARELEVLKLVAEGRANREIA 171

Query: 208 VILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
             L IS NTV N++ +I+ K    +R  A+ YAVR  +
Sbjct: 172 RKLFISENTVKNHVRNILDKLQLHSRMEAVMYAVRQGL 209


>gi|324113634|gb|EGC07609.1| autoinducer binding domain-containing protein [Escherichia
           fergusonii B253]
          Length = 251

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 44/231 (19%), Positives = 78/231 (33%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L+R   +         +   T+ +   ++ L         +      S +P   V 
Sbjct: 21  RRTMLSRFQEMASAEDVFQELQLQTQKLEFDYYSLCVRHPVPFTRPKVAYYSTYPEAWVS 80

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYC--SLTFDVA 138
                       VL+        +              +     G+        +  + A
Sbjct: 81  YYQQHNFLAIDPVLKPENFSQGHLLWDDALFSEAQPLWDAARAHGLRRGVTQYLMLSNRA 140

Query: 139 RIRIGLMLLFPKGRIILRDRLW-EIGLLAAYQANMFKSY--DVHWGKDFELTGREVECLT 195
              + L  +  +   I  D L  ++ LL     N+      ++        + RE E L 
Sbjct: 141 LGFLSLSRMSAREGPIAHDELELKLQLLVRESLNVLARVQHEMVMTPAMRFSKRETEILR 200

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    I+
Sbjct: 201 WTAEGKTSAEIAMILSISENTVNFHQKNMQKKFNAPNKTQVACYAAATGII 251


>gi|297159907|gb|ADI09619.1| putative two-component system response regulator [Streptomyces
           bingchenggensis BCW-1]
          Length = 252

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 32/241 (13%), Positives = 76/241 (31%), Gaps = 25/241 (10%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVR 65
           + + +++  +       +  +  + + +  +                    GA       
Sbjct: 34  EPIRVLVVDDHALFRRGLEIVLAQEEDIQVVGEAGD---------------GAEAVDKAA 78

Query: 66  WDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
             L     +D  +      +    +          V      +   +     +       
Sbjct: 79  DLLPDIVLMDVRMPKRGGIEACTSIKE--------VAPSAKIIMLTISDEEADLYDAIKA 130

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE 185
               Y         +   +  +      I      ++  L  +++ + ++ +        
Sbjct: 131 GATGYLLKEISTDEVSTAIRAVADGQSQISPSMASKL--LTEFKSMIQRTDERRLVPAPR 188

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I
Sbjct: 189 LTDRELEVLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKI 248

Query: 246 V 246
           +
Sbjct: 249 L 249


>gi|288554158|ref|YP_003426093.1| two-component response regulator [Bacillus pseudofirmus OF4]
 gi|288545318|gb|ADC49201.1| two-component response regulator of extracellular degradative
           enzyme [Bacillus pseudofirmus OF4]
          Length = 233

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 34/247 (13%), Positives = 78/247 (31%), Gaps = 29/247 (11%)

Query: 12  LNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQE 71
           +N   + R   +       + + R++ ++                G+    LV       
Sbjct: 1   MNENKKIRIVLIDDHQLFREGVKRILAMEPDFEIVADGE-----DGSEARALVDEHRPDV 55

Query: 72  QKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYC 131
             +D  +      +  R +  +  +           L   +               + Y 
Sbjct: 56  ILMDINMPKVNGVEATRELVAAYPN--------VRVLILSIHDDETYVTHVLKTGASGYL 107

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE------ 185
               D   +   + ++   G  I       +      +     + D  + +         
Sbjct: 108 LKEMDAGALIEAVKVVASGGSYIHPKVTHNL----IKEYRRLATEDDKYEESIGFREVEY 163

Query: 186 ------LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
                 LT RE E L  +++G+++  I   L IS  TV N++++I++K +   R+ A+  
Sbjct: 164 RKPLHILTRRECEVLQLMTDGQSNRAIGESLYISEKTVKNHVSNILQKMSVNDRTQAVVE 223

Query: 240 AVRNNIV 246
           A++   V
Sbjct: 224 AIKKGYV 230


>gi|296331212|ref|ZP_06873685.1| two-component response regulator [YvqE] responding to cell wall
           stress [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305675910|ref|YP_003867582.1| two-component response regulator [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296151663|gb|EFG92539.1| two-component response regulator [YvqE] responding to cell wall
           stress [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305414154|gb|ADM39273.1| two-component response regulator [liaS] responding to cell wall
           stress [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 211

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 39/239 (16%), Positives = 69/239 (28%), Gaps = 30/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  + E     ++        +  +                    G     L    
Sbjct: 2   IRVLLIDDHEMVRMGLAAFLEAQPDIEVIGEASD---------------GGEGVRLAAEL 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++      +  + +                 +    F    +         
Sbjct: 47  SPDVILMDLVMEGMDGIEATKQICRELP---DP-----KIIVLTSFIDDDKVYPVIEAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y   T   A I   +         +           A    +  +    H      LT
Sbjct: 99  LSYLLKTSKAAEIADAIRAASKGEPKLESKV-------AGKVLSRLRHSGEHALPHESLT 151

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE+E L  I+EGKT+ EI   L I+  TV  +I +I+ K     R+ A  YA RN++V
Sbjct: 152 KRELEILCLIAEGKTNKEIGEELFITIKTVKTHITNILSKLDVSDRTQAAVYAHRNHLV 210


>gi|256751296|ref|ZP_05492176.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|256749851|gb|EEU62875.1| two component transcriptional regulator, LuxR family
           [Thermoanaerobacter ethanolicus CCSD1]
          Length = 205

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 72/218 (33%), Gaps = 21/218 (9%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPFD 85
               D       L   +     +  +++   G   + L +  +     +D  +       
Sbjct: 2   LVADDHALIRKGLVQLIEMEKDIKVISQASNGEEAYKLAKKFMPDLILMDVNMPVMNGIK 61

Query: 86  LVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLM 145
             + +   +             LF  +++     +         Y     +   +   + 
Sbjct: 62  AAKMLKEEKHP--------SKVLFLTIYNDREYLLEALKLGVEGYILKDAEYDDLIKAIK 113

Query: 146 LLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDE 205
            ++  G  I    + EI  +                   +LT RE+E L  IS G ++ E
Sbjct: 114 TIYNGGVYIHPSLMEEIDNIDQETLKK------------DLTPREIEILKLISNGYSNKE 161

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           IA  L +S  TV N++ +I +K   K R+ A  Y ++N
Sbjct: 162 IAQKLFLSEKTVKNHVYNIFKKLDVKDRTQAAIYMLKN 199


>gi|117619760|ref|YP_858670.1| transcriptional activator protein AhyR/asaR [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117561167|gb|ABK38115.1| transcriptional activator protein AhyR/asaR [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 203

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 48/216 (22%), Positives = 77/216 (35%), Gaps = 35/216 (16%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           + + R      T     ++   +  +G  +F L+       QK    + ++ P       
Sbjct: 8   EHIDRFTKAKKTSDIQQQLERFSHQMGFDYFRLLIIFPISMQKSHVALFNNCPTSWFDAY 67

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPK 150
           +         V+    +   P+F    +  +P                            
Sbjct: 68  SERHYLTQDPVVFLGLKQTQPIFWNKLDCDSP---------------------------- 99

Query: 151 GRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVIL 210
                   L     +      + KS         EL+ RE ECL W SEGKTS EIA IL
Sbjct: 100 -------WLPSASYIFNSALQLIKSRPDLMKYLTELSDREKECLFWASEGKTSWEIATIL 152

Query: 211 GISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           GIS  TVN ++  +  KT +K R+ AIA ++ + I+
Sbjct: 153 GISERTVNFHLNQVTNKTDSKNRNQAIAKSISSGII 188


>gi|152985537|ref|YP_001348746.1| putative transcriptional regulator [Pseudomonas aeruginosa PA7]
 gi|150960695|gb|ABR82720.1| probable transcriptional regulator [Pseudomonas aeruginosa PA7]
          Length = 237

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 36/233 (15%), Positives = 70/233 (30%), Gaps = 14/233 (6%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            R   L  +  +     +      +    G   F       F          S++P +  
Sbjct: 4   EREGYLEILSRITTEEEFFSLALEICGNYGFEFFSFGARAPFPLTAPKYHFLSNYPGEWK 63

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFH--------TLPENITPPAGMDNRYCSLTFDVAR 139
                 +      +++     + P+                    G+ + +         
Sbjct: 64  SRYISEDYTSIDPIVRHGLLEYMPLIWNGEDFQENRFFWEEALHHGIRHGWSIPVRGKYG 123

Query: 140 IRIGLMLLFPKGRIILRDRLWE------IGLLAAYQANMFKSYDVHWGKDFELTGREVEC 193
           +     L+     I   + L +      I  +         +  +    +  LT RE E 
Sbjct: 124 LISMFSLVRSAESIAAAEILEKESFLLWITSMLQATFGDLLAPRIVPESNVRLTARETEM 183

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GKT  EI +IL I + TV  +I + MRK  +  ++ A   A    ++
Sbjct: 184 LKWTAVGKTYGEIGLILSIDQRTVKFHIVNAMRKLNSSNKAEATMKAYAIGLL 236


>gi|150398334|ref|YP_001328801.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
 gi|150029849|gb|ABR61966.1| regulatory protein LuxR [Sinorhizobium medicae WSM419]
          Length = 246

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 37/238 (15%), Positives = 73/238 (30%), Gaps = 24/238 (10%)

Query: 32  LLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMA 91
            LA +  +            L +  G   + +VR     E  L  +++  WP    +   
Sbjct: 9   FLALLEEMKTREEILPEFERLLDRCGFDFYGVVRQPKPHENPLRLLLAGRWPEGWPQIYI 68

Query: 92  LSEKDKYYNVLQRPTELFCPVFHTL----------------PENITPPAGMDNRYCSLTF 135
             +       ++                                     G+ + Y     
Sbjct: 69  RKKYVVIDPTIRFLGHAQRGFRWRDTLVAFRSDPHRKRMESMMIEARNHGLFDGYIFPVH 128

Query: 136 DVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVH-------WGKDFELTG 188
               +   L  +  +   +    L     +A                       + ++T 
Sbjct: 129 GRRGLMGNL-TVGGRVVDLSPVELSLFDAIAKRLFWKLLELTDPEIMAELVSRVEVQMTR 187

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE+E L ++++G TS++I  +L IS +TV+ Y+  I  K   K R   +A A R  ++
Sbjct: 188 REMEALHYLADGMTSNDIGKVLDISSHTVDWYMNGIQEKLKAKNRHHVVALAFRLGLI 245


>gi|319650145|ref|ZP_08004294.1| two-component system response regulator [Bacillus sp. 2_A_57_CT2]
 gi|317398326|gb|EFV79015.1| two-component system response regulator [Bacillus sp. 2_A_57_CT2]
          Length = 212

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 38/239 (15%), Positives = 76/239 (31%), Gaps = 32/239 (13%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           +++ +  + E     +         +  +   +                G     LV  +
Sbjct: 2   ISVAVVDDHEMVRKGIISYLATEAGIKVIGEAES---------------GNEAVKLVLNE 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
             +   +D ++ +    +  R +  S              +    ++   +         
Sbjct: 47  RPEIVLMDLLMENGNGIEATREILKS--------YPGCKIIIITSYYDDEQVFPAIEAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y   T + A +   +        +I           A    + F+  +     D  LT
Sbjct: 99  FSYMLKTANAAEVVNAIKKAAQGESVIESKV-------AGKMVSRFREKEKKPHDD--LT 149

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE + L  I EG T+ EI+  L I   TV  ++++I+ K     R+ A  YA RN I+
Sbjct: 150 EREFDVLLCIGEGMTNQEISEELFIGIKTVKTHVSNILSKLGVTDRTQAAVYANRNGII 208


>gi|313140461|ref|ZP_07802654.1| response regulator [Bifidobacterium bifidum NCIMB 41171]
 gi|313132971|gb|EFR50588.1| response regulator [Bifidobacterium bifidum NCIMB 41171]
          Length = 248

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 37/262 (14%), Positives = 79/262 (30%), Gaps = 35/262 (13%)

Query: 4   EIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL 63
           E+Q++ +V+  + E   +  + +      +  +                    GA    L
Sbjct: 3   ELQRIRVVIADDQELVRAGFAMVIGSQPDIQVVGQAGD---------------GAQAVSL 47

Query: 64  VRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPP 123
                     +D  +      +    ++  E        ++   +    F      +   
Sbjct: 48  AESLHPDVVLMDVRMPGMDGLEATSRISALEAAAGDA-PRKTRVIILTTFDLDEYVMAAI 106

Query: 124 AGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIG---LLAAYQANMFKSYDVHW 180
               + +     +   +   +  ++    II       +    +   Y  +   + D + 
Sbjct: 107 NAGASGFLLKDTEPETLLSSIRTVYQGNAIIAPSATKRLIEKMMEDGYTKHGLTATDGYA 166

Query: 181 GKDFE----------------LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASI 224
                                LT RE E L  I+ G ++ EIA  L IS  T   ++A I
Sbjct: 167 DGSSTMPGARPVAYTDPELNLLTEREREVLVEIAHGLSNQEIADKLFISLPTAKTHVAHI 226

Query: 225 MRKTATKTRSGAIAYAVRNNIV 246
           + K   + R  A+ +A  N +V
Sbjct: 227 LAKINARDRVQAVVFAYDNGLV 248


>gi|86356800|ref|YP_468692.1| transcriptional regulator protein [Rhizobium etli CFN 42]
 gi|86280902|gb|ABC89965.1| probable transcriptional regulator protein [Rhizobium etli CFN 42]
          Length = 240

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 87/226 (38%), Gaps = 18/226 (7%)

Query: 37  IPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI-VSSDWPFDLVRCMALSEK 95
              +        M  LT+ +G + FL++        ++ +  + ++WP ++V        
Sbjct: 15  AGFNTHYEVFKYMKGLTQGLGMTAFLIMTLPTVDFVEIGATKIITNWPAEMVDYYDAHNL 74

Query: 96  DKYYNVLQRPTELFCPVFHTLPE--------------NITPPAGMDNRYCSLTFDVARIR 141
                V++R      P  + +                ++    GM+        D A  R
Sbjct: 75  MVDSPVIRRMLRSTSPFNYDVEAINTDRGEGKKSTVIDLFRRYGMEKGAYFPVHDAAGGR 134

Query: 142 IGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYD-VHWGKDFELTGREVECLTWISEG 200
             + +   +   +    + ++  +A    +           K    T  E++CL   + G
Sbjct: 135 GAMSISGSRNFSM--VEMAKLLFIATLIYDRLSQLTLNEKHKPVAFTQSELDCLRLTAGG 192

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + S EIA +L +S + VNN I S++RK    TR+ A+  A+R NI+
Sbjct: 193 RKSSEIAKLLDLSESAVNNQIGSVIRKLGCTTRTQAVVSALRLNII 238


>gi|325496964|gb|EGC94823.1| DNA-binding transcriptional activator SdiA [Escherichia fergusonii
           ECD227]
          Length = 240

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 44/231 (19%), Positives = 78/231 (33%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L+R   +         +   T+ +   ++ L         +      S +P   V 
Sbjct: 10  RRTMLSRFQEMASAEDVFQELQLQTQKLEFDYYSLCVRHPVPFTRPKVAYYSTYPEAWVS 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYC--SLTFDVA 138
                       VL+        +              +     G+        +  + A
Sbjct: 70  YYQQHNFLAIDPVLKPENFSQGHLLWDDALFSEAQPLWDAARAHGLRRGVTQYLMLSNRA 129

Query: 139 RIRIGLMLLFPKGRIILRDRLW-EIGLLAAYQANMFKSY--DVHWGKDFELTGREVECLT 195
              + L  +  +   I  D L  ++ LL     N+      ++        + RE E L 
Sbjct: 130 LGFLSLSRMSAREGPIAHDELELKLQLLVRESLNVLARLQHEMVMTPAMRFSKRETEILR 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    I+
Sbjct: 190 WTAEGKTSAEIAMILSISENTVNFHQKNMQKKFNAPNKTQVACYAAATGII 240


>gi|258423125|ref|ZP_05686019.1| response regulator receiver [Staphylococcus aureus A9635]
 gi|257846689|gb|EEV70709.1| response regulator receiver [Staphylococcus aureus A9635]
          Length = 207

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 34/226 (15%), Positives = 79/226 (34%), Gaps = 21/226 (9%)

Query: 23  VSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFL--LVRWDLFQEQKLDSIVSS 80
           ++ +    D       L   +S    +  L ++     FL  L   +      LD ++  
Sbjct: 1   MNKVILVDDHYIVRQGLRFLLSTIENIEVLQDFADGETFLEYLKEHEHPDIVLLDLVMPG 60

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARI 140
               ++   +       +Y  ++         +      I+      + Y     +  ++
Sbjct: 61  MNGIEITEYIKA-----HYPEIKVL---VLTSYVDDEHVISAINKGADGYEMKDVEPQQL 112

Query: 141 RIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEG 200
              +  +    ++I                ++ ++         +L+ RE+E L  + +G
Sbjct: 113 IETIRRVMNDEKMIHP-----------KAQDVIETVSQKPHYTNKLSKREIEVLREMVKG 161

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           KT+ EIA  L +S  T+  +++ I  K     R+ A  YA+ N ++
Sbjct: 162 KTNKEIAETLFVSEKTIKTHVSHIFSKLQVSDRTQAAIYAMENKLI 207


>gi|225352800|ref|ZP_03743823.1| hypothetical protein BIFPSEUDO_04432 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225156407|gb|EEG69976.1| hypothetical protein BIFPSEUDO_04432 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 248

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 40/261 (15%), Positives = 77/261 (29%), Gaps = 33/261 (12%)

Query: 4   EIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL 63
           E Q++ +V+  + E   +  + +      +A                      GA    L
Sbjct: 3   EEQKIRVVIADDQELVRAGFAMVIGSQPDMAVAAQARD---------------GAEAVAL 47

Query: 64  VRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQ----RPTELFCPVFHTLPEN 119
                     +D  +      +  R ++        +  Q        +    F      
Sbjct: 48  AETLHPDVVLMDVRMPGMDGIEATRQISALRHRFAADGTQSEVTHTKVIILTTFDLDEYV 107

Query: 120 ITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVH 179
           +       + +     +   +   +  +F    II       +         M  +    
Sbjct: 108 MAAITAGASGFLLKDTEPETLLNSIRTVFQGNAIIAPSATKRLIEKMMEGDFMAANVGRP 167

Query: 180 WGKDF--------------ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIM 225
                              +LT RE E L  I+ G ++ EIA  L IS  TV  ++A I+
Sbjct: 168 ENSATTSTTDSTYTDPELDDLTDREREVLIEIAHGLSNQEIADKLFISLPTVKTHVAHIL 227

Query: 226 RKTATKTRSGAIAYAVRNNIV 246
            K   + R  A+ +A  N++V
Sbjct: 228 AKINARDRVQAVVFAYENHLV 248


>gi|161724877|emb|CAO85750.1| LasR protein [Pseudomonas aeruginosa]
          Length = 239

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 42/233 (18%), Positives = 73/233 (31%), Gaps = 17/233 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           D    +      + W+  +  +   +G S  L        +   ++ +  ++P       
Sbjct: 5   DGFLELERSSGKLEWSAILQKMASDLGFSKILFGLLHKDSQDYENAFIVGNYPAAWHEHY 64

Query: 91  ALSEKDKYYNVLQRPTELFCPVFH----------TLPENITPPAGMDNRYCSLTFDVARI 140
             +   +    + + T+   P+F                    AG+              
Sbjct: 65  DRTGYARVDPTVSQCTQNVLPIFWEASIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGE 124

Query: 141 RIGLMLL-----FPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWG--KDFELTGREVEC 193
              L L        +    +   L  + +L  Y               K   LT RE E 
Sbjct: 125 LGALSLSVEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAFEHPVSKPVVLTSREKEV 184

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GKTS EI+VI   S   VN ++ +I RK    +R  A   AV   ++
Sbjct: 185 LQWCAIGKTSWEISVICNCSEANVNFHMGNIRRKFGVTSRRVAAIMAVNLGLI 237


>gi|322690880|ref|YP_004220450.1| two-component response regulator [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|320455736|dbj|BAJ66358.1| two-component response regulator [Bifidobacterium longum subsp.
           longum JCM 1217]
          Length = 248

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 41/261 (15%), Positives = 78/261 (29%), Gaps = 33/261 (12%)

Query: 4   EIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL 63
           E Q++ +V+  + E   +  + +      +                       GA    L
Sbjct: 3   EEQKIRVVIADDQELVRAGFAMVIGSQPDMTVAAQARD---------------GAEAVAL 47

Query: 64  VRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQ----RPTELFCPVFHTLPEN 119
                     +D  +      +  R ++  +     +  Q        +    F      
Sbjct: 48  AETLHPDVVLMDVRMPGMDGIEATRQISALQHRFAADGTQSEVTHTKVIILTTFDLDEYV 107

Query: 120 ITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVH 179
           +       + +     +   +   +  +F    II       +         M  +   H
Sbjct: 108 MAAITAGASGFLLKDTEPETLLNSIRTVFQGNAIIAPSATKRLIEKMMEGDFMAANVGAH 167

Query: 180 WGKDF--------------ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIM 225
                              ELT RE E L  I+ G ++ EIA  L IS  TV  ++A I+
Sbjct: 168 GNSTASSTSDSTYTDPELDELTDREREVLIEIAHGLSNQEIADKLFISLPTVKTHVAHIL 227

Query: 226 RKTATKTRSGAIAYAVRNNIV 246
            K   + R  A+ +A  N++V
Sbjct: 228 AKINARDRVQAVVFAYENHLV 248


>gi|295696562|ref|YP_003589800.1| two component transcriptional regulator, LuxR family [Bacillus
           tusciae DSM 2912]
 gi|295412164|gb|ADG06656.1| two component transcriptional regulator, LuxR family [Bacillus
           tusciae DSM 2912]
          Length = 220

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 46/239 (19%), Positives = 75/239 (31%), Gaps = 30/239 (12%)

Query: 7   QVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRW 66
            V+++L  +       V  +   ++ L  +                    G     L   
Sbjct: 2   PVSVLLVDDHALFRRGVRTILETAEDLLVVGEASN---------------GKQAVELYAE 46

Query: 67  DLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGM 126
                  +D  +      + VR +           ++        V     +        
Sbjct: 47  LRPDLVLMDIRMPVMGGLEAVRKLRAM-----DPQVRIL---ILTVSEEDDDLFEAIRAG 98

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFEL 186
            N Y     D   +   +  +     +I        GLLAA                  L
Sbjct: 99  ANGYLLKNVDPDELISSIQKVAAGEAVIP-------GLLAARIVAELHKEATPEDVLEPL 151

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           T RE+E L ++S G ++ EIA  L IS +TV N+I +I+ K     R  A AYA+R  I
Sbjct: 152 TSRELEVLGYLSTGASNREIAKQLFISEHTVRNHIQNILGKLHLTNRVQAAAYAIRQGI 210


>gi|76057938|emb|CAJ30486.1| PlaR protein [Burkholderia plantarii]
          Length = 240

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 38/236 (16%), Positives = 75/236 (31%), Gaps = 17/236 (7%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
               D   +    +       ++ A ++ +G  +            +    +   +P   
Sbjct: 3   LRWQDAYHQFNTAENEQQLFHQVSAYSKRLGFEYCCYGIRVPQPGSQPLVEIFDTYPPGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI--------TPPAGMDNRYCSLTFDVA 138
           +         +    ++        +     +              GM       +   A
Sbjct: 63  MAHYQARNYIEIDPTVRDGAASPNMIIWPDADAAEQPSLWRDARDFGMSVGVAQ-SSWAA 121

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQAN-------MFKSYDVHWGKDFELTGREV 191
           R   GL+ +  +   +    +  + L A + AN        F    +       LT RE 
Sbjct: 122 RGVFGLLTIARRSDRLTPAEINSLTLQANWLANLSHSLMGRFLVPKLSPAASISLTKRER 181

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGA-IAYAVRNNIV 246
           E L+W SEG+T+ EI   L IS  TV  +I +I+ K     +  A +  A+   ++
Sbjct: 182 EVLSWTSEGRTASEIGEQLNISERTVTFHINNILAKLGAANKVQAVVVKAIGMGLI 237


>gi|311113859|ref|YP_003985081.1| DegU family transcriptional regulator [Rothia dentocariosa ATCC
           17931]
 gi|310945353|gb|ADP41647.1| transcriptional regulatory protein DegU [Rothia dentocariosa ATCC
           17931]
          Length = 241

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 29/255 (11%), Positives = 70/255 (27%), Gaps = 31/255 (12%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVR 65
           +Q+ ++L  + +     +  L      L  ++  D   +       + E           
Sbjct: 3   EQITVMLVDDQQLVRGGLKMLINSQPDLQVVLEADDGAAAVDSYARMAEE---------- 52

Query: 66  WDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
               Q   +D  +      +  + +           +     +    F            
Sbjct: 53  GTAPQVVLMDVRMPIMDGLEAAKSILELN-------VPDSRVIMLTTFDVDEYVYAAVRA 105

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF- 184
             + +         +   +  +     +I       +         +    D        
Sbjct: 106 GASGFLLKDAPPEELLGAIRTIHRGDAVIAPSATRRLLEHMIPVLEVHSEQDSASVAPTP 165

Query: 185 -------------ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATK 231
                         L+ RE E L  I++G ++ EI+  L +S  T+  +++ ++ K   +
Sbjct: 166 QEEPQLLHQELMQTLSPREHEVLRLIAQGLSNVEISRALVLSEATIKTHVSHVLSKLDAR 225

Query: 232 TRSGAIAYAVRNNIV 246
            R  A+  A    IV
Sbjct: 226 DRVQAVIMAYEAGIV 240


>gi|294102849|ref|YP_003554707.1| two component transcriptional regulator, LuxR family
           [Aminobacterium colombiense DSM 12261]
 gi|293617829|gb|ADE57983.1| two component transcriptional regulator, LuxR family
           [Aminobacterium colombiense DSM 12261]
          Length = 223

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 34/243 (13%), Positives = 72/243 (29%), Gaps = 25/243 (10%)

Query: 3   FEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFL 62
             +++V I+L  + +     +  L    + +  +   D                G     
Sbjct: 2   KSMKKVRILLADDHQILRDGLRTLLNTQEDMEVIAEADT---------------GRKAID 46

Query: 63  LVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITP 122
           L          +D ++      +    +           L     L   +          
Sbjct: 47  LALCHCPDVLVMDVVMPELNGIEATSRLKKD--------LPEIKVLALSMHADRRFVAEM 98

Query: 123 PAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGK 182
                + +         +   +  +      +         ++  Y   +      H   
Sbjct: 99  LKAGASGFLLKECAFQELAEAIRSIIKGKMYLSPSISK--CVIEEYVGFLSGDEKEHTDS 156

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +  L+ RE E L  I+EGK + +IA  L IS  TV  +  +IMRK    + +    YA++
Sbjct: 157 ESALSHREKEVLQLIAEGKANRDIAKTLHISVKTVETHKYNIMRKINLHSVAELTKYAIK 216

Query: 243 NNI 245
           + +
Sbjct: 217 SGL 219


>gi|282865219|ref|ZP_06274272.1| two component transcriptional regulator, LuxR family [Streptomyces
           sp. ACTE]
 gi|282560142|gb|EFB65691.1| two component transcriptional regulator, LuxR family [Streptomyces
           sp. ACTE]
          Length = 250

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 32/241 (13%), Positives = 76/241 (31%), Gaps = 25/241 (10%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVR 65
           + + +++  +       +  +  + + +  +                    GA       
Sbjct: 32  EPIRVLVVDDHALFRRGLEIVLAQEEDIQVVGEAGD---------------GAEAVDKAA 76

Query: 66  WDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
             L     +D  +      +    +          V      +   +     +       
Sbjct: 77  DLLPDIVLMDVRMPKRGGIEACTSIKE--------VAPSAKIIMLTISDEEADLYEAIKA 128

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE 185
               Y         +   +  +      I      ++  L  +++ + ++ +        
Sbjct: 129 GATGYLLKEISTDEVSTAIRAVADGQSQISPSMASKL--LTEFKSMIQRTDERRLVPAPR 186

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I
Sbjct: 187 LTERELEVLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKI 246

Query: 246 V 246
           +
Sbjct: 247 L 247


>gi|320010465|gb|ADW05315.1| two component transcriptional regulator, LuxR family [Streptomyces
           flavogriseus ATCC 33331]
          Length = 250

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 32/241 (13%), Positives = 76/241 (31%), Gaps = 25/241 (10%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVR 65
           + + +++  +       +  +  + + +  +                    GA       
Sbjct: 32  EPIRVLVVDDHALFRRGLEIVLAQEEDIQVVGEAGD---------------GAEAVDKAA 76

Query: 66  WDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
             L     +D  +      +    +          V      +   +     +       
Sbjct: 77  DLLPDIVLMDVRMPKRGGIEACTSIKE--------VAPSAKIIMLTISDEEADLYEAIKA 128

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE 185
               Y         +   +  +      I      ++  L  +++ + ++ +        
Sbjct: 129 GATGYLLKEISTDEVATAIRAVADGQSQISPSMASKL--LTEFKSMIQRTDERRLVPAPR 186

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I
Sbjct: 187 LTERELEVLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKI 246

Query: 246 V 246
           +
Sbjct: 247 L 247


>gi|229105997|ref|ZP_04236618.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock3-28]
 gi|228677392|gb|EEL31648.1| Two component transcriptional regulator, LuxR [Bacillus cereus
           Rock3-28]
          Length = 215

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 41/221 (18%), Positives = 80/221 (36%), Gaps = 10/221 (4%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFD 85
           +    D    +  L   +S    +  + E       L+       E   D ++   +  +
Sbjct: 5   VLLVDDHTVVLKGLAFFLSTQEDLELVGEANNGKEALV----KVGETNPDVVLMDLYMPE 60

Query: 86  LVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLM 145
           +    A +   K Y  ++    +    F      +       + Y     +  ++   + 
Sbjct: 61  MDGVEATACIKKEYPDVK---VIVLTSFSDQAHVLPALRSGASGYILKDVEPDQLVEAIR 117

Query: 146 LLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDE 205
             +     +  D    +      Q    + + VH      LT RE E L  +++G ++ E
Sbjct: 118 SAYKGNIQLHPDIASTLISQTLPQEERAEEHFVHVD---VLTARENEVLQLLAKGMSNKE 174

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           IA +L I+  TV  +++SI+ K     R+ A  YAV+N IV
Sbjct: 175 IASVLVITEKTVKAHVSSILSKLNLSDRTQAALYAVKNGIV 215


>gi|238895474|ref|YP_002920209.1| DNA-binding transcriptional activator SdiA [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262043448|ref|ZP_06016571.1| regulatory protein SdiA [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330001006|ref|ZP_08303866.1| regulatory protein SdiA [Klebsiella sp. MS 92-3]
 gi|238547791|dbj|BAH64142.1| LuxR/UhpA-family transcriptional activator for cell division
           [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|259039190|gb|EEW40338.1| regulatory protein SdiA [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328537810|gb|EGF64005.1| regulatory protein SdiA [Klebsiella sp. MS 92-3]
          Length = 240

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 39/231 (16%), Positives = 74/231 (32%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R D+L +   +         +   TE +   ++ L         +      S +P   + 
Sbjct: 10  RRDMLHQFQSMATGEEVYNLLQRETEALEYDYYTLCVRHPVPFTRPRVTFQSTYPRAWMS 69

Query: 89  CMALSEKDKYYNVLQR--PTELFCPVFHTLPENI------TPPAGMDNRYCSLTFDVARI 140
                       VL+         P   +L  +           G+              
Sbjct: 70  HYQAENYFAIDPVLRPENFMRGHLPWNDSLFRDAPALWDGARDHGLQKGVTQCLTLPNHA 129

Query: 141 RIGLMLLF-----PKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLT 195
           +  L +               +         +    +    ++    + + + RE+E L 
Sbjct: 130 QGFLSVSANNRLPGGYPEDELELRLRTLTELSLLTLLRLEDEMVMPPEMKFSRRELEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS E+A+IL IS NTVN +  ++ RK     ++    YAV   ++
Sbjct: 190 WTAEGKTSAEVAMILSISENTVNFHQKNMQRKFNAPNKTQIACYAVATGLI 240


>gi|323699571|ref|ZP_08111483.1| two component transcriptional regulator, LuxR family [Desulfovibrio
           sp. ND132]
 gi|323459503|gb|EGB15368.1| two component transcriptional regulator, LuxR family [Desulfovibrio
           desulfuricans ND132]
          Length = 226

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 35/237 (14%), Positives = 68/237 (28%), Gaps = 25/237 (10%)

Query: 10  IVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLF 69
           I++  +       +  + +R    A                      G     L R    
Sbjct: 8   IMIVDDHPLFREGLKTIVSRDANFAVCAEAGT---------------GQEGVNLARTHKP 52

Query: 70  QEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNR 129
               +D  +       ++R +           L     +   +       +         
Sbjct: 53  DIVLVDISMPDKSGIQMIRELKDE--------LPLTRFVIISMHSEADYIVEAFRAGATG 104

Query: 130 YCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGR 189
           Y        ++  GL  +      +      E+  +           D        LT R
Sbjct: 105 YIIKESAAGQLLKGLNTVAGGNLFLDSALSQEV--VFKLLQTKTGEADGQDDPYATLTPR 162

Query: 190 EVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E E +  ++EG T+  +A  L IS  TV N+  ++M+K   K+    + YA R  ++
Sbjct: 163 EQEVMRMLAEGLTAKAVAEQLFISPKTVENHRTNLMKKLGLKSSVELVRYAARLGLI 219


>gi|315649841|ref|ZP_07902924.1| two component transcriptional regulator, LuxR family protein
           [Paenibacillus vortex V453]
 gi|315274815|gb|EFU38196.1| two component transcriptional regulator, LuxR family protein
           [Paenibacillus vortex V453]
          Length = 240

 Score =  135 bits (339), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 31/258 (12%), Positives = 72/258 (27%), Gaps = 35/258 (13%)

Query: 1   MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASH 60
           M  E   + ++L  + +     +  +    D +  +      +        +        
Sbjct: 4   MEKENAIIKVLLADDHQLFREGLKRILNMEDDIDVIGECGDGIQVLEFCNEV-------- 55

Query: 61  FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI 120
                        +D  + ++        +          +      +   +        
Sbjct: 56  -------KPDIVLMDINMPTENGVQATEKLRE--------MFPEIKVIILSIHDDESYVF 100

Query: 121 TPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQ----------- 169
                  N Y     +   +   +  +      I      ++                  
Sbjct: 101 ETLRKGANGYLLKDMEAESLINAIRSVHEGYAFIHPKVTGKLIQQLRRMTYVNEAGAMAE 160

Query: 170 -ANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKT 228
                       G++  LT RE E L  ++EGK++  I   L IS  TV N+++SI++K 
Sbjct: 161 SGTREAGVKFVAGENNPLTRREAEVLRLMAEGKSNKMIGEYLFISEKTVKNHVSSILQKM 220

Query: 229 ATKTRSGAIAYAVRNNIV 246
               R+ A+  +++   V
Sbjct: 221 EVDDRTQAVINSIKYGWV 238


>gi|16080361|ref|NP_391188.1| two-component response regulator YvqE responding to cell wall
           stress [Bacillus subtilis subsp. subtilis str. 168]
 gi|221311254|ref|ZP_03593101.1| hypothetical protein Bsubs1_17956 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221315581|ref|ZP_03597386.1| hypothetical protein BsubsN3_17872 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221320496|ref|ZP_03601790.1| hypothetical protein BsubsJ_17835 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221324780|ref|ZP_03606074.1| hypothetical protein BsubsS_17986 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321312856|ref|YP_004205143.1| two-component response regulator YvqE [Bacillus subtilis BSn5]
 gi|68051995|sp|O32197|LIAR_BACSU RecName: Full=Transcriptional regulatory protein liaR
 gi|2635805|emb|CAB15298.1| two-component response regulator [YvqE] responding to cell wall
           stress [Bacillus subtilis subsp. subtilis str. 168]
 gi|2832821|emb|CAA11745.1| YvqC protein [Bacillus subtilis]
 gi|320019130|gb|ADV94116.1| two-component response regulator [YvqE] responding to cell wall
           stress [Bacillus subtilis BSn5]
          Length = 211

 Score =  135 bits (339), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 38/239 (15%), Positives = 70/239 (29%), Gaps = 30/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  + E     ++        +  +                    G+    L    
Sbjct: 2   IRVLLIDDHEMVRMGLAAFLEAQPDIEVIGEASD---------------GSEGVRLAVEL 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++      +  + +                 +    F    +         
Sbjct: 47  SPDVILMDLVMEGMDGIEATKQICREL---SDP-----KIIVLTSFIDDDKVYPVIEAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y   T   A I   +         +           A    +  +    +      LT
Sbjct: 99  LSYLLKTSKAAEIADAIRAASKGEPKLESKV-------AGKVLSRLRHSGENALPHESLT 151

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE+E L  I+EGKT+ EI   L I+  TV  +I +I+ K     R+ A  YA RN++V
Sbjct: 152 KRELEILCLIAEGKTNKEIGEELFITIKTVKTHITNILSKLDVSDRTQAAVYAHRNHLV 210


>gi|229552512|ref|ZP_04441237.1| LuxR family response regulator [Lactobacillus rhamnosus LMS2-1]
 gi|229314064|gb|EEN80037.1| LuxR family response regulator [Lactobacillus rhamnosus LMS2-1]
          Length = 233

 Score =  135 bits (339), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 36/230 (15%), Positives = 77/230 (33%), Gaps = 19/230 (8%)

Query: 18  QRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDS 76
           QR   +  +    D     + L   +     +  + +   G     +   D      +D 
Sbjct: 8   QRMLRMIKVLIVDDHEMVRLGLSTYIGVQPDLEVVDQAENGQEGVEMALKDRPDIILMDL 67

Query: 77  IVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFD 136
           ++      +  + +  +          +   +    F    +           Y   T  
Sbjct: 68  VMPVKDGIEATKEILKAW--------PQARIIILTSFIDDAKVYPAMEAGAASYILKTAT 119

Query: 137 VARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTW 196
              I   +       R++      ++              +    +  ELT RE E L  
Sbjct: 120 AEEIAKAIRQTASGERVLEPQVTTKM----------MNRMNHPQPQYDELTNREREVLQL 169

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           I++GK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA+++ +V
Sbjct: 170 IAQGKSNQEIATELFITLKTVKTHVSNILAKLDVEDRTQAAIYALKHGLV 219


>gi|16760896|ref|NP_456513.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|29141412|ref|NP_804754.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|213053513|ref|ZP_03346391.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
 gi|213426356|ref|ZP_03359106.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213616131|ref|ZP_03371957.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-2068]
 gi|213650336|ref|ZP_03380389.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|289824072|ref|ZP_06543670.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
 gi|25302436|pir||AH0749 cell-division regulatory protein STY2158 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16503193|emb|CAD05699.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29137039|gb|AAO68603.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 240

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 72/231 (31%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   +         +   T+ +   ++ L         +    + + +P   V 
Sbjct: 10  RRAMLLRFQEMAAAEDVYTELQYQTQRLEFDYYALCVRHPVPFTRPKISLRTTYPQAWVT 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLP--------ENITPPAGMDNRYCSLTFDVARI 140
                       VL+        +              +     G+            R 
Sbjct: 70  HYQSENYFAIDPVLKPENFRQGHLHWDDVLFHEAQAMWDAAQRFGLRRGVTQCVMLPNRA 129

Query: 141 RIGLMLLFPKGRIIL---RDRLWEIGLLAAYQANMF--KSYDVHWGKDFELTGREVECLT 195
              L       R       +    + LLA    +       D+    +   + RE E L 
Sbjct: 130 LGFLSFSRSSLRCSSFTYDEVELRLQLLARESLSALTRLEDDMVMAPEMRFSKREKEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|332799645|ref|YP_004461144.1| LuxR family two component transcriptional regulator
           [Tepidanaerobacter sp. Re1]
 gi|332697380|gb|AEE91837.1| two component transcriptional regulator, LuxR family
           [Tepidanaerobacter sp. Re1]
          Length = 215

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 34/242 (14%), Positives = 81/242 (33%), Gaps = 27/242 (11%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           ++++ +VL  +       +  +    + +  +      +    ++               
Sbjct: 1   MEKITVVLADDHVLMRKGLRKILEMEEDIEVIDEASDGIEAIEKVME------------- 47

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                Q   LD  +      ++ + +          ++         ++      +    
Sbjct: 48  --KKPQVLLLDINMPKLNGIEVTKSLREKNV--DSQIV------ILTIYDDREYLLELLK 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
              + Y     +   +   +         I  +    +      + N       +     
Sbjct: 98  LGISGYVLKDIEPQGLIEAVRSASRGETYIQPNLTRAL----VAEYNRLTQPVSNNDVRK 153

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            LT RE E L  I++G ++ EI++ LGIS  TV N+++SI+RK     R+ A  +A++N 
Sbjct: 154 NLTAREKEVLADIAKGMSNREISIDLGISEKTVKNHVSSILRKLNLMDRTQAAVFAIKNR 213

Query: 245 IV 246
           +V
Sbjct: 214 LV 215


>gi|291301939|ref|YP_003513217.1| LuxR family two component transcriptional regulator [Stackebrandtia
           nassauensis DSM 44728]
 gi|290571159|gb|ADD44124.1| two component transcriptional regulator, LuxR family
           [Stackebrandtia nassauensis DSM 44728]
          Length = 224

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 30/235 (12%), Positives = 69/235 (29%), Gaps = 15/235 (6%)

Query: 12  LNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQE 71
           ++ +   +   V   P        ++  +  +             G     L R  L   
Sbjct: 1   MSTDKPIKVLLVDDQPLLRTGFRMVLGAEADIDIIAEAGD-----GVEAVDLARRLLPDV 55

Query: 72  QKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYC 131
             +D  +         + +  ++             L    F      +         + 
Sbjct: 56  VLMDIRMPRMDGVAATKAIVEAKLP--------VRVLILTTFDLDEYVVGALRAGAAGFL 107

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREV 191
           +       +   +  +     ++    L  +  L  +   + +           LT RE 
Sbjct: 108 AKDVPAEDLVAAIRSVSSGEAVVAPRILRRL--LEKFVDRLPEPDGATPASLEVLTERER 165

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L  +++G ++ EIA  L +S  TV  ++  ++ K   + R  A+  A    +V
Sbjct: 166 EVLILVAKGMSNTEIAKELTVSETTVKTHVGHVLTKLGVRDRVQAVVLAYETGLV 220


>gi|56413135|ref|YP_150210.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197362061|ref|YP_002141698.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|56127392|gb|AAV76898.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197093538|emb|CAR59000.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 240

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 72/231 (31%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   +         +   T+ +   ++ L         +    + + +P   V 
Sbjct: 10  RRAMLLRFQEMAAAEDVYTELQYQTQRLEFDYYALCVRHPVPFTRPKISLRTTYPQAWVT 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLP--------ENITPPAGMDNRYCSLTFDVARI 140
                       VL+        +              +     G+            R 
Sbjct: 70  HYQSENYFAIDPVLKPENFRQGHLHWDDVLFHEAQAMWDAAQRFGLRRGVTQCVMLPNRA 129

Query: 141 RIGLMLLFPKGRIIL---RDRLWEIGLLAAYQANMFK--SYDVHWGKDFELTGREVECLT 195
              L       R       +    + LLA    +       D+    +   + RE E L 
Sbjct: 130 LGFLSFSRSSLRCSSFTYDEVELRLQLLARESLSALTRFEDDMVMAPEMRFSKREKEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|284801354|ref|YP_003413219.1| hypothetical protein LM5578_1104 [Listeria monocytogenes 08-5578]
 gi|284994496|ref|YP_003416264.1| hypothetical protein LM5923_1058 [Listeria monocytogenes 08-5923]
 gi|284056916|gb|ADB67857.1| hypothetical protein LM5578_1104 [Listeria monocytogenes 08-5578]
 gi|284059963|gb|ADB70902.1| hypothetical protein LM5923_1058 [Listeria monocytogenes 08-5923]
          Length = 212

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 80/239 (33%), Gaps = 31/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  + E     VS   +  D +  +   +                G     +    
Sbjct: 2   IKVLLVDDHEMVRIGVSAYLSVQDDMEVVGEAEN---------------GREGADMALEL 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++      +  + +  +         +    +    F    +         
Sbjct: 47  RPDIILMDLVMDEMDGIEATKEIMQNW--------KEAKIIIVTSFIDDEKVYPALEAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + Y   T   + I   +   +    ++  +   ++            +         +LT
Sbjct: 99  SSYMLKTSTASEIADAIRATYGGDSVLEPEVTGKMMQRL--------TAKPEKNLHDDLT 150

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA ++++V
Sbjct: 151 NRENEILLLIAEGKSNQEIADELFITLKTVKTHVSNILSKLGVQDRTQAAIYAFKHDLV 209


>gi|296269819|ref|YP_003652451.1| LuxR family two component transcriptional regulator [Thermobispora
           bispora DSM 43833]
 gi|296092606|gb|ADG88558.1| two component transcriptional regulator, LuxR family [Thermobispora
           bispora DSM 43833]
          Length = 226

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 33/223 (14%), Positives = 68/223 (30%), Gaps = 7/223 (3%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D           +     +  + E   GA+     R  L     +D  +     
Sbjct: 4   RVLLADDQPLLRTGFRLILEAEQDITVVGEAGDGATALEQARALLPDVVLMDIRMPGVDG 63

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
            +  R +   +K  +         L    F      +       + +         +   
Sbjct: 64  IEATRRIVREQKGGHVP-----RVLVLTTFDLDEYIVEALRAGASGFLLKDVPPDELVQA 118

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           + ++     I+       +    A               +  LT RE+E L  I++G ++
Sbjct: 119 IRVVAAGDAIVAPSVTRRLLDKFAALLPPADRQPTPALLE-RLTERELEVLRLIAKGMSN 177

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            EIA  L +S  TV  ++ +++ K   + R  A+  A    +V
Sbjct: 178 AEIAAELVVSETTVKTHVGNVLTKLGLRDRVQAVVLAYETGLV 220


>gi|319441505|ref|ZP_07990661.1| LuxR family two component transcriptional regulator
           [Corynebacterium variabile DSM 44702]
          Length = 232

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 27/248 (10%), Positives = 68/248 (27%), Gaps = 30/248 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           +++++  +       V+ + +    +  +           R+ +L               
Sbjct: 2   ISVLVVDDQALIRQAVADIISTHPDIEVVATAGDGEDAVDRVASL--------------- 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +       ++  +  + +            L    F      ++      
Sbjct: 47  HPDVVLMDVRMP------VLDGIGATGQICADPANASTRVLILTTFEEDEYVVSALRAGA 100

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF--- 184
             +     +   I   +  +     +        +        +         G      
Sbjct: 101 GGFIGKGAEPEDIVRAVQAVHAGDSLFSPAATRSLITRYIDVPDATGQGGASSGGTVSED 160

Query: 185 ------ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIA 238
                  LTGRE E L  + +G ++ EIA    IS +T   ++  IM K     R+  + 
Sbjct: 161 AAKDLARLTGREQEVLLLVGQGLSNQEIAEKFFISPHTAKTHVNRIMSKINAHDRAQLVI 220

Query: 239 YAVRNNIV 246
            A  + ++
Sbjct: 221 LAYESGLL 228


>gi|218548547|ref|YP_002382338.1| DNA-binding transcriptional activator SdiA [Escherichia fergusonii
           ATCC 35469]
 gi|218356088|emb|CAQ88705.1| DNA-binding transcriptional activator [Escherichia fergusonii ATCC
           35469]
          Length = 251

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 44/231 (19%), Positives = 78/231 (33%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L+R   +         +   T+ +   ++ L         +      S +P   V 
Sbjct: 21  RRTMLSRFQEMASAEDVFQELQFQTQKLEFDYYSLCVRHPVPFTRPKVAYYSTYPEAWVS 80

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYC--SLTFDVA 138
                       VL+        +              +     G+        +  + A
Sbjct: 81  YYQQHNFLAIDPVLKPENFSQGHLLWDDALFSEAQPLWDAARAHGLRRGVTQYLMLSNRA 140

Query: 139 RIRIGLMLLFPKGRIILRDRLW-EIGLLAAYQANMFKSY--DVHWGKDFELTGREVECLT 195
              + L  +  +   I  D L  ++ LL     N+      ++        + RE E L 
Sbjct: 141 LGFLSLSRMSAREGPIAHDELELKLQLLVRESLNVLARLQHEMVMTPAMRFSKRETEILR 200

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    I+
Sbjct: 201 WTAEGKTSAEIAMILSISENTVNFHQKNMQKKFNAPNKTQVACYAAATGII 251


>gi|297200099|ref|ZP_06917496.1| two-component system response regulator [Streptomyces sviceus ATCC
           29083]
 gi|297147573|gb|EDY61231.2| two-component system response regulator [Streptomyces sviceus ATCC
           29083]
          Length = 269

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 37/233 (15%), Positives = 76/233 (32%), Gaps = 15/233 (6%)

Query: 14  REDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQK 73
           R++  R   V         L  ++  +  +          E V  +  LL          
Sbjct: 49  RKEPIRVLVVDDHALFRRGLEIVLAAEEDIQVVGEAGDGAEAVDKAADLL-----PDIVL 103

Query: 74  LDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSL 133
           +D  +      +    +          V      +   +     +           Y   
Sbjct: 104 MDVRMPKRGGIEACTSIKE--------VAPSAKIIMLTISDEEADLYDAIKAGATGYLLK 155

Query: 134 TFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVEC 193
                 +   +  +      I      ++  L  +++ + ++ +        LT RE+E 
Sbjct: 156 EISTDEVATAIRAVADGQSQISPSMASKL--LTEFKSMIQRTDERRLVPAPRLTDRELEV 213

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I+
Sbjct: 214 LKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKIL 266


>gi|227821018|ref|YP_002824988.1| putative LuxR/GerE family transcriptional regulator [Sinorhizobium
           fredii NGR234]
 gi|227340017|gb|ACP24235.1| putative LuxR/GerE family transcriptional regulator [Sinorhizobium
           fredii NGR234]
          Length = 246

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 42/222 (18%), Positives = 79/222 (35%), Gaps = 17/222 (7%)

Query: 41  CTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDS-IVSSDWPFDLVRCMALSEKDKYY 99
                   +  +++  G   F+++         L +  + + WP + +R    +   +  
Sbjct: 25  NEDDVKRVLDQISDAFGFRGFMVLAIPDSGCHSLAAQALLTSWPMEFLRRYDSAGLIEGS 84

Query: 100 NVLQRPTELFCPVFHTLPENITP--------------PAGMDNRYCSLTFDVARIRIGLM 145
            V+QR      P  +                       AGM         D    R  + 
Sbjct: 85  PVIQRLRRSTIPFTYDAHLLARRRVDGKGEAAISVFEAAGMPRGLYLPVHDAKGGRAAIA 144

Query: 146 LLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-LTGREVECLTWISEGKTSD 204
                  ++  D +  +   A    +       H  +    L+ RE+ECL W + GKT+ 
Sbjct: 145 F-GGDREVVSSDEMQALNFWAGLLYSRLSEVRTHDRRRPGSLSRREIECLRWAAAGKTTV 203

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E+A I+ +S  TVN+Y+    RK  +  R   +A A+R  ++
Sbjct: 204 EMARIMALSEYTVNHYLNRATRKLDSVNRVQTVAKAMRAGLI 245


>gi|325914881|ref|ZP_08177216.1| response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Xanthomonas vesicatoria ATCC
           35937]
 gi|325538972|gb|EGD10633.1| response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Xanthomonas vesicatoria ATCC
           35937]
          Length = 213

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 29/239 (12%), Positives = 75/239 (31%), Gaps = 27/239 (11%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + + L  +       +  L    + +  +           ++  +               
Sbjct: 2   IRVCLVDDQTLVRQGIRSLLALDNGIEVVAEASDGKQAVEQIPQI--------------- 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      + ++ ++ +              +    F      +       
Sbjct: 47  QPDVVLMDMRMPVMSGLEALQMLSRNGTLP--------PTIILTTFDDDQLVLAGLKAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y      + ++   +  +   G ++       +     +  N F S      +   LT
Sbjct: 99  KGYLLKDVSLEQLVGAIRTVADGGSLVQPAVTQRLLSGLEHMRNEFVSL----DRPDPLT 154

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  ++ G ++ EIA  LG++  T+ N++++I+ K   + R+ A+  A    +V
Sbjct: 155 DRETEILRLMASGFSNKEIANSLGVAEGTIKNHVSNILSKLGVRDRTRAVLKAFELQLV 213


>gi|258510526|ref|YP_003183960.1| two component transcriptional regulator, LuxR family
           [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
 gi|257477252|gb|ACV57571.1| two component transcriptional regulator, LuxR family
           [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
          Length = 231

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 42/239 (17%), Positives = 77/239 (32%), Gaps = 28/239 (11%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + +++  + E     V  +   +  +  +               L               
Sbjct: 10  IKVLVVDDHELFRRGVVTVLRSTPGIYVVGEAGNGREAIECFQTL--------------- 54

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 LD  +      +  R M  +  +           L   V  T            
Sbjct: 55  QPDVTLLDIHMPVCNGLETARKMREANPN--------TKILMLTVSETEEMLFEAVKSGA 106

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKD-FEL 186
           + Y   +    R+   +  ++    ++       + +    + +      +   +   EL
Sbjct: 107 SGYVLKSVSPERLIECVRQVYEGEPVVPSS----LAMKMIAEFSRTAETRMPSSESVTEL 162

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           T RE E L ++S G ++ EIA  L IS NTV N++  I+ K     R+ A AYAVRN I
Sbjct: 163 TEREREVLQYLSAGASNKEIARALFISENTVRNHVRHILDKLHLSNRAQAAAYAVRNGI 221


>gi|186682728|ref|YP_001865924.1| LuxR family transcriptional regulator [Nostoc punctiforme PCC
           73102]
 gi|186465180|gb|ACC80981.1| two component transcriptional regulator, LuxR family [Nostoc
           punctiforme PCC 73102]
          Length = 221

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 34/216 (15%), Positives = 62/216 (28%), Gaps = 11/216 (5%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D       L   +     +  + E   G     LV         LD  +      
Sbjct: 5   VLLVDDQGLIRQGLRALLELESDLEIVGEAENGEQAINLVAEFQPDVVLLDIRMPIMDGV 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
              + +             +   L    F                Y         + + +
Sbjct: 65  AATKEIQKR--------FSKTKILVLTTFDDDEYVSAALQNGAMGYLLKDTPSEELAVAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
             ++     +    + ++  L  +                ELT RE E L  I+ G ++ 
Sbjct: 117 RAVYKGYTQLGPGIVKKL--LTQFSNGTPIHSTPVPSTLNELTPREKEVLRLIATGASNR 174

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           EIA  L IS  TV N++ +I+     + R+ A  +A
Sbjct: 175 EIAQELYISEGTVKNHVTNILNTLNLRDRTQAAIWA 210


>gi|237731962|ref|ZP_04562443.1| DNA-binding transcriptional activator SdiA [Citrobacter sp. 30_2]
 gi|226907501|gb|EEH93419.1| DNA-binding transcriptional activator SdiA [Citrobacter sp. 30_2]
          Length = 240

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 39/231 (16%), Positives = 75/231 (32%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   +         +   T+++    + L         +  + + + +P   V 
Sbjct: 10  RRSMLLRFQEMATAEDVYTELQQQTQHLEFDFYALCVRHPVPFTRPKTSLHTTYPKAWVA 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVARI 140
                       VL+        +              +     G+            R 
Sbjct: 70  HYQSENYFAIDPVLKPENFSQGHLPWNDTLFRDAQPLWDAARNHGLRKGMTQCLMLPNRA 129

Query: 141 RI--GLMLLFPKGRIILRDRLW-EIGLLAAYQANMF--KSYDVHWGKDFELTGREVECLT 195
                +     +   +  D +   + LL     ++      D+    +   + RE E L 
Sbjct: 130 LGFLSVSRASIRNSRLASDEVELRMQLLVRESLSVLTRLEDDMVMAPEMRFSKREKEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|188584215|ref|YP_001927660.1| LuxR family transcriptional regulator [Methylobacterium populi
           BJ001]
 gi|179347713|gb|ACB83125.1| transcriptional regulator, LuxR family [Methylobacterium populi
           BJ001]
          Length = 243

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 39/233 (16%), Positives = 79/233 (33%), Gaps = 18/233 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD---LFQEQKLDSIVSSDWPFDLV 87
           ++L  +            +      +G  + +        L    + + ++  +   +  
Sbjct: 11  EILKSLDRAHSREDILRAIMPRLNAMGIEYVISAMIPQKRLPARTQKNFVILENTSDEWN 70

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTL-------------PENITPPAGMDNRYCSLT 134
           R         +  ++Q           +                N     G+ + +    
Sbjct: 71  RLYFSKGYMYFDPIVQATLSSTTGFRWSETDPAGLQDPKARQVMNEAVEFGLGDGFTVPL 130

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDV-HWGKDFELTGREVEC 193
             +   R GL     +   I   +   + L+A+Y        D     +   LT RE E 
Sbjct: 131 ATLEEERGGLTFAG-RQLDISPGQRGMLTLIASYVVGQTLLIDNGPSERRMGLTPRERES 189

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W++EGKT  EI  ++GISR+ V+ ++ S   K    +R+ A+A   R  ++
Sbjct: 190 LQWVAEGKTDWEIGELMGISRHGVDFHLRSARVKLGCVSRTQAVAEGFRRGLI 242


>gi|158317584|ref|YP_001510092.1| two component LuxR family transcriptional regulator [Frankia sp.
           EAN1pec]
 gi|158112989|gb|ABW15186.1| two component transcriptional regulator, LuxR family [Frankia sp.
           EAN1pec]
          Length = 237

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 35/243 (14%), Positives = 77/243 (31%), Gaps = 25/243 (10%)

Query: 4   EIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL 63
           E   + +++  +       +  +  +   +  +                    GA    +
Sbjct: 17  EANPIRVLIVDDHALFRRGLEMVLAQEVDIEVVGEAAD---------------GAEAVTM 61

Query: 64  VRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPP 123
                     +D  +      D    +           +     +   +     +     
Sbjct: 62  AAEMAPDIVLMDVRMPRRGGIDATSAIKEK--------VPSAKIVMLTISDEEADLFDAI 113

Query: 124 AGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKD 183
                 Y      +  +   +  ++    +I      ++  L+ + A +    D      
Sbjct: 114 KAGAMGYLLKEISIDEVAADIRAVYNGQSLISPSMASKL--LSEFAAMIKTKDDRPQLPT 171

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             LT RE+E L  +++G  + +IA  L IS NTV N+I +I+ K    +R  A+ YAVR 
Sbjct: 172 PRLTDREMEVLRLVAKGLNNRDIAKQLYISENTVKNHIRNILEKLQLHSRMEAVVYAVRE 231

Query: 244 NIV 246
            ++
Sbjct: 232 KLL 234


>gi|256397512|ref|YP_003119076.1| LuxR family transcriptional regulator [Catenulispora acidiphila DSM
           44928]
 gi|256363738|gb|ACU77235.1| two component transcriptional regulator, LuxR family [Catenulispora
           acidiphila DSM 44928]
          Length = 239

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 34/240 (14%), Positives = 70/240 (29%), Gaps = 25/240 (10%)

Query: 7   QVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRW 66
            + IVL  + E   +    +      +A +            +  L              
Sbjct: 20  PIRIVLVDDQELLRTGFRMVLNSQPDMAVVGEAGDGQVALDLLTRL-------------- 65

Query: 67  DLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGM 126
                  +D  +         R + +          +RP  L    F       T     
Sbjct: 66  -QADVVLMDVRMPRLDGVAATREIVVRG--------ERPRVLMLTTFDLDEYAFTALKAG 116

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFEL 186
            + +         +   +  +     ++       +  L  +   +    +    +   L
Sbjct: 117 ASGFLLKDVPPPDLLAAIRAVHSGEAVVAPSTTRRL--LDKFAPMLPSESEPAPPELTVL 174

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T RE E L  +++G ++ EIA  L +S  TV  ++  I+ K   + R  A+  A    +V
Sbjct: 175 TDREHEVLLLVAQGMSNAEIAGKLFLSEATVKTHVGRILMKLGLRDRVQAVVLAYETGLV 234


>gi|261409652|ref|YP_003245893.1| LuxR family two component transcriptional regulator [Paenibacillus
           sp. Y412MC10]
 gi|329928696|ref|ZP_08282545.1| putative oxygen regulatory protein NreC [Paenibacillus sp. HGF5]
 gi|261286115|gb|ACX68086.1| two component transcriptional regulator, LuxR family [Paenibacillus
           sp. Y412MC10]
 gi|328937477|gb|EGG33895.1| putative oxygen regulatory protein NreC [Paenibacillus sp. HGF5]
          Length = 240

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 29/251 (11%), Positives = 71/251 (28%), Gaps = 35/251 (13%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  + +     +  +    D +  +      +        +               
Sbjct: 11  IKVLLADDHQLFREGLKRILNMEDDIDVIGECGDGIQVLEFCNEV--------------- 55

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  + ++        +          +      +   +               
Sbjct: 56  KPDIVLMDINMPTENGVQATEKLRE--------MFPEIKVIILSIHDDESYVFETLRKGA 107

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQ------------ANMFKS 175
           N Y     +   +   +  +      I      ++                    +    
Sbjct: 108 NGYLLKDMEAESLINAIRSVHEGYAFIHPKVTGKLIHQLRRMTYVNEAGAMAESGSREAG 167

Query: 176 YDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSG 235
                G++  LT RE E L  ++EGK++  I   L IS  TV N+++SI++K     R+ 
Sbjct: 168 VKFVAGENNPLTRREAEVLRLMAEGKSNKMIGEYLFISEKTVKNHVSSILQKMEVDDRTQ 227

Query: 236 AIAYAVRNNIV 246
           A+  +++   V
Sbjct: 228 AVINSIKYGWV 238


>gi|254387129|ref|ZP_05002401.1| two-component system response regulator [Streptomyces sp. Mg1]
 gi|194345946|gb|EDX26912.1| two-component system response regulator [Streptomyces sp. Mg1]
          Length = 243

 Score =  134 bits (338), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 32/241 (13%), Positives = 76/241 (31%), Gaps = 25/241 (10%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVR 65
           + + +++  +       +  +  + + +  +                    GA       
Sbjct: 25  EPIRVLVVDDHALFRRGLEIVLAQEEDIQVVGEAGD---------------GAEAVDKAA 69

Query: 66  WDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
             L     +D  +      +    +          V      +   +     +       
Sbjct: 70  DLLPDIVLMDVRMPRRGGIEACTSIKE--------VAPSAKIIMLTISDEEADLYDAIKA 121

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE 185
               Y         +   +  +      I      ++  L  +++ + ++ +        
Sbjct: 122 GATGYLLKEISTDEVATAIRAVADGQSQISPSMASKL--LTEFKSMIQRTDERRLVPAPR 179

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I
Sbjct: 180 LTDRELEVLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKI 239

Query: 246 V 246
           +
Sbjct: 240 L 240


>gi|299069138|emb|CBJ40391.1| transcriptional activator of quorum sensing autoinducer synthesis
           transcription regulator protein (LuxR family) [Ralstonia
           solanacearum CMR15]
          Length = 238

 Score =  134 bits (338), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 37/220 (16%), Positives = 76/220 (34%), Gaps = 14/220 (6%)

Query: 41  CTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYN 100
            T      + A    +G  H            +   ++ +++P         +       
Sbjct: 18  STSDVFEHIEAAALALGFEHVAYGFKAPLPLSEPKVVLLNNYPQAWRVRYLEAGYLHVDP 77

Query: 101 VLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGR 152
            + +      P+  +           +     G+   +   + D   +   L L      
Sbjct: 78  SVAQACRSQAPIVWSDRLFQDVPALWDEAKAHGLRVGWAQSSLDSLGVGGMLSLSRSCEP 137

Query: 153 IILRDRL---WEIGLLAAYQA---NMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEI 206
           +  R+       +  LA       +     DV    D  LT REVE + W ++GK++ +I
Sbjct: 138 LSARELAENTRRMQWLAHMAHVALSRLLRADVAGYVDDSLTNREVEVMKWTADGKSAQDI 197

Query: 207 AVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           A IL IS+NTV+ ++ + ++K     ++ A+  A     +
Sbjct: 198 ADILAISKNTVDFHVKNAVKKLQAVNKTAAVVRAAMLGYL 237


>gi|15964581|ref|NP_384934.1| putative transcription regulator protein [Sinorhizobium meliloti
           1021]
 gi|307309327|ref|ZP_07588990.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
 gi|307320063|ref|ZP_07599484.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|15073759|emb|CAC45400.1| Putative transcriptional regulator [Sinorhizobium meliloti 1021]
 gi|306894278|gb|EFN25043.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           AK83]
 gi|306900196|gb|EFN30814.1| transcriptional regulator, LuxR family [Sinorhizobium meliloti
           BL225C]
          Length = 246

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 47/236 (19%), Positives = 81/236 (34%), Gaps = 17/236 (7%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDS-IVSSDWPFD 85
               D  A    +D        +  ++E  G   F+++         L +  + + WP D
Sbjct: 11  LVLPDGHAISGAIDSEDDVRRALGRVSEGFGFRGFMVLAIPESGSHSLTAQALMTTWPMD 70

Query: 86  LVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPP--------------AGMDNRYC 131
            +R    +       V+QR      P  +                       A M     
Sbjct: 71  FLRRYDSARLIDGSPVIQRLRRSTIPFTYDAHLLARGRVDGKGEAAICVFEQANMPRGVY 130

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE-LTGRE 190
               D A  R  +         +  D +  + L A    +          +    L+ RE
Sbjct: 131 LPVHDAAGHRAAIAF-GGDRSAVSDDEMQALNLWAGLLYSRLSEVRTRDRRGPGSLSRRE 189

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +ECL W + GKT+ E+A I+ +S  TVN+Y+    RK  +  R   +A A+R  ++
Sbjct: 190 IECLRWAAAGKTTVEMARIMALSEYTVNHYLNRATRKLDSVNRVQTVAKAIRAGLI 245


>gi|163848766|ref|YP_001636810.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222526715|ref|YP_002571186.1| LuxR family two component transcriptional regulator [Chloroflexus
           sp. Y-400-fl]
 gi|163670055|gb|ABY36421.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222450594|gb|ACM54860.1| two component transcriptional regulator, LuxR family [Chloroflexus
           sp. Y-400-fl]
          Length = 218

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 35/242 (14%), Positives = 75/242 (30%), Gaps = 30/242 (12%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           ++Q+ ++L  +       +         +  +                    GA    L 
Sbjct: 1   MEQITVLLIDDHRVVRQGLRDFLELQPDIEVVGEAGS---------------GAEGVELA 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
           R  L     +D ++      +  R +          V      +    F    +      
Sbjct: 46  RELLPDVVLMDLVMPGIDGVETTRRLKA--------VSPSSQVIVLTSFADDDKVFPAIK 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
                Y         +   +        ++  D   ++          F +   +     
Sbjct: 98  AGAISYLLKDISPEDLAHAIRAACRGEAVLHPDVAAKL-------MQEFNTPRPNEAPVE 150

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE++ L  +++G ++ EIA  L +S  TV  +I++I+ K     R+    YA+R  
Sbjct: 151 QLTPREMDVLRLVAKGMSNKEIAETLIVSEKTVKTHISNILSKLHLADRTQVAIYALRKR 210

Query: 245 IV 246
           +V
Sbjct: 211 LV 212


>gi|314934012|ref|ZP_07841377.1| DNA-binding response regulator VraR [Staphylococcus caprae C87]
 gi|313654162|gb|EFS17919.1| DNA-binding response regulator VraR [Staphylococcus caprae C87]
          Length = 207

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 37/221 (16%), Positives = 76/221 (34%), Gaps = 17/221 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFD 85
           +    D    +  L+  +S    +  +    G S+       L Q    D ++      +
Sbjct: 4   VVLVDDHHIVLQGLEFLLSTVEDLEVVK---GFSNGKTFLSYLEQHHLPDIVLLDLVMPE 60

Query: 86  LVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLM 145
           +          + Y  ++         +      I+      + Y     +  ++   + 
Sbjct: 61  MNGIEITEVLKRQYPQVKVL---VLTSYVDDEHVISAIDKGADGYEMKDVEPQKLIETIH 117

Query: 146 LLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDE 205
            +    RII  +    I  ++                  +L+ REVE L  + +GKT+ E
Sbjct: 118 KVLNGERIIHPEAKSVIEAVSKKPHF-----------TNKLSKREVEVLREMVKGKTNKE 166

Query: 206 IAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           IA  L +S  T+  +++ I  K     R+ A  YA+ N ++
Sbjct: 167 IAQTLFVSEKTIKTHVSHIFNKLQVTDRTQAAIYAMENKLI 207


>gi|239637871|ref|ZP_04678832.1| DNA-binding response regulator, LuxR family [Staphylococcus warneri
           L37603]
 gi|239596434|gb|EEQ78970.1| DNA-binding response regulator, LuxR family [Staphylococcus warneri
           L37603]
          Length = 207

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 79/224 (35%), Gaps = 17/224 (7%)

Query: 23  VSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDW 82
           ++ +    D       L+  +S    +  +    G +   L    L   ++ D ++    
Sbjct: 1   MNKIILVDDHHIVRQGLEFLLSTVEDIEVV---QGFAEGKLFLEYLENNEQPDIVLLDLV 57

Query: 83  PFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRI 142
             D+          K+Y  ++         +      I+      + Y     +  ++  
Sbjct: 58  MPDMNGIEITEYLKKHYPNIKIL---VLTSYVDDEHVISAIEKGADGYEMKDVEPQKLIE 114

Query: 143 GLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKT 202
            +  +    RII  D        A +  +   S      K   L+ RE E L  + +GKT
Sbjct: 115 TIHNVLNGKRIIHPD--------AKHVIDSMSSKPHFTNK---LSKRETEVLKEMVKGKT 163

Query: 203 SDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + EIA  L +S  T+  +++ I  K     R+ A  YA+ N ++
Sbjct: 164 NKEIANTLFVSEKTIKTHVSHIFSKLQVSDRTQAAIYAMENKLI 207


>gi|226366081|ref|YP_002783864.1| NarL family two-component response regulator [Rhodococcus opacus
           B4]
 gi|226244571|dbj|BAH54919.1| putative NarL family two-component response regulator [Rhodococcus
           opacus B4]
          Length = 222

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 31/223 (13%), Positives = 66/223 (29%), Gaps = 11/223 (4%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D           +     +    +   G     L R  +     +D  +     
Sbjct: 4   RVLVADDQALVRAGFAALLDAQPDITVAGQAENGEQAVSLTRTLIPDVVLMDIRMPVLDG 63

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
            +  R +A          L     +    F                +     + A +   
Sbjct: 64  LEATRRIAT------DPALSGVRVVVLTTFELDEYVFEAMRAGATGFLVKHTEPAELVRA 117

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           + ++     ++      ++      +         H  +  +LT RE E +T I+EG T+
Sbjct: 118 VRVVADGDALLSPSVTRKL----VAEFATHAKRPPHSSRLDDLTDREREVMTLIAEGLTN 173

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            EI   L +S  T   +++ I+ K   + R+  +  A    +V
Sbjct: 174 AEIGSRLFLSPATARTHVSRILLKLGARDRTQLVVMAYEWGLV 216


>gi|89097699|ref|ZP_01170587.1| YhcZ [Bacillus sp. NRRL B-14911]
 gi|89087558|gb|EAR66671.1| YhcZ [Bacillus sp. NRRL B-14911]
          Length = 211

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 33/230 (14%), Positives = 67/230 (29%), Gaps = 20/230 (8%)

Query: 17  EQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDS 76
           + R             L   +     +             G                +D 
Sbjct: 2   KVRVLVADDHNVVRRGLIFFLKTQKEIEIAGEAK-----DGLEAVEQTGRLKPDIVLMDL 56

Query: 77  IVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFD 136
            + +    +  R +                 L    F      I       + Y     +
Sbjct: 57  DMPNMNGIEATRMIKQK--------YPETKVLMLTSFSDQDHVIPALEAGASGYQLKDIE 108

Query: 137 VARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTW 196
              +   ++ +      +            ++  +   + D       ELT RE++ L  
Sbjct: 109 PDELVKAIVQVTQGENQLHPKAT-------SHLLSHLSNKDKKKSPIDELTKRELDVLKE 161

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           I++GK++ EIA  L I+  TV  ++++++ K     R+ A   AVR  +V
Sbjct: 162 IAKGKSNKEIAASLFITEKTVKTHVSNLLSKLEISDRTQAALLAVREKLV 211


>gi|307327120|ref|ZP_07606309.1| two component transcriptional regulator, LuxR family [Streptomyces
           violaceusniger Tu 4113]
 gi|306887201|gb|EFN18198.1| two component transcriptional regulator, LuxR family [Streptomyces
           violaceusniger Tu 4113]
          Length = 236

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 27/239 (11%), Positives = 65/239 (27%), Gaps = 27/239 (11%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + +V+  + E   S  S +      +  +            +                  
Sbjct: 3   IRVVVADDQELVRSGFSMILDAQPDIEVIAEAGDGAEAVEAVRR---------------H 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 LD  +      +  R +                 +    F +            
Sbjct: 48  APDVALLDIRMPGMDGIEACRAIGADG---------ACRTVMLTTFDSDEYVYEALHAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +         +   + ++     ++       +           +  D        LT
Sbjct: 99  SGFLLKDVRRDDLVHAVRVVARGDSLLAPSVARRLVEQYTRATARPRRPDPRLD---MLT 155

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  ++ G ++ EIA  L +S +TV  ++ +++ K   + R  A+  A    ++
Sbjct: 156 ARERETLLLLARGLSNAEIAAELVVSDHTVKTHVGNVLAKLGLRDRIQAVICAYETGLI 214


>gi|212638021|ref|YP_002314541.1| NarL family DNA-binding response regulator [Anoxybacillus
           flavithermus WK1]
 gi|212559501|gb|ACJ32556.1| DNA-binding response regulator, NarL family (REC-HTH domains)
           [Anoxybacillus flavithermus WK1]
          Length = 208

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 38/239 (15%), Positives = 77/239 (32%), Gaps = 33/239 (13%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  + E     VS   +    +  +   +                G     L    
Sbjct: 2   IKVLLVDDHEMVRLGVSAYLSAQPDMEVIGEAES---------------GEKGVELALQL 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++      +  + +  +              +    F    +         
Sbjct: 47  RPDMILMDLVMEPMDGIEATKQIISAW--------PEAKIMIVTSFLDDDKVYPAIEAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y   T   + I   +   F    +   +   ++            S         +LT
Sbjct: 99  VSYMLKTSKASEIANAIRATFHGQSVFEPEVTGKM----------MNSMRKPSLPHEQLT 148

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE+E L  I++GKT+ EIA  L IS  TV  ++++I+ K   + R+ A+ YA ++ +V
Sbjct: 149 SREMEVLLLIAQGKTNQEIAEELFISLKTVKVHVSNILAKLDVQDRTQAVIYAFKHGLV 207


>gi|222350143|emb|CAX32456.1| LuxR-type regulator [Rhizobium leguminosarum]
          Length = 251

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 42/243 (17%), Positives = 80/243 (32%), Gaps = 29/243 (11%)

Query: 32  LLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQK-----LDSIVSSDWPFDL 86
           LL  +       +    +  +    G  ++ L+R       +       + ++  WP   
Sbjct: 9   LLVILEECSNPEAVVTELEQILHGCGFEYYGLLRHLPQNPVQQNPESWAAALAGRWPEHW 68

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI----------------TPPAGMDNRY 130
            R  A  +      +++       P                             G+++ Y
Sbjct: 69  PRIYAAKKYALIDPMVRYLGHAQRPFRWREAMAAFHKDAHQRRMEQMMVDAFGHGLEDGY 128

Query: 131 CSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMF-------KSYDVHWGKD 183
                        L L   K   +    +  +  +A               + +     D
Sbjct: 129 IFPIHGRNGTLASLSLAG-KPIELSPVEIALLEAVARKAFWRLLDLKGEAPALETVLPAD 187

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             LT RE+E L +++EG TS EI+ +L IS +TV+ Y+  +  K   K R  A+A A R+
Sbjct: 188 TPLTRREMEILHYLAEGMTSMEISKMLKISNHTVDWYMNGLQDKLKAKNRQQAVALAFRH 247

Query: 244 NIV 246
            ++
Sbjct: 248 GLI 250


>gi|27468447|ref|NP_765084.1| two-component response regulator-like protein [Staphylococcus
           epidermidis ATCC 12228]
 gi|57867331|ref|YP_188953.1| LuxR family transcriptional regulator [Staphylococcus epidermidis
           RP62A]
 gi|242243070|ref|ZP_04797515.1| response regulator [Staphylococcus epidermidis W23144]
 gi|251811190|ref|ZP_04825663.1| response regulator [Staphylococcus epidermidis BCM-HMP0060]
 gi|282875769|ref|ZP_06284636.1| response regulator receiver domain protein [Staphylococcus
           epidermidis SK135]
 gi|293366174|ref|ZP_06612860.1| DNA-binding response regulator [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|27315994|gb|AAO05128.1|AE016749_74 two-component response regulator-like protein [Staphylococcus
           epidermidis ATCC 12228]
 gi|57637989|gb|AAW54777.1| DNA-binding response regulator, LuxR family [Staphylococcus
           epidermidis RP62A]
 gi|242233528|gb|EES35840.1| response regulator [Staphylococcus epidermidis W23144]
 gi|251805318|gb|EES57975.1| response regulator [Staphylococcus epidermidis BCM-HMP0060]
 gi|281294794|gb|EFA87321.1| response regulator receiver domain protein [Staphylococcus
           epidermidis SK135]
 gi|291319696|gb|EFE60056.1| DNA-binding response regulator [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329724867|gb|EGG61370.1| response regulator receiver domain protein [Staphylococcus
           epidermidis VCU144]
 gi|329734273|gb|EGG70588.1| response regulator receiver domain protein [Staphylococcus
           epidermidis VCU045]
 gi|329737276|gb|EGG73530.1| response regulator receiver domain protein [Staphylococcus
           epidermidis VCU028]
          Length = 207

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 35/238 (14%), Positives = 77/238 (32%), Gaps = 33/238 (13%)

Query: 9   NIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDL 68
            ++L  +       +  L +  D L+ +       ++   +                 + 
Sbjct: 3   KVILVDDHYIVRQGLEFLLSTVDDLSVLKGFKDGATFLSYLK--------------NNER 48

Query: 69  FQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDN 128
                LD ++      ++          + Y  ++         +      I+      +
Sbjct: 49  PDIVLLDLVMPEMNGIEITEI-----LKQQYPEIKVL---VLTSYVDDEHVISAIDKGAD 100

Query: 129 RYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTG 188
            Y     +  ++   +  +    RII                ++ K+         +L+ 
Sbjct: 101 GYEMKDVEPQKLIETIHKVLQGERIIHP-----------QAKSVIKAVSKKPHYTNKLSK 149

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE E L  + +GKT+ EIA  L +S  TV  +++ I  K     R+ A  YA+ N ++
Sbjct: 150 REKEVLKEMVKGKTNKEIARALFVSEKTVKTHVSHIFSKLEVSDRTQAAIYAMENKLI 207


>gi|320191891|gb|EFW66538.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. EC1212]
          Length = 240

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 38/231 (16%), Positives = 70/231 (30%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   ++        +    + +   ++ L         +      +++P   V 
Sbjct: 10  RRTMLLRFQRMETAEEVYHEIELQAQQLEFDYYSLCVRHPVPFTRPKVAFYTNYPEAWVS 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVARI 140
                       VL         +                    G+            R 
Sbjct: 70  YYQAKNFLAIDPVLNPENFSQGHLMWNDDLFNEAQPLWEAARAHGLRRGVTQYLMLPNRA 129

Query: 141 RIGLMLL---FPKGRIILRDRLWEIGLLAAYQANMFKSYDV--HWGKDFELTGREVECLT 195
              L        +  I+  +   ++ LL           +       +   + RE E L 
Sbjct: 130 LGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREKEILR 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|294628486|ref|ZP_06707046.1| LOW QUALITY PROTEIN: two-component system response regulator
           [Streptomyces sp. e14]
 gi|292831819|gb|EFF90168.1| LOW QUALITY PROTEIN: two-component system response regulator
           [Streptomyces sp. e14]
          Length = 231

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 33/221 (14%), Positives = 66/221 (29%), Gaps = 9/221 (4%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D           +     +  + E   G      VR        +D  +     
Sbjct: 4   RVLLVDDQPLLRTGFRMILEAERDLAVVGEAGDGLQALDQVRALQPDVVLMDIRMPRMDG 63

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
            +  R +   E+D           L    F      +       + +         +   
Sbjct: 64  VEATRQITGPERDG------PAKVLVLTTFDLDEYVVEALRAGASGFLLKDAPANELVQA 117

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           + ++     ++       +  L  Y  ++    +        LT REVE L  ++ G ++
Sbjct: 118 IRVVAAGEAMLAPSITRRL--LDKYATHLPSGEEPVPDTLHTLTEREVEVLKLVARGLSN 175

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            EIA  L +S  TV  ++  ++ K   + R  A  YA  + 
Sbjct: 176 AEIAADLFVSETTVKTHVGHVLTKLGLRDRVQAAVYAYESG 216


>gi|288573855|ref|ZP_06392212.1| two component transcriptional regulator, LuxR family
           [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288569596|gb|EFC91153.1| two component transcriptional regulator, LuxR family
           [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 222

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 35/238 (14%), Positives = 74/238 (31%), Gaps = 30/238 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + +++  +     + V +  +  D +  +      +     M  +               
Sbjct: 5   IRVLVVDDHAIFRTGVINTLSLEDDIEVVGEAGDGLEALEFMKKV--------------- 49

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
            F    +D  +      +LV  M  +   +          +         + +       
Sbjct: 50  DFDVALVDVTMPRMGGVELVSKMEETGMARS--------VIALTALEDDRDMVFLSKAGV 101

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             +   T     +   +  +      +           A    N F            L+
Sbjct: 102 KGFVLKTSGFDELISAIRTVSGGDNYVDSRA-------AGKLLNCFSEDTSRERGMSRLS 154

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
            RE+E L W+++G    EIA  L +S  TV N+I+ I+ K     R+ A+A+A R+ +
Sbjct: 155 ERELEVLYWLAQGLNGQEIAERLSLSDKTVKNHISHILAKLKVSDRTQAVAWAWRSGL 212


>gi|212716971|ref|ZP_03325099.1| hypothetical protein BIFCAT_01917 [Bifidobacterium catenulatum DSM
           16992]
 gi|212660256|gb|EEB20831.1| hypothetical protein BIFCAT_01917 [Bifidobacterium catenulatum DSM
           16992]
          Length = 248

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 43/264 (16%), Positives = 82/264 (31%), Gaps = 34/264 (12%)

Query: 1   MNFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASH 60
           M+ E Q++ +V+  + E   +  + +      +A                      GA  
Sbjct: 1   MSKE-QKIRVVIADDQELVRAGFAMVIGSQPDMAVAAQARD---------------GAEA 44

Query: 61  FLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNV----LQRPTELFCPVFHTL 116
             L          +D  +      +  R ++  +     +     + R   +    F   
Sbjct: 45  LALAETLHPDVVLMDVRMPGMDGIEATRQISALQHRFAADGTQSEVARTKVIILTTFDLD 104

Query: 117 PENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSY 176
              +       + +     +   +   +  +F    II       +         M  + 
Sbjct: 105 EYVMAAITAGASGFLLKDTEPETLLNSIRTVFQGNAIIAPSATKRLIEKMMEGDFMAANV 164

Query: 177 DVHWGKDF--------------ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIA 222
             H                   ELT RE E L  I+ G ++ EIA  L IS  TV  ++A
Sbjct: 165 GAHGNSTASSTSDSTYTDPELDELTDREREVLIEIAHGLSNQEIADKLFISLPTVKTHVA 224

Query: 223 SIMRKTATKTRSGAIAYAVRNNIV 246
            I+ K   + R  A+ +A  N++V
Sbjct: 225 HILAKINARDRVQAVVFAYENHLV 248


>gi|163758000|ref|ZP_02165088.1| putative GerE/LuxR family transcriptional regulator [Hoeflea
           phototrophica DFL-43]
 gi|162284289|gb|EDQ34572.1| putative GerE/LuxR family transcriptional regulator [Hoeflea
           phototrophica DFL-43]
          Length = 224

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 84/223 (37%), Positives = 124/223 (55%), Gaps = 3/223 (1%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
             R+  + ++       S       +++Y GA  +L+ R+D + ++  D +++S+WPFDL
Sbjct: 2   IARAAFIQQIEDRTICGSIANGFDLISDYTGAKCYLVARYDHYSDRHHDFVLTSNWPFDL 61

Query: 87  VRCMALSEKDKYYNV--LQRPTELFCPVFHT-LPENITPPAGMDNRYCSLTFDVARIRIG 143
           VR +     D       + R    F P+F       +  P  +  R C + ++V ++R+ 
Sbjct: 62  VRNLGAGLVDAQARTSEVSRCLHAFEPLFQDVDGVAVNLPENLSPRVCLVPYNVGKVRLL 121

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           + LLF K   +  DR+ +  L A+Y A  F           +LT REVECL+WI EGKTS
Sbjct: 122 MALLFEKDAFVSHDRIRDAALAASYHAVHFTEITTTSDSLSDLTDREVECLSWIGEGKTS 181

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           DEIA+I+GISRNTVNNYI SIM KT  KTRS A+A+AVR  I+
Sbjct: 182 DEIALIIGISRNTVNNYITSIMNKTGAKTRSEAVAFAVRQRII 224


>gi|229817781|ref|ZP_04448063.1| hypothetical protein BIFANG_03053 [Bifidobacterium angulatum DSM
           20098]
 gi|229785570|gb|EEP21684.1| hypothetical protein BIFANG_03053 [Bifidobacterium angulatum DSM
           20098]
          Length = 248

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 42/261 (16%), Positives = 81/261 (31%), Gaps = 33/261 (12%)

Query: 4   EIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL 63
           E Q++++V+  + E   +  + +      +A                      GA    L
Sbjct: 3   EEQKIHVVIADDQELVRAGFAMVIGSQPDMAVAAQARD---------------GAEAMAL 47

Query: 64  VRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNV----LQRPTELFCPVFHTLPEN 119
                     +D  +      +  R ++  +     +     + R   +    F      
Sbjct: 48  AETLHPDVVLMDVRMPGMDGIEATRQISALQHRFAADGTKSEVARTKVIILTTFDLDEYV 107

Query: 120 ITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVH 179
           +       + +     +   +   +  +F    II       +         M  +   H
Sbjct: 108 MAAINAGASGFLLKDTEPETLLNSIRTVFQGNAIIAPSATKRLIEKMMEGDFMAANVGAH 167

Query: 180 WGKDF--------------ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIM 225
                              ELT RE E L  I+ G ++ EIA  L IS  TV  ++A I+
Sbjct: 168 GNSTASSTSDSTYTDPELDELTDREREVLIEIAHGLSNQEIADKLFISLTTVKTHVAHIL 227

Query: 226 RKTATKTRSGAIAYAVRNNIV 246
            K   + R  A+ +A  N++V
Sbjct: 228 SKINARDRVQAVVFAYENHLV 248


>gi|302551827|ref|ZP_07304169.1| two-component system response regulator [Streptomyces
           viridochromogenes DSM 40736]
 gi|302469445|gb|EFL32538.1| two-component system response regulator [Streptomyces
           viridochromogenes DSM 40736]
          Length = 270

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 32/241 (13%), Positives = 75/241 (31%), Gaps = 25/241 (10%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVR 65
           + + +++  +       +  +    + +  +                    GA       
Sbjct: 52  EPIRVLVVDDHALFRRGLEIVLAAEEDIQVVGEAGD---------------GAEAVEKAA 96

Query: 66  WDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
             L     +D  +      +    +          V      +   +     +       
Sbjct: 97  DLLPDIVLMDVRMPKRGGIEACTSIKE--------VAPSAKIIMLTISDEEADLYDAIKA 148

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE 185
               Y         +   +  +      I      ++  L  +++ + ++ +        
Sbjct: 149 GATGYLLKEISTDEVATAIRAVADGQSQISPSMASKL--LTEFKSMIQRTDERRLVPAPR 206

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I
Sbjct: 207 LTDRELEVLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKI 266

Query: 246 V 246
           +
Sbjct: 267 L 267


>gi|168259766|ref|ZP_02681739.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|200391066|ref|ZP_03217677.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199603511|gb|EDZ02057.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205351245|gb|EDZ37876.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 240

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 73/231 (31%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   +         +   T+ +   ++ L         +    + + +P   V 
Sbjct: 10  RRAMLLRFQEMAAAEDVYTELQYQTQRLEFDYYALCVRHPVPFTRPKISLRTTYPPAWVT 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLP--------ENITPPAGMDNRYCSLTFDVARI 140
                       VL+        +              +     G+            R 
Sbjct: 70  HYQSENYFAIDPVLKPENFRQGHLHWDDVLFHEAQAMWDAAQRFGLRRGVTQCVMLPNRA 129

Query: 141 RIGLMLLFPKGRIIL---RDRLWEIGLLAAYQANMFK--SYDVHWGKDFELTGREVECLT 195
              L +     R       +    + LLA    +       D+    +   + RE E L 
Sbjct: 130 LGFLSVSRSSLRCSSFTYDEVELRLQLLARESLSALTRFEDDMVMAPEMRFSKREKEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|116254365|ref|YP_770203.1| GerE family transcriptional regulator [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115259013|emb|CAK10122.1| LuxR-family regulator [Rhizobium leguminosarum bv. viciae 3841]
          Length = 251

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/243 (16%), Positives = 78/243 (32%), Gaps = 29/243 (11%)

Query: 32  LLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQE-----QKLDSIVSSDWPFDL 86
           LL  +       +    +  +    G  ++ L R           +   + ++  WP   
Sbjct: 9   LLVILEECSNPEAVVTELEQILHGCGFEYYGLPRHLPQTPMQQNPEPWAAALAGRWPEQW 68

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI----------------TPPAGMDNRY 130
                  +      +++       P                             G+++ Y
Sbjct: 69  PHIYTAKKYALIDPMVRYLAHAQRPFRWREAMAAFRKDAYHRRMEQMMVDAFGHGLEDGY 128

Query: 131 CSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFK-------SYDVHWGKD 183
                    I   L L   K   +    +  +  +A               + +     D
Sbjct: 129 IFPIHGRNGILASLSLAG-KPIELSPVEIALLEAVARKAFWRLLDLKGEAQALETVLPAD 187

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             LT RE+E L +++EG TS EI+ +L IS +TV+ Y+  +  K   K R  A+A A R+
Sbjct: 188 TPLTRREMEILHYLAEGMTSMEISKMLKISNHTVDWYMNGLQDKLKAKNRQQAVALAFRH 247

Query: 244 NIV 246
            ++
Sbjct: 248 GLI 250


>gi|83589824|ref|YP_429833.1| two component LuxR family transcriptional regulator [Moorella
           thermoacetica ATCC 39073]
 gi|83572738|gb|ABC19290.1| two component transcriptional regulator, LuxR family [Moorella
           thermoacetica ATCC 39073]
          Length = 222

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 35/241 (14%), Positives = 71/241 (29%), Gaps = 28/241 (11%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           I+++ I++  +       +  +      L  +                    G     + 
Sbjct: 4   IEKITILIADDHSLVREGIRKILELEPDLQVVGEAAT---------------GQEAIEMT 48

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
           R    Q   +D  +      +  + +        +  +         +       I    
Sbjct: 49  RRYQPQVIIMDINMPGLNGIEATKVIRQE-----WPQIAIL---ALTIHDDEEYIIELLR 100

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
              + Y         +   +  +    R+I      ++           +          
Sbjct: 101 SGVSGYVLKDISAEELVQAVYQVARGARVIHPGVAQKVIGCI-----QKQKPFTPAPVSI 155

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            LT RE E L  +S GK++ EIA  L IS  TV N++  I  K     R+ A  YA+++ 
Sbjct: 156 PLTAREREILIHVSLGKSNREIARELFISEKTVKNHLTHIFHKIGVSDRTQAALYALKHG 215

Query: 245 I 245
           +
Sbjct: 216 L 216


>gi|16330984|ref|NP_441712.1| NarL subfamily protein [Synechocystis sp. PCC 6803]
 gi|1653479|dbj|BAA18392.1| NarL subfamily [Synechocystis sp. PCC 6803]
          Length = 222

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 33/242 (13%), Positives = 77/242 (31%), Gaps = 21/242 (8%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           ++++ I L  +++     +               ++ +  W           G    +++
Sbjct: 1   MEKIRIALIEDEDLIRQGLQDAL----------TMEPSFEWVGEA-----ANGRLGLVMM 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
           +        +D  +      D+ + +     +    V+         +       +   +
Sbjct: 46  QQTRPDVVIIDIGLPDMNGIDVTQQLKKGPLNCQCRVV------ILTLNDQEETVLAAFS 99

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
              + YC        +   +         I       +   A        S        +
Sbjct: 100 AGADAYCMKDSRTELLIEAIQATHGGFAWIDPAIARIVLAHAPGAEPSEPSSPSRTSLSY 159

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            LT RE+E L  I +G ++ +IA  L I+  TV  ++ +I+ K     R+ A   A+R+ 
Sbjct: 160 GLTERELEVLQLIVDGCSNADIAEKLYITVGTVKTHVRNILNKLCANDRTQAAVRAIRSG 219

Query: 245 IV 246
           +V
Sbjct: 220 LV 221


>gi|119025623|ref|YP_909468.1| response regulator of two-component system [Bifidobacterium
           adolescentis ATCC 15703]
 gi|118765207|dbj|BAF39386.1| response regulator of two-component system [Bifidobacterium
           adolescentis ATCC 15703]
          Length = 249

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/262 (15%), Positives = 83/262 (31%), Gaps = 34/262 (12%)

Query: 4   EIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL 63
           E Q++ +V+  + E   +  + +      +A +                    GA    L
Sbjct: 3   EEQKIRVVIADDQELVRAGFAMVIGSQPDMAVVGQARD---------------GAEAVAL 47

Query: 64  VRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQ----RPTELFCPVFHTLPEN 119
                     +D  +      +  R ++  +     +           +    F      
Sbjct: 48  AETLHPDVVLMDVRMPGMDGIEATRRISALQHRFAPDGSALDDAHTRVIILTTFDLDEYV 107

Query: 120 ITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEI---------------GL 164
           +       + +     +   +   +  ++    II       +                 
Sbjct: 108 MAAINAGASGFLLKDTEPETLLNSIRTVYQGNAIIAPSATKRLIEKMMDGDFAGTAAAAP 167

Query: 165 LAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASI 224
           ++A  A+   +      +  ELT RE E L  I+ G ++ EIA  L IS  TV  ++A I
Sbjct: 168 VSATSASASTATMYTDPELDELTDREREVLIEIAHGLSNQEIADKLFISLPTVKTHVAHI 227

Query: 225 MRKTATKTRSGAIAYAVRNNIV 246
           + K   + R  A+ +A  N++V
Sbjct: 228 LSKINARDRVQAVVFAYENHLV 249


>gi|239941686|ref|ZP_04693623.1| putative two-component system response regulator [Streptomyces
           roseosporus NRRL 15998]
 gi|239988145|ref|ZP_04708809.1| putative two-component system response regulator [Streptomyces
           roseosporus NRRL 11379]
 gi|291445128|ref|ZP_06584518.1| two-component system response regulator [Streptomyces roseosporus
           NRRL 15998]
 gi|291348075|gb|EFE74979.1| two-component system response regulator [Streptomyces roseosporus
           NRRL 15998]
          Length = 251

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 31/241 (12%), Positives = 76/241 (31%), Gaps = 25/241 (10%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVR 65
           + + +++  +       +  +  + + +  +                    G+       
Sbjct: 33  EPIRVLVVDDHALFRRGLEIVLAQEEDIQVIGEAGD---------------GSEAVDKAA 77

Query: 66  WDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
             L     +D  +      +    +          V      +   +     +       
Sbjct: 78  DLLPDIVLMDVRMPKRGGIEACTAIKE--------VAPSAKIIMLTISDEEADLYEAIKA 129

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE 185
               Y         +   +  +      I      ++  L  +++ + ++ +        
Sbjct: 130 GATGYLLKEISTDEVATAIRAVADGQSQISPSMASKL--LTEFKSMIQRTDERRLVPAPR 187

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I
Sbjct: 188 LTERELEVLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKI 247

Query: 246 V 246
           +
Sbjct: 248 L 248


>gi|308179160|ref|YP_003918566.1| two-component system response regulator [Arthrobacter arilaitensis
           Re117]
 gi|307746623|emb|CBT77595.1| two-component system response regulator [Arthrobacter arilaitensis
           Re117]
          Length = 234

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 30/236 (12%), Positives = 65/236 (27%), Gaps = 17/236 (7%)

Query: 15  EDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKL 74
           +D+ +   V   P        ++  +  +             G                +
Sbjct: 4   DDKIKVLLVDDQPLLRMGFRLILEGEDDIVIAGEA-----ADGLDALAQTAALKPDVVLM 58

Query: 75  DSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLT 134
           D  +      +    +A                +    F       +      + +    
Sbjct: 59  DVRMPKMDGLEATERIAKEH--------PETKIIILTTFDLDEYAFSGLQAGASAFLLKD 110

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLL----AAYQANMFKSYDVHWGKDFELTGRE 190
                +   + L+     ++       +       A +      +         +LT RE
Sbjct: 111 VAPEELVHAVRLVASGDAVVAPRVTARLLETYVRNAGHGVPGQAAEPKRDPLLDDLTPRE 170

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            E L  ++EG ++ EIA    +S  TV  ++  I+ K   + R  A+ YA    +V
Sbjct: 171 QEVLRALAEGLSNAEIAHRFFLSEATVKTHVRRILTKLHLRDRVQAVVYAYETGLV 226


>gi|182439176|ref|YP_001826895.1| putative two-component system response regulator [Streptomyces
           griseus subsp. griseus NBRC 13350]
 gi|326779828|ref|ZP_08239093.1| two component transcriptional regulator, LuxR family [Streptomyces
           cf. griseus XylebKG-1]
 gi|178467692|dbj|BAG22212.1| putative two-component system response regulator [Streptomyces
           griseus subsp. griseus NBRC 13350]
 gi|326660161|gb|EGE45007.1| two component transcriptional regulator, LuxR family [Streptomyces
           cf. griseus XylebKG-1]
          Length = 234

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 34/231 (14%), Positives = 63/231 (27%), Gaps = 14/231 (6%)

Query: 15  EDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKL 74
           +   R   V   P   D +AR    +            T   G                L
Sbjct: 15  DRPIRVMVVDDHPMWRDAVAR-DLTESGFDVV-----ATAGDGPQAVRRAGAVSPDVLVL 68

Query: 75  DSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLT 134
           D  +       + + +  S              L         + +         Y   +
Sbjct: 69  DLNLPGMPGVQVCKELVGSH--------PGLRVLVLSASGEHADVLEAVKSGATGYLLKS 120

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECL 194
                +   +        +        +       A+       +  K  +LT RE E L
Sbjct: 121 ASTQELTDAVRSTAAGDPVFTPGLAGLVLGEYRRLASDPAPVASNEPKAPQLTDRETEVL 180

Query: 195 TWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
             +++G +  +IA  L IS  TV N++ + + K     R   + YA+   +
Sbjct: 181 RLVAKGLSYKQIAERLVISHRTVQNHVQNTLGKLQLHNRVELVRYAIERGL 231


>gi|167552822|ref|ZP_02346573.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205322659|gb|EDZ10498.1| regulatory protein SdiA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 240

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 73/231 (31%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   +         +   T+ +   ++ L         +    + + +P   V 
Sbjct: 10  RRAMLLRFQEMAAAEDVYTELQYQTQRLEFDYYALCVRHPVPFTRPKISLRTTYPPAWVT 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLP--------ENITPPAGMDNRYCSLTFDVARI 140
                       VL+        +              +     G+            R 
Sbjct: 70  HYQSENYFAIDPVLKPENFRQGHLHWDDVLFHEAQAMWDAAQRFGLRRGVTQCVMLPNRA 129

Query: 141 RIGLMLLFPKGRIIL---RDRLWEIGLLAAYQANMFK--SYDVHWGKDFELTGREVECLT 195
              L +     R       +    + LLA    +       D+    +   + RE E L 
Sbjct: 130 LGFLSISRSSLRCSSFTYDEVELRLQLLARESLSALTRFEDDMVMAPEMRFSKREKEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|62180524|ref|YP_216941.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|224583549|ref|YP_002637347.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|62128157|gb|AAX65860.1| transcriptional regulator of ftsQAZ gene cluster (LuxR/UhpA family)
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|224468076|gb|ACN45906.1| cell-division regulatory protein [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|322715000|gb|EFZ06571.1| DNA-binding transcriptional activator SdiA [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
          Length = 240

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 74/231 (32%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   +     +   +   T+ +   ++ L         +    + + +P   V 
Sbjct: 10  RRAMLLRFQEMAAAEDFYTELQYQTQRLEFDYYALCVRHPVPFTRPKISLRTTYPPAWVT 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLP--------ENITPPAGMDNRYCSLTFDVARI 140
                       VL+        +              +     G+            R 
Sbjct: 70  HYQSENYFAIDPVLKPENFRQGHLHWDDVLFHEAQAMWDAAQRFGLRRGVTQCVMLPNRA 129

Query: 141 RIGLMLLFPKGRIIL---RDRLWEIGLLAAYQANMFK--SYDVHWGKDFELTGREVECLT 195
              L +     R       +    + LLA    +       D+    +   + RE E L 
Sbjct: 130 LGFLSVSRSSLRCSSFTYDEVELRLQLLARESLSALTRFEDDMVMAPEMRFSKREKEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|219847289|ref|YP_002461722.1| LuxR family two component transcriptional regulator [Chloroflexus
           aggregans DSM 9485]
 gi|219541548|gb|ACL23286.1| two component transcriptional regulator, LuxR family [Chloroflexus
           aggregans DSM 9485]
          Length = 217

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 30/242 (12%), Positives = 70/242 (28%), Gaps = 30/242 (12%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           ++Q+ ++L  +       +         +  +               L            
Sbjct: 1   MEQITVLLIDDHRVVRQGLRDFLELQSDIEVVGEAASGEEGIELARELL----------- 49

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                    +D ++      +  R +          V      +    F    +      
Sbjct: 50  ----PDVVLMDLVMPGIDGVETTRRIKA--------VSPSSQVIVLTSFADDDKVFPAIK 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
                Y         +   +        ++      ++          F +   +     
Sbjct: 98  AGAISYLLKDISPEELAHAIRAARRGEAVLHPAVAAKL-------MQEFNTPRPNEPPVE 150

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           +LT RE++ L  +++G ++ EIA  L +S  TV  +I++I+ K     R+    YA+R  
Sbjct: 151 QLTPREMDVLRLVAKGMSNKEIADTLIVSEKTVKTHISNILSKLHLADRTQVAIYALRKR 210

Query: 245 IV 246
           +V
Sbjct: 211 LV 212


>gi|297243640|ref|ZP_06927571.1| response regulator of two-component system [Gardnerella vaginalis
           AMD]
 gi|296888391|gb|EFH27132.1| response regulator of two-component system [Gardnerella vaginalis
           AMD]
          Length = 260

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/260 (14%), Positives = 75/260 (28%), Gaps = 41/260 (15%)

Query: 22  FVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSS 80
            V  +    D           ++    M  + +   G     +   D      +D  +  
Sbjct: 5   GVIRVTIADDQELVRAGFAMVINSQQDMQVVAQAANGKQIVEITERDHPDIILMDVRMPV 64

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARI 140
               +  R +   + ++          +    F      +       + +     +   +
Sbjct: 65  MDGLEATRKILQQKTNEN------TKIIILTTFDLDEYVMAAIHAGASGFLLKDTEPETL 118

Query: 141 RIGLMLLFPKGRIILRDRLWEI--GLL------------------AAYQANMFKSYDVHW 180
              +  ++    II       +   ++                  A    ++  S     
Sbjct: 119 LNSIRTVYQGNAIIAPTATKRLIETMIQQSKVATNTTENSAANYTAQASYDVQASSTAQT 178

Query: 181 GKDF--------------ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMR 226
             D               ELT RE E L  I+ G ++ EIA  L IS  TV  ++A I+ 
Sbjct: 179 NPDVQETQSCTYENSAIPELTDREREVLVEIAHGLSNQEIADKLFISLPTVKTHVAHILG 238

Query: 227 KTATKTRSGAIAYAVRNNIV 246
           K   + R  A+ +A  N +V
Sbjct: 239 KIDARDRVQAVVFAYENGLV 258


>gi|225020347|ref|ZP_03709539.1| hypothetical protein CORMATOL_00354 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224946736|gb|EEG27945.1| hypothetical protein CORMATOL_00354 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 223

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 32/239 (13%), Positives = 72/239 (30%), Gaps = 21/239 (8%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  +       +S +   +D +  +   D  +        L               
Sbjct: 2   IRVLLVDDQALIRQAISVMLDATDDITIVGQGDTGLDAIAMAQRL--------------- 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                + D ++      +L   +A +EK      L     L    F      +       
Sbjct: 47  -----QPDVVLMDIRMPEL-DGIAATEKICGNPDLAATRVLILTTFENDTNIVAALRAGA 100

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +     +   +   +  +     ++       +                +      LT
Sbjct: 101 SGFIGKGSEPEELARAVRAVANGDALLSPSATRSLITRMLQPTETDPEPYANPELIDALT 160

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  +++G ++ EIA  L IS +T   ++ +IM K     R+  +     + +V
Sbjct: 161 IREREVLRLVTKGLSNQEIADELVISIHTTKTHVGNIMTKLGAHDRAQLVIVGYESGLV 219


>gi|295836933|ref|ZP_06823866.1| nitrate/nitrite response regulator [Streptomyces sp. SPB74]
 gi|295826282|gb|EDY45818.2| nitrate/nitrite response regulator [Streptomyces sp. SPB74]
          Length = 264

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 37/235 (15%), Positives = 78/235 (33%), Gaps = 12/235 (5%)

Query: 14  REDEQRTSFVS-HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQE 71
            EDE R       +    D       L+  ++    +  + E   G+         L   
Sbjct: 37  DEDEPRPRAEPIRVLVVDDHALFRRGLEIVLATEEDIEVVGEAGDGSEAVEKATDLLPDI 96

Query: 72  QKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYC 131
             +D  +      +    +          V      +   +     +           Y 
Sbjct: 97  VLMDVRMPKRGGIEACTAIKE--------VAPSAKIIMLTISDEEADLYDAIKAGATGYL 148

Query: 132 SLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREV 191
                   +   +  +      I      ++  L+ +++ + ++ +        LT RE+
Sbjct: 149 LKEISTDEVATAIRAVADGQSQISPSMASKL--LSEFKSMIQRTDERRLVPAPRLTDREM 206

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I+
Sbjct: 207 DVLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKIL 261


>gi|302545751|ref|ZP_07298093.1| response regulator, two-component system [Streptomyces
           hygroscopicus ATCC 53653]
 gi|302463369|gb|EFL26462.1| response regulator, two-component system [Streptomyces
           himastatinicus ATCC 53653]
          Length = 226

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 34/223 (15%), Positives = 70/223 (31%), Gaps = 6/223 (2%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D           ++    +  + E   G     + R        +D  +     
Sbjct: 4   RVIIVDDQAMVRAGFAALLAAQSDIDVVGEAPDGRQGVDVSRNTHPDVVLMDVRMPEMDG 63

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
            +  R +    +     V  RP  L    F              + +       A +   
Sbjct: 64  LEAARQLLEPPRG----VTHRPKVLMLTTFDVDDYVYEALRAGASGFLLKDAPPADLISA 119

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           + ++     ++       +    A Q    +       +   LT RE E L  I+ G ++
Sbjct: 120 VRVVAAGEALLAPSVTRRLIAEFARQRPAPRRNSSLLRRS-GLTPRETEVLELIARGLSN 178

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            EIA  L ++  TV  +I  ++ K   + R+ A+ +A  + +V
Sbjct: 179 QEIAESLVLAEQTVKTHIGRVLAKLGLRDRAQAVIFAYESGLV 221


>gi|29831611|ref|NP_826245.1| two-component system response regulator [Streptomyces avermitilis
           MA-4680]
 gi|29608727|dbj|BAC72780.1| putative two-component system response regulator [Streptomyces
           avermitilis MA-4680]
          Length = 248

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 32/241 (13%), Positives = 75/241 (31%), Gaps = 25/241 (10%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVR 65
           + + +++  +       +  +    + +  +                    GA       
Sbjct: 30  EPIRVLVVDDHALFRRGLEIVLAAEEDIQVVGEAGD---------------GAEAVDKAA 74

Query: 66  WDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
             L     +D  +      +    +          V      +   +     +       
Sbjct: 75  DLLPDIVLMDVRMPKRGGIEACTSIKE--------VAPSAKIIMLTISDEEADLYDAIKA 126

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE 185
               Y         +   +  +      I      ++  L  +++ + ++ +        
Sbjct: 127 GATGYLLKEISTDEVATAIRAVADGQSQISPSMASKL--LTEFKSMIQRTDERRLVPAPR 184

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I
Sbjct: 185 LTDRELEVLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKI 244

Query: 246 V 246
           +
Sbjct: 245 L 245


>gi|154487087|ref|ZP_02028494.1| hypothetical protein BIFADO_00927 [Bifidobacterium adolescentis
           L2-32]
 gi|154084950|gb|EDN83995.1| hypothetical protein BIFADO_00927 [Bifidobacterium adolescentis
           L2-32]
          Length = 249

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/262 (15%), Positives = 83/262 (31%), Gaps = 34/262 (12%)

Query: 4   EIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL 63
           E Q++ +V+  + E   +  + +      +A +                    GA    L
Sbjct: 3   EEQKIRVVIADDQELVRAGFAMVIGSQPDMAVVGQARD---------------GAEAVAL 47

Query: 64  VRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQ----RPTELFCPVFHTLPEN 119
                     +D  +      +  R ++  +     +           +    F      
Sbjct: 48  AETLHPDVVLMDVRMPGVDGIEATRRISALQHRFAPDGSALDDAHTRVIILTTFDLDEYV 107

Query: 120 ITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEI---------------GL 164
           +       + +     +   +   +  ++    II       +                 
Sbjct: 108 MAAINAGASGFLLKDTEPETLLNSIRTVYQGNAIIAPSATKRLIEKMMDGDFAGTAAAAP 167

Query: 165 LAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASI 224
           ++A  A+   +      +  ELT RE E L  I+ G ++ EIA  L IS  TV  ++A I
Sbjct: 168 VSAMSASASTATMYTDPELDELTDREREVLIEIAHGLSNQEIADKLFISLPTVKTHVAHI 227

Query: 225 MRKTATKTRSGAIAYAVRNNIV 246
           + K   + R  A+ +A  N++V
Sbjct: 228 LSKINARDRVQAVVFAYENHLV 249


>gi|306823235|ref|ZP_07456611.1| transcriptional regulator [Bifidobacterium dentium ATCC 27679]
 gi|309801640|ref|ZP_07695761.1| response regulator receiver domain protein [Bifidobacterium dentium
           JCVIHMP022]
 gi|304553867|gb|EFM41778.1| transcriptional regulator [Bifidobacterium dentium ATCC 27679]
 gi|308221772|gb|EFO78063.1| response regulator receiver domain protein [Bifidobacterium dentium
           JCVIHMP022]
          Length = 248

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/253 (15%), Positives = 73/253 (28%), Gaps = 23/253 (9%)

Query: 12  LNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQE 71
           ++ E   R              A +I     +    +        GA    L        
Sbjct: 1   MSEEQRIRVIIADDQELVRAGFAMVIGSQPDMMVAGQAR-----DGAEAVALAETLHPDV 55

Query: 72  QKLDSIVSSDWPFDLVRCMALSEKDKYYNVL----QRPTELFCPVFHTLPENITPPAGMD 127
             +D  +      +  R ++  +            +R   +    F      +       
Sbjct: 56  VLMDVRMPGMDGIEATRQISSLQHRFAATGAQTGPRRTRVIILTTFDLDEYVMAAINAGA 115

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEI--------------GLLAAYQANMF 173
           + +     +   +   +  +F    II       +                +        
Sbjct: 116 SGFLLKDTEPETLLNSIRTVFQGNAIIAPSATKRLIERMMEGGLTDQDSLTIPTSADTAP 175

Query: 174 KSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
                   +  ELT RE E L  I+ G ++ EIA  L IS  TV  ++A I+ K   + R
Sbjct: 176 SRPAYTDPELDELTDREREVLIEIAHGLSNQEIADRLFISLPTVKTHVAHILSKINARDR 235

Query: 234 SGAIAYAVRNNIV 246
             A+ +A  N++V
Sbjct: 236 VQAVVFAYENHLV 248


>gi|290958644|ref|YP_003489826.1| two component system response regulator [Streptomyces scabiei
           87.22]
 gi|260648170|emb|CBG71278.1| putative two component system response regulator [Streptomyces
           scabiei 87.22]
          Length = 224

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 31/229 (13%), Positives = 69/229 (30%), Gaps = 11/229 (4%)

Query: 19  RTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSI 77
            TS    +    D           +     +  + + V G      V         +D  
Sbjct: 1   MTSSTIRVLIADDQQMVRQGFSVLLDIQPDIDVVGQAVHGLDAIDKVAELAPDVVLMDIR 60

Query: 78  VSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           +      +  R +                 L    F              + +       
Sbjct: 61  MPELGGIEATRRITTER--------PHIRVLVLTTFDLDEYVYEALRAGASGFLLKDASA 112

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
            ++   + ++     ++       +  +A +             +  +LT RE E L+ I
Sbjct: 113 DQLAEAVRVVAAGDALLAPGVTRRL--IAEFSRLGTAPRAPLKERVGDLTERETEVLSLI 170

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++G ++ EIA  L ++  TV  ++  I+ K   + R+ A  +A  + +V
Sbjct: 171 AQGLSNAEIAQSLVVAEQTVKTHVGRILVKLGLRDRTQAAVFAYESGLV 219


>gi|188585286|ref|YP_001916831.1| two component transcriptional regulator, LuxR family
           [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179349973|gb|ACB84243.1| two component transcriptional regulator, LuxR family
           [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 215

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/227 (18%), Positives = 75/227 (33%), Gaps = 19/227 (8%)

Query: 20  TSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVS 79
              V         L+ ++     +    ++    E +        +        LD  + 
Sbjct: 5   VLVVDDHAVLGKGLSMLLNSQDDMEVCGQVGTAKEALDT-----CKEKCPDVVLLDLSLP 59

Query: 80  SDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVAR 139
                ++++ +  S              L   +               + Y         
Sbjct: 60  DKQGHEIIKELKESC---------SARVLALTMHEDEAYFKRVVEAGGDGYILKKAADDE 110

Query: 140 IRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISE 199
           +   +  ++    I+ +       LL  Y  N  K       K+++L+ RE E L  I+ 
Sbjct: 111 LISAIRSVYQGEVIVDKTFTK---LLIDYYRNPDKQSGT--EKNYDLSDREKEVLQLIAL 165

Query: 200 GKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           G T+ EIA  L IS  TV  +IA I  K     RS  + YA+RNNI+
Sbjct: 166 GYTNKEIAEKLYISIKTVETHIARIKEKLGLNRRSELVRYAMRNNII 212


>gi|328882798|emb|CCA56037.1| putative two-component system response regulator [Streptomyces
           venezuelae ATCC 10712]
          Length = 250

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 32/241 (13%), Positives = 76/241 (31%), Gaps = 25/241 (10%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVR 65
           + + +++  +       +  +  + + +  +                    GA       
Sbjct: 32  EPIRVLVVDDHALFRRGLEIVLAQEEDIQVVGEAGD---------------GAEAVDKAA 76

Query: 66  WDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
             L     +D  +      +    +          V      +   +     +       
Sbjct: 77  DLLPDIVLMDVRMPRRGGIEACTSIKE--------VAPSAKIIMLTISDEEADLYDAIKA 128

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE 185
               Y         +   +  +      I      ++  L  +++ + ++ +        
Sbjct: 129 GATGYLLKEISTDEVATAIRAVADGQSQISPSMASKL--LTEFKSMIQRTDERRLVPAPR 186

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I
Sbjct: 187 LTDRELEVLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKI 246

Query: 246 V 246
           +
Sbjct: 247 L 247


>gi|290959922|ref|YP_003491104.1| two-component system response regulator [Streptomyces scabiei
           87.22]
 gi|260649448|emb|CBG72563.1| putative two-component system response regulator [Streptomyces
           scabiei 87.22]
          Length = 249

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 37/234 (15%), Positives = 77/234 (32%), Gaps = 15/234 (6%)

Query: 13  NREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQ 72
           +R++  R   V         L  ++  +  +          E V  +  LL         
Sbjct: 28  SRKEPIRVLVVDDHALFRRGLEIVLAAEEDIQVVGEAGDGAEAVDKAADLL-----PDIV 82

Query: 73  KLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCS 132
            +D  +      +    +          V      +   +     +           Y  
Sbjct: 83  LMDVRMPKRGGIEACTSIKE--------VAPSAKIIMLTISDEEADLYDAIKAGATGYLL 134

Query: 133 LTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVE 192
                  +   +  +      I      ++  L  +++ + ++ +        LT RE+E
Sbjct: 135 KEISTDEVATAIRAVADGQSQISPSMASKL--LTEFKSMIQRTDERRLVPAPRLTDRELE 192

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I+
Sbjct: 193 VLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKIL 246


>gi|302534781|ref|ZP_07287123.1| two-component system response regulator [Streptomyces sp. C]
 gi|302443676|gb|EFL15492.1| two-component system response regulator [Streptomyces sp. C]
          Length = 270

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 32/241 (13%), Positives = 76/241 (31%), Gaps = 25/241 (10%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVR 65
           + + +++  +       +  +  + + +  +                    GA       
Sbjct: 52  EPIRVLVVDDHALFRRGLEIVLAQEEDIQVVGEAGD---------------GAEAVDKAA 96

Query: 66  WDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
             L     +D  +      +    +          V      +   +     +       
Sbjct: 97  DLLPDIVLMDVRMPRRGGIEACTSIKE--------VAPSAKIIMLTISDEEADLYDAIKA 148

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE 185
               Y         +   +  +      I      ++  L  +++ + ++ +        
Sbjct: 149 GATGYLLKEISTDEVATAIRAVADGQSQISPSMASKL--LTEFKSMIQRTDERRLVPAPR 206

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE+E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I
Sbjct: 207 LTDRELEVLKLVATGMNNRDIAKQLFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKI 266

Query: 246 V 246
           +
Sbjct: 267 L 267


>gi|259046510|ref|ZP_05736911.1| DNA-binding response regulator [Granulicatella adiacens ATCC 49175]
 gi|259036675|gb|EEW37930.1| DNA-binding response regulator [Granulicatella adiacens ATCC 49175]
          Length = 211

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 75/239 (31%), Gaps = 31/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           +N++L  + E     VS   +  D +  +                    G          
Sbjct: 2   INVLLVDDHEMVRLGVSSYLSMQDDIDVIAEAKN---------------GREGVEKALSY 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++      +  + +                 +    F    +         
Sbjct: 47  KPDIILMDLVMPEMDGIEATKEILHQW--------PEAKIIILTSFIDDEKVFPAINAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y   T   ++I   +   +    +       ++        N             +LT
Sbjct: 99  KSYILKTSSASQIAKAIRDTYQGDGVFEPQVTDKL-------VNRI-QMKQQHFPHDDLT 150

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE+E L  I++GK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA ++ ++
Sbjct: 151 QRELEVLLLIAQGKSNQEIADELFITLKTVKTHVSNILSKLEVEDRTQATIYAFKHQLI 209


>gi|307324713|ref|ZP_07603919.1| two component transcriptional regulator, LuxR family [Streptomyces
           violaceusniger Tu 4113]
 gi|306889595|gb|EFN20575.1| two component transcriptional regulator, LuxR family [Streptomyces
           violaceusniger Tu 4113]
          Length = 225

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 35/223 (15%), Positives = 72/223 (32%), Gaps = 8/223 (3%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D           ++    +  + E   G     + R        +D  +      
Sbjct: 5   VIIVDDQAMVRAGFAALLAAQSDIDVVGEAPDGRQGVEVSRRAHPDVVLMDVRMPEMDGL 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +  R +     D    V+ RP  L    F              + +       A +   +
Sbjct: 65  EAARQL----LDPPRGVIHRPKVLMLTTFDVDDYVYEALRAGASGFLLKDAPPADLISAV 120

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFK-SYDVHWGKDFELTGREVECLTWISEGKTS 203
            ++     ++       +  +A +         D    +   LT RE E L  I+ G ++
Sbjct: 121 RVVAAGEALLAPSVTRRL--IADFARQRPAPRRDGPSARRSGLTPRETEVLELIARGLSN 178

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            EIA  L ++  TV  +I  ++ K   + R+ A+ +A  + +V
Sbjct: 179 QEIAESLVLAEQTVKTHIGRVLAKLGLRDRAQAVIFAYESGLV 221


>gi|295704610|ref|YP_003597685.1| two-component response regulator [Bacillus megaterium DSM 319]
 gi|294802269|gb|ADF39335.1| two-component response regulator [Bacillus megaterium DSM 319]
          Length = 212

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/221 (17%), Positives = 68/221 (30%), Gaps = 15/221 (6%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D       L   +     +  + E   G     L          +D  +      
Sbjct: 5   ILIADDHHVVRKGLVFFLQTQPDLEVVGEASNGEEALKLATSLEPHIVLMDLSMPVLDGI 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +     A  E  K    +Q         F      I       + Y     D   +   +
Sbjct: 65  E-----ATKELKKQAPHIQVM---ILTSFSDQDHVIPALEAGASGYQLKESDPDELVAAI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
             L      +       +           KS +        LT RE + L  I++GK++ 
Sbjct: 117 RKLMNGENQLHPKVTTHLLTRLT------KSSEKKVNFIDHLTKREKDVLKEIAKGKSNK 170

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           EI   L I+  TV  ++++I+ K   + R+ A  YAV++ I
Sbjct: 171 EIGAALHITEKTVKTHVSNILSKLGVQDRTQAALYAVQHGI 211


>gi|218514697|ref|ZP_03511537.1| probable transcriptional regulator protein, LuxR family [Rhizobium
           etli 8C-3]
          Length = 124

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 78/124 (62%), Positives = 96/124 (77%)

Query: 123 PAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGK 182
           P G   +YCSLTF+V R R+ LM LF +G I+  +RL ++GLLA Y A+  +       +
Sbjct: 1   PEGASRQYCSLTFNVGRSRLALMFLFGEGFILSPERLRDVGLLAGYVASFLRCGGARVDR 60

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           DFELT RE+ECL WI+EGKTSDEIA+ILGISRNT+NNYI S+MRKTATKTRS AIA+AVR
Sbjct: 61  DFELTDRELECLFWIAEGKTSDEIAMILGISRNTINNYITSVMRKTATKTRSEAIAFAVR 120

Query: 243 NNIV 246
           NN+V
Sbjct: 121 NNLV 124


>gi|296134303|ref|YP_003641550.1| two component transcriptional regulator, LuxR family [Thermincola
           sp. JR]
 gi|296032881|gb|ADG83649.1| two component transcriptional regulator, LuxR family [Thermincola
           potens JR]
          Length = 214

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/241 (17%), Positives = 76/241 (31%), Gaps = 27/241 (11%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           + ++ +++  +       +  +      +              ++  L            
Sbjct: 1   MGKIKVLIADDHPLIREGLIKVLALDKEICVAGEAADGNEVLDKVNRL------------ 48

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
                   K D ++            A     K    ++    +   V       +    
Sbjct: 49  --------KPDVVLLDLNMPKFSGVEAAKILLKNDPEIK---VIALTVDDCEQRILELIK 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
              + Y      V  +   +  ++    +I       +      + N   S     G   
Sbjct: 98  IGVSGYLLKDVSVDALISTIKAVYAGETVIAPRITQML----LREVNNPVSGGPASGGLA 153

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ELT RE E +  I+EGK + EIA  L IS  TV N+I+SI RK     R+ A  YA++ N
Sbjct: 154 ELTAREREIIRLIAEGKNNREIAAELFISEKTVKNHISSIFRKIKVHDRTQAALYAIKTN 213

Query: 245 I 245
           +
Sbjct: 214 L 214


>gi|325003494|ref|ZP_08124606.1| two component system response regulator [Pseudonocardia sp. P1]
          Length = 222

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 34/239 (14%), Positives = 68/239 (28%), Gaps = 24/239 (10%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  +     S    L      L  +                    GA      R  
Sbjct: 2   IRVLLADDQALVRSGFRALLGSQPDLEVVAEAGD---------------GAEALAAARAQ 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +         R +           L     +    F           G  
Sbjct: 47  SPDVVLMDIRMPGTDGLTATREITG------DPGLSGTRVIVLTTFTDDSYVFEAIRGGA 100

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +     + A +   + ++     ++       +    A  A   +       +   LT
Sbjct: 101 SGFLVKDSEPADLIHAIRIVHGGEALLAPAVTRTLI---AEFAARSRGGPAVSPRLDALT 157

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  ++ G ++DEIA  L +S  T   +++  M K   + R+  +  A  + +V
Sbjct: 158 EREREVLAEVAAGLSNDEIAGRLHMSPTTAKTHVSRTMTKLGARDRAQLVVVAYESGLV 216


>gi|283455737|ref|YP_003360301.1| two-component response regulator [Bifidobacterium dentium Bd1]
 gi|283102371|gb|ADB09477.1| Two-component response regulator [Bifidobacterium dentium Bd1]
          Length = 251

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/253 (15%), Positives = 74/253 (29%), Gaps = 23/253 (9%)

Query: 12  LNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQE 71
           ++ E   R              A +I     +    +        GA    L        
Sbjct: 4   MSEEQRIRVIIADDQELVRAGFAMVIGSQPDMMVAGQAR-----DGAEAVALAETLHPDV 58

Query: 72  QKLDSIVSSDWPFDLVRCMALSEKDKYYNVL----QRPTELFCPVFHTLPENITPPAGMD 127
             +D  +      +  R ++  +            +R   +    F      +       
Sbjct: 59  VLMDVRMPGMDGIEATRQISSLQHRFAATGAQTGPRRTRVIILTTFDLDEYVMAAINAGA 118

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEI--------------GLLAAYQANMF 173
           + +     +   +   +  +F    II       +                + A      
Sbjct: 119 SGFLLKDTEPETLLNSIRTVFQGNAIIAPSATKRLIERMMEGGLTDQDSLTIPASADTAP 178

Query: 174 KSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
                   +  ELT RE E L  I+ G ++ EIA  L IS  TV  ++A I+ K   + R
Sbjct: 179 SRPAYTDPELDELTDREREVLIEIAHGLSNQEIADRLFISLPTVKTHVAHILSKINARDR 238

Query: 234 SGAIAYAVRNNIV 246
             A+ +A  N++V
Sbjct: 239 VQAVVFAYENHLV 251


>gi|295705373|ref|YP_003598448.1| two-component response regulator [Bacillus megaterium DSM 319]
 gi|294803032|gb|ADF40098.1| two-component response regulator [Bacillus megaterium DSM 319]
          Length = 213

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 30/242 (12%), Positives = 71/242 (29%), Gaps = 30/242 (12%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           +Q   I++  +       +  +    +    +                    G     L 
Sbjct: 1   MQPFRILIVDDHAHAREGIRDILEEYEDFIIVGEGTN---------------GQEAIELT 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
              +     +D  +      +  + + L               +   V   + +      
Sbjct: 46  EKLMPDIVLMDIGMPVMDGLEATKQIKLQ--------FPYVKIVVITVSDDITDLFDALK 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
                Y             L         + ++       +A      F         D 
Sbjct: 98  KGAQGYLLKNLQSEVWYDYLRAFALDEVPMSKE-------IAFQILKEFPQETSIKKPDT 150

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            L+ RE+E L  +++G ++ +I+  L IS +TV +++ +I+ K   + R    +YA +N 
Sbjct: 151 PLSARELEVLQLVAKGLSNRDISAQLFISEHTVKSHLKNILSKLHLENRVQLTSYAFQNG 210

Query: 245 IV 246
           ++
Sbjct: 211 LM 212


>gi|269956412|ref|YP_003326201.1| LuxR family two component transcriptional regulator [Xylanimonas
           cellulosilytica DSM 15894]
 gi|269305093|gb|ACZ30643.1| two component transcriptional regulator, LuxR family [Xylanimonas
           cellulosilytica DSM 15894]
          Length = 234

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/223 (16%), Positives = 74/223 (33%), Gaps = 11/223 (4%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D           +     +  + E   G +   L          +D  +     
Sbjct: 6   RVLVCDDQALIRTGFTTIIDAQPDLEVVGECGDGRTAVHLAGRLRPDVVVMDVRMPGLDG 65

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
            +  R +A +       V      L    F+             + +       A++  G
Sbjct: 66  IEATRLLAGAGVP--DPV----KVLVVTTFNLDEYVYEALRAGASGFLLKDAPPAQLLDG 119

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           +  +     ++  +    +       A+     +     D  LT RE++ L  ++EG ++
Sbjct: 120 IRTVAAGSALLAPEVTRRL---VGRYASRVAPPEPA-PADGPLTPRELDVLRLLAEGLSN 175

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            EIA  L I+R TV  Y++ I+ K   + R  A+ +A +  +V
Sbjct: 176 AEIAAALVITRETVKTYVSRILTKLDLRDRVQAVVWAYQTGLV 218


>gi|71906473|ref|YP_284060.1| LuxR response regulator receiver [Dechloromonas aromatica RCB]
 gi|71846094|gb|AAZ45590.1| regulatory protein, LuxR:Response regulator receiver [Dechloromonas
           aromatica RCB]
          Length = 221

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 30/240 (12%), Positives = 77/240 (32%), Gaps = 27/240 (11%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVR 65
           +++ ++L  +     S +  L  R+D    +      +    R+ +L             
Sbjct: 3   ERIRVLLVDDHTLFRSGIKSLLQRNDDFEVVGEAGDGLEGIKRVRSL------------- 49

Query: 66  WDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAG 125
                   LD  +      + V+ ++          +     L   V     + +     
Sbjct: 50  --KPDVALLDLHMPGVSGLEAVKVISEE--------MPEVRVLMLTVSEDAQDLMDALRA 99

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFE 185
             + Y     +   +   +        ++ +    ++              +    +   
Sbjct: 100 GASGYLLKNIETDMLVDAIRRAAQGESVVSQQMTAKL----IQGVRNPPKAETATIERDR 155

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
            + RE + L  +++G+++ EIA  L ++ +TV  ++ +I +K    +R     YAV N  
Sbjct: 156 FSPRERDILASLAQGESNKEIARKLDLAESTVKIHVQNIFKKLNMSSRVQVALYAVENGY 215


>gi|317122209|ref|YP_004102212.1| LuxR family transcriptional regulator [Thermaerobacter marianensis
           DSM 12885]
 gi|315592189|gb|ADU51485.1| two component transcriptional regulator, LuxR family
           [Thermaerobacter marianensis DSM 12885]
          Length = 280

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 39/245 (15%), Positives = 72/245 (29%), Gaps = 23/245 (9%)

Query: 2   NFEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHF 61
           +  ++ + +++  +       +  L      +A +                    G    
Sbjct: 55  DDGLRPIRVLVADDHAILRDGIRTLLEAQPDIAVVGEAAD---------------GREAV 99

Query: 62  LLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENIT 121
            L R        LD  +      +  R +                 L   +         
Sbjct: 100 ELARRLRPDVVLLDIGMPGMNGIEATRAILKER--------PETRVLILSMHDNEEYIFP 151

Query: 122 PPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWG 181
                   Y         +   L  +     I+  D   ++   AA +       +    
Sbjct: 152 ILEAGAAGYVLKRSAATELVSALRAVVQGHTILHPDVAAKVVSGAARRQKGGGPQEGVPR 211

Query: 182 KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAV 241
           +   LT RE E LT I++G T+ EIA  L IS  TV  + ++IM K           YA+
Sbjct: 212 RVDGLTERETEVLTLIAQGLTNQEIADRLFISIKTVQAHRSNIMEKLDLHDAVELTKYAI 271

Query: 242 RNNIV 246
           R+ ++
Sbjct: 272 RHGLI 276


>gi|118917992|dbj|BAF40420.1| PsyR [Pseudomonas syringae pv. tabaci]
          Length = 247

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 33/228 (14%), Positives = 72/228 (31%), Gaps = 23/228 (10%)

Query: 40  DCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYY 99
                          ++G   +        +  K   ++ S++P   ++    S      
Sbjct: 22  APLRQLIEDFENDLHHIGDFTYAYFSTPKTRNVKP--VILSNYPDSWLKSYVASNYHLID 79

Query: 100 NVLQRPTELFCPVFHTLPEN------------ITPPAGMDNRYCSLTFDVARIRIGLMLL 147
            +++       P F     N             +    + +       D + +   L L 
Sbjct: 80  PIIKHAWHSITPFFWREARNAVQGVETDDFLKRSAKYQLSSGATFTLHDASGLFAALSLC 139

Query: 148 FPKG----RIILRDRLWEIGLLAAYQANMFKSYDVHW-----GKDFELTGREVECLTWIS 198
             +        +R++  +I +      +                  +L+ RE   L W++
Sbjct: 140 NARQQNDFDQRIREKAADIQMSLIRFHDRLIKTRAPHELFPQPTQCKLSTRETGVLKWVA 199

Query: 199 EGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            GK+  EIA I  IS  TV  +++++  K   +T   A+  A+   +V
Sbjct: 200 MGKSYSEIAEIFSISERTVKFHMSNVSSKLEVRTAKQAVYKAINMGMV 247


>gi|258539885|ref|YP_003174384.1| two-component response regulator [Lactobacillus rhamnosus Lc 705]
 gi|257151561|emb|CAR90533.1| Two-component response regulator [Lactobacillus rhamnosus Lc 705]
          Length = 221

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 77/239 (32%), Gaps = 33/239 (13%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + +++  + E     +S        L  +   +                G     +   D
Sbjct: 2   IKVLIVDDHEMVRLGLSTYIGVQPDLEVVDQAEN---------------GQEGVEMALKD 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++      +  + +  +          +   +    F    +         
Sbjct: 47  RPDIILMDLVMPVKDGIEATKEILKAW--------PQARIIILTSFIDDAKVYPAMEAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y   T     I   +       R++      ++              +    +  ELT
Sbjct: 99  ASYILKTATAEEIAKAIRQTASGERVLEPQVTTKM----------MNRMNHPQPQYDELT 148

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  I++GK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA+++ +V
Sbjct: 149 NREREVLQLIAQGKSNQEIATELFITLKTVKTHVSNILAKLDVEDRTQAAIYALKHGLV 207


>gi|305679871|ref|ZP_07402681.1| response regulator receiver domain protein [Corynebacterium
           matruchotii ATCC 14266]
 gi|305660491|gb|EFM49988.1| response regulator receiver domain protein [Corynebacterium
           matruchotii ATCC 14266]
          Length = 223

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 32/239 (13%), Positives = 72/239 (30%), Gaps = 21/239 (8%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  +       +S +   +D +  +   D  +        L               
Sbjct: 2   IRVLLVDDQALIRQAISVMLDATDDITIVGQGDTGLDAIAMAQRL--------------- 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                + D ++      +L   +A +EK      L     L    F      +       
Sbjct: 47  -----QPDVVLMDIRMPEL-DGIAATEKICGNPDLAATRVLILTTFENDTNIVAALRAGA 100

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +     +   +   +  +     ++       +                +      LT
Sbjct: 101 SGFIGKGSEPEELARAVRAVANGDALLSPSATRSLITRMLQPTEADPEPYANPELIDALT 160

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  +++G ++ EIA  L IS +T   ++ +IM K     R+  +     + +V
Sbjct: 161 IREREVLRLVTKGLSNQEIADELVISIHTTKTHVGNIMTKLGAHDRAQLVIVGYESGLV 219


>gi|297203696|ref|ZP_06921093.1| two-component system response regulator [Streptomyces sviceus ATCC
           29083]
 gi|197711744|gb|EDY55778.1| two-component system response regulator [Streptomyces sviceus ATCC
           29083]
          Length = 223

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 30/239 (12%), Positives = 69/239 (28%), Gaps = 24/239 (10%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + +V+  + E   S  + +      +  +                    GA     V   
Sbjct: 3   IRVVVADDQELVRSGFTMILEAQPDIEVVAEAGD---------------GAEAVAAVCRH 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 LD  +      +  R +                 +    F              
Sbjct: 48  TPDVLLLDIRMPVMDGLEAARRVCARS---------SCKVVMLTTFDLDEYVYDALYAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + +         +   + ++     ++       +      +     +      +   LT
Sbjct: 99  SGFLLKDVRRDDLVHAVRVVAGGDSLLAPTITRRLVADIVRRRREEAATGATPDRLDALT 158

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            REVE L  ++ G ++ EIA  L +S +TV  ++++++ K   + R  A+  A    +V
Sbjct: 159 AREVEILRMLARGLSNAEIATTLFVSEHTVKTHVSNVLSKLGLRDRVQAVICAYETGLV 217


>gi|228985356|ref|ZP_04145515.1| DNA-binding response regulator [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228774309|gb|EEM22716.1| DNA-binding response regulator [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 211

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 34/220 (15%), Positives = 67/220 (30%), Gaps = 16/220 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           L    D       L   +        + E   G   F  VR +      +D  +      
Sbjct: 5   LLLVEDHHIVRRGLVFFLKTKEEFEIVGEAGNGEEAFTFVRTERPDVVLMDLSMPKMDGI 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +  + +      +Y   ++         F      +       + Y        ++   +
Sbjct: 65  EATKRI-----KQYDETIKILILSS---FSEQDYVLPALEAGADGYQLKEVQPEQLVASI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
           + +              +                       LT RE E L  I++G+++ 
Sbjct: 117 VAVHQGNANFHPKITPAL-------LGRSAVKKEKENPFSMLTKREKEVLREIAKGRSNK 169

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EIA  L I+  TV  ++++I+ K     R+ A  YAV++ 
Sbjct: 170 EIAAELHITEQTVKTHVSNILAKLEVDDRTQAALYAVKHG 209


>gi|224824369|ref|ZP_03697477.1| two component transcriptional regulator, LuxR family [Lutiella
           nitroferrum 2002]
 gi|224603788|gb|EEG09963.1| two component transcriptional regulator, LuxR family [Lutiella
           nitroferrum 2002]
          Length = 222

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/238 (15%), Positives = 79/238 (33%), Gaps = 26/238 (10%)

Query: 7   QVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRW 66
            + I+L  +     S +  L +R   LA +                    GA    L + 
Sbjct: 5   PIRILLVDDHTLFRSGIRMLLSRQPELAVVGEAAD---------------GAEGVKLAKQ 49

Query: 67  DLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGM 126
            +     LD  +      + +  +                 +   V     +        
Sbjct: 50  LMPDVVLLDLHMPGISGVEALGLLLQDNPT--------LAVVMLTVSEDADDLTAALKAG 101

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFEL 186
              Y     D   ++  ++       ++      ++    A+      +      +  +L
Sbjct: 102 ARGYLLKNIDADFLKQSIIKAAAGESVMSEAMTAKL---MAHFRAGAPAPSQQQQELEKL 158

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           T RE E L ++++G+++ EIA  L ++ +TV  ++ +I++K    +R  A  YAV + 
Sbjct: 159 TPREREILGFLAQGQSNKEIARTLDLAESTVKIHVQNILKKLGLSSRVQAAVYAVEHG 216


>gi|261407454|ref|YP_003243695.1| LuxR family two component transcriptional regulator [Paenibacillus
           sp. Y412MC10]
 gi|329927546|ref|ZP_08281731.1| putative nitrate/nitrite response regulator protein NarL
           [Paenibacillus sp. HGF5]
 gi|261283917|gb|ACX65888.1| two component transcriptional regulator, LuxR family [Paenibacillus
           sp. Y412MC10]
 gi|328938415|gb|EGG34804.1| putative nitrate/nitrite response regulator protein NarL
           [Paenibacillus sp. HGF5]
          Length = 219

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/228 (15%), Positives = 69/228 (30%), Gaps = 20/228 (8%)

Query: 19  RTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIV 78
           R   +       + +  ++  D T        +     G     L    +     +D  +
Sbjct: 7   RVLIIDDSDLAREGIRTILSSDPTFEVVAEGQS-----GEDALELTEIWMPDIILMDIQM 61

Query: 79  SSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVA 138
                 +  + +           ++            L + +         Y     +  
Sbjct: 62  PGMGGLEATKRVKDKF-----PYVKIVMVTVSDDIAHLFDALKR---GAQGYLLKNLNPE 113

Query: 139 RIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWIS 198
                L  +      + R+       LA      F  YD        LT RE E L  ++
Sbjct: 114 SWHEYLKAIAVDEAPVSRE-------LAFRILKEFSQYDKPDPSKSPLTAREKEILGLVA 166

Query: 199 EGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EG ++ +I+  L IS NTV N++ +I++K   + R     YA     +
Sbjct: 167 EGLSNRDISSDLCISENTVKNHLKNILQKLHLENRVQLTRYAFEQGWM 214


>gi|239820479|ref|YP_002947664.1| transcriptional regulator, LuxR family [Variovorax paradoxus S110]
 gi|239805332|gb|ACS22398.1| transcriptional regulator, LuxR family [Variovorax paradoxus S110]
          Length = 235

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 43/228 (18%), Positives = 78/228 (34%), Gaps = 12/228 (5%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           D+L R+           ++      +G  H       L    +  +++ S +     R  
Sbjct: 7   DVLGRLDEASEPSQVLAQVSVAARQLGFEHCAYGLRTLVPFTRPKTLMFSTYDERWSRRY 66

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTLP--------ENITPPAGMDNRYCSLTFDVARIRI 142
             +   +    +        PV  +           +     G+   +    F+      
Sbjct: 67  ISAGYLQVDPTVAHGVHSGTPVIWSNEVFRDAPQMWDEARSFGLRVGWAQSVFEPDARVG 126

Query: 143 GLMLLFPKGRIILRDRLWEIGLLAAYQANMFKS----YDVHWGKDFELTGREVECLTWIS 198
            L L      +   +   +  L         ++              LT R+VE L W  
Sbjct: 127 MLSLARSSEPLTAAEMRAKDLLFQGLVNKAHRAFCRLLGGPLAGIEPLTKRQVEVLRWTG 186

Query: 199 EGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +GKTSDEIA IL IS+ TV+ ++ + M +    T+S A A+A R  ++
Sbjct: 187 DGKTSDEIAAILCISKPTVDFHLRNAMARLGASTKSSAAAFASRLGLL 234


>gi|194364877|ref|YP_002027487.1| two component LuxR family transcriptional regulator
           [Stenotrophomonas maltophilia R551-3]
 gi|194347681|gb|ACF50804.1| two component transcriptional regulator, LuxR family
           [Stenotrophomonas maltophilia R551-3]
          Length = 213

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 78/239 (32%), Gaps = 27/239 (11%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + + L  +       +  L    D +  +                    G     L+   
Sbjct: 2   IRVCLVDDQTLVRQGIRSLLALDDGIEVVAEAGD---------------GRQAVELIPQV 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      + ++ ++  E        Q P  +    F      +       
Sbjct: 47  RPDVVLMDMRMPVMSGLEALQMLSRQE--------QLPPTIILTTFDDDQLVLAGLKAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y      +A++   +  +   G ++       +     +  N F S      +   LT
Sbjct: 99  KGYLLKDVTLAQLVGAIRTVADGGSLVQPAVTQRLLSGLEHMRNDFVSL----DRPDPLT 154

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  ++ G ++ EIA  LG++  T+ N++++I+ K   + R+ A+  A    +V
Sbjct: 155 DRETEILRLMASGFSNKEIANSLGVAEGTIKNHVSNILSKLGVRDRTRAVLKAFELQLV 213


>gi|313884941|ref|ZP_07818693.1| putative oxygen regulatory protein NreC [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312619632|gb|EFR31069.1| putative oxygen regulatory protein NreC [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 211

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 38/239 (15%), Positives = 76/239 (31%), Gaps = 31/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  + E     VS   +  D +  +                    G   + L    
Sbjct: 2   IKVILVDDHEMVRLGVSSYLSIQDDIEVIGEAAN---------------GLEGYHLAVEL 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++      +  + +             +   +    F    +         
Sbjct: 47  KPDIILMDLVMDVMDGIEATQRIMQDW--------PQAKIIIVTSFLDDEKVYPALEAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y   T     I   +   +   +++  +      LLA    +             ELT
Sbjct: 99  KSYILKTSSAKEIAEAIRETYSGEQVMDDEV--NDILLAKDIKDSQPQLHD------ELT 150

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  I++G ++ EIA  L I+  TV  ++++I+ K     R+ A  YA ++ +V
Sbjct: 151 RREYEVLLLIAKGYSNQEIADELFITLKTVKTHVSNILAKLEVSDRTQATIYAYQHKLV 209


>gi|47565618|ref|ZP_00236658.1| MW1789 [Bacillus cereus G9241]
 gi|47557254|gb|EAL15582.1| MW1789 [Bacillus cereus G9241]
          Length = 211

 Score =  133 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 35/220 (15%), Positives = 67/220 (30%), Gaps = 16/220 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           L    D       L   +        + E   G   F  VR +      +D  +      
Sbjct: 5   LLLVEDHHIVRRGLVFFLKTREEFEIVGEAGNGEEAFTFVRTERPDIVLMDLSMPKMDGI 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +  + +      +Y   ++         F      I       + Y        ++   +
Sbjct: 65  EATKRI-----KQYDETIKILILSS---FSEQDYVIPALEAGADGYQLKEVQPEQLVASI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
           + +              +                       LT RE E L  I++G+++ 
Sbjct: 117 VAVHQGNANFHPKITPAL-------LGRSAVKKEKENPFSMLTKREQEVLREIAKGRSNK 169

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EIA  L I+  TV  ++++I+ K     R+ A  YAV++ 
Sbjct: 170 EIAAELHITEQTVKTHVSNILAKLEVDDRTQAALYAVKHG 209


>gi|149182159|ref|ZP_01860641.1| YhcZ [Bacillus sp. SG-1]
 gi|148850110|gb|EDL64278.1| YhcZ [Bacillus sp. SG-1]
          Length = 213

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 31/222 (13%), Positives = 65/222 (29%), Gaps = 16/222 (7%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D       L   +     +  + E   G     +          +D ++     
Sbjct: 4   RVLIADDHHVVRRGLVFFLKTQKDIEIVGEASNGREAVDMAGKLQPHLILMDLVMPEMDG 63

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
               + +           ++         F      I         Y     +   +   
Sbjct: 64  IQATKLIKNQH-----PNIEIMM---LTSFSDQDHVIPAIEAGAAGYQLKDIEPDELVDS 115

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           +  L      +             +        +    +  +LT RE + L  +++GK++
Sbjct: 116 IRKLVRGENSLHPKATN-------HLLKRVSRKNQPPHQIHQLTNRERDVLKELAKGKSN 168

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
            EIA  L I+  TV  +I++I  K     R+ A  YAV++ +
Sbjct: 169 KEIAASLYITEKTVKTHISNIFAKLEVSDRTQAALYAVKHGL 210


>gi|190573276|ref|YP_001971121.1| putative two-component response regulator transcriptional regulator
           [Stenotrophomonas maltophilia K279a]
 gi|190011198|emb|CAQ44808.1| putative two-component response regulator transcriptional
           regulatory protein [Stenotrophomonas maltophilia K279a]
          Length = 213

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 78/239 (32%), Gaps = 27/239 (11%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + + L  +       +  L    D +  +                    G     L+   
Sbjct: 2   IRVCLVDDQTLVRQGIRSLLALDDGIEVVAEAGD---------------GRQAVELIPQV 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      + ++ ++  E        Q P  +    F      +       
Sbjct: 47  RPDVVLMDMRMPVMSGLEALQVLSRQE--------QLPPTIILTTFDDDQLVLAGLKAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y      +A++   +  +   G ++       +     +  N F S      +   LT
Sbjct: 99  KGYLLKDVTLAQLVGAIRTVAEGGSLVQPAVTQRLLSGLEHMRNEFVSL----DRPDPLT 154

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  ++ G ++ EIA  LG++  T+ N++++I+ K   + R+ A+  A    +V
Sbjct: 155 DRETEILRLMASGFSNKEIANSLGVAEGTIKNHVSNILSKLGVRDRTRAVLKAFELQLV 213


>gi|294500004|ref|YP_003563704.1| two-component response regulator [Bacillus megaterium QM B1551]
 gi|294349941|gb|ADE70270.1| two-component response regulator [Bacillus megaterium QM B1551]
          Length = 213

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 29/242 (11%), Positives = 70/242 (28%), Gaps = 30/242 (12%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
           +Q   I++  +       +  +    +    +                    G     L 
Sbjct: 1   MQPFRILIVDDHAHAREGIRDILEEYEDFIIVGEGTN---------------GQEAIELT 45

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
              +     +D  +      +  + +                 +   V   + +      
Sbjct: 46  EKLMPDIVLMDIGMPVMDGLEATKQIKFR--------FPYVKIVVITVSDDITDLFDALK 97

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
                Y             L         + ++       +A      F         D 
Sbjct: 98  KGAQGYLLKNLQSEVWYDYLRAFALDEVPMSKE-------IAFQILKEFPQETSITKPDT 150

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            L+ RE+E L  +++G ++ +I+  L IS +TV +++ +I+ K   + R    +YA +N 
Sbjct: 151 PLSARELEVLQLVAKGLSNRDISAQLFISEHTVKSHLKNILSKLHLENRVQLTSYAFQNG 210

Query: 245 IV 246
           ++
Sbjct: 211 LM 212


>gi|260467388|ref|ZP_05813560.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|259028848|gb|EEW30152.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
          Length = 242

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/223 (17%), Positives = 69/223 (30%), Gaps = 16/223 (7%)

Query: 36  MIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDS-IVSSDWPFDLVRCMALSE 94
           +       +         E  G  +FL+    +         I++  W  +        E
Sbjct: 16  IDTARSAEAILHEFRLAMERYGLRNFLITGLPVPHGTDWQREILADGWSPEWHHRYVSEE 75

Query: 95  KDKYYNVLQRPTELFCPVFHTLP------------ENITPPAGMDNRYCSLTFDVARIRI 142
              +   + +      P                   +     GM    C           
Sbjct: 76  YFLHDPCVAQCRHSPEPFRWAELPAARLVARAKLVMDEAAEFGMKEGICVPIHVPLAGPG 135

Query: 143 GLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWG--KDFELTGREVECLTWISEG 200
            ++ +      +    +  I  L  +               +   LT RE E L W ++G
Sbjct: 136 -VVTMASDRMDVPPSAMPLIETLCVHTFRSLSGLGTPGDGYEPTPLTARERELLEWSAQG 194

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
           K++D+IA ILG++RNTV ++  +I  K      + AI  A+R 
Sbjct: 195 KSTDDIACILGVTRNTVESHQRNIRAKLDAINVAHAIVKALRR 237


>gi|49081930|gb|AAT50365.1| PA1898 [synthetic construct]
          Length = 238

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/233 (15%), Positives = 72/233 (30%), Gaps = 14/233 (6%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
            R   L  +  +     +   +  +    G   F       F          S++P +  
Sbjct: 4   EREGYLEILSRITTEEEFFSLVLEICGNYGFEFFSFGARAPFPLTAPKYHFLSNYPGEWK 63

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFH--------TLPENITPPAGMDNRYCSLTFDVAR 139
                 +      +++     + P+                    G+ + +         
Sbjct: 64  SRYISEDYTSIDPIVRHGLLEYTPLIWNGEDFQENRFFWEEALHHGIRHGWSIPVRGKYG 123

Query: 140 IRIGLMLLFPKGRIILRDRLWE------IGLLAAYQANMFKSYDVHWGKDFELTGREVEC 193
           +   L L+     I   + L +      I  +         +  +    +  LT RE E 
Sbjct: 124 LISMLSLVRSSESIAATEILEKESFLLWITSMLQATFGDLLAPRIVPESNVRLTARETEM 183

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W + GKT  EI +IL I + TV  +I + +RK  +  ++ A   A    ++
Sbjct: 184 LKWTAVGKTYGEIGLILSIDQRTVKFHIVNAVRKLNSSNKAEATMKAYAIGLL 236


>gi|251795413|ref|YP_003010144.1| LuxR family transcriptional regulator [Paenibacillus sp. JDR-2]
 gi|247543039|gb|ACT00058.1| two component transcriptional regulator, LuxR family [Paenibacillus
           sp. JDR-2]
          Length = 235

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/239 (15%), Positives = 69/239 (28%), Gaps = 23/239 (9%)

Query: 18  QRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI 77
            R   V   P   + +  +I  D          +  E                +   D +
Sbjct: 8   IRVFLVDDHPHGREGMREIIGADPEFMVVGEAASGEEA----------IARIDDVLPDLV 57

Query: 78  VSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           +       +    A  +    Y  L+            L E I         Y       
Sbjct: 58  LMDINMPGMGGLEATQQLKYLYPSLKIVMVTVSDDITHLFEAIKR---GAQGYLFKNLSP 114

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQAN----------MFKSYDVHWGKDFELT 187
           +  R  L  +      + ++  + +       A+                        LT
Sbjct: 115 SAWREYLRAVVDDEAPMSKEIAFRLLQEFTSAASNGIKPAKTGSKPGHAGDASAMTTPLT 174

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE + L  +  G+++ EIAV  G+S +TV N++ +I++K     R     YA    ++
Sbjct: 175 AREKDILERVVTGESNKEIAVAFGLSEHTVKNHLKNILQKLHLDNRVQLTRYAYEQGML 233


>gi|298246329|ref|ZP_06970135.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
 gi|297553810|gb|EFH87675.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
          Length = 233

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/235 (16%), Positives = 75/235 (31%), Gaps = 16/235 (6%)

Query: 17  EQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTE-YVGASHFLLVRWDLFQEQKLD 75
           +++   + H+    D       L   +        ++E   G                LD
Sbjct: 8   KRKAQTMIHILLADDHPIVREGLRAVLETQPDFEVISECASGDEVIRQAELLKPDILLLD 67

Query: 76  SIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTF 135
             +      + ++ +            Q    +    F T    I       + Y     
Sbjct: 68  LEMPIMDGVEAIKQLRQRR--------QNARIIVFTAFDTDERIIHAIQAGADGYLLKGS 119

Query: 136 DVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYD----VHWGKDFELTGREV 191
               I   + L    G ++      ++     +     +  +        +  ELT RE+
Sbjct: 120 PRDEIFKAIRLAMEGGSLLQPLVASKL---LRHMGQRERENNYRTLQGIPRVEELTEREL 176

Query: 192 ECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E L  +++G  + EIA  L IS  T   +++SIM K     R+ A+A A +  ++
Sbjct: 177 EVLRLLAQGMPNKEIASHLVISERTAKFHVSSIMSKLGATNRTEAVALAAQRGLI 231


>gi|320160284|ref|YP_004173508.1| NarL family two-component response regulator [Anaerolinea
           thermophila UNI-1]
 gi|319994137|dbj|BAJ62908.1| NarL family two-component response regulator [Anaerolinea
           thermophila UNI-1]
          Length = 216

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 32/222 (14%), Positives = 65/222 (29%), Gaps = 15/222 (6%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D       +   +     +  + E   G     L    +     +D I+      
Sbjct: 6   VLIVDDHSIVRAGIRTYLETQSDLEVVGEAASGKEAVQLAAELVPDVILMDLIMPEMDGV 65

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +  + +          +  R   +    FH               Y         +   +
Sbjct: 66  EATQRVRQ--------ISPRTQVIVLTSFHEDTHIFPAIKAGALSYLLKDVSAEELGEAI 117

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
                   ++       +         M  +          LT RE E L  I++G ++ 
Sbjct: 118 RAAARGEAVLHPQVAARL------VKEMRGTPAEKPNPYTALTEREQEVLKCIAQGMSNA 171

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA  L +S  TV  ++++I+ K     R+ A  YA +  ++
Sbjct: 172 EIAAHLVVSEKTVKGHVSNILSKLHLADRTQAAIYAWKEGLI 213


>gi|239933765|ref|ZP_04690718.1| two component system response regulator [Streptomyces ghanaensis
           ATCC 14672]
          Length = 212

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 31/209 (14%), Positives = 75/209 (35%), Gaps = 3/209 (1%)

Query: 39  LDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKY 98
           +    +  +   +  + VG +       +L +    D ++   W  ++    A     + 
Sbjct: 2   VRAGFAALLAAQSDIDVVGEAPDGAQGVELSRRTHPDVVLMDVWMPEMDGLEAARRLLEP 61

Query: 99  YNVL-QRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRD 157
              +  RP  L    F              + +       A +   + ++     ++   
Sbjct: 62  APGVTHRPRVLMLTTFDVDDYVYEALRAGASGFLLKNAPPADLIAAVRVVASGDALLAPS 121

Query: 158 RLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTV 217
               +  +A +             +   LT RE E LT ++ G+++ EIA  L ++  TV
Sbjct: 122 VTRRL--IADFAKQRPAVRGKPALRLKGLTERETEVLTLVARGQSNGEIAQTLVLAEQTV 179

Query: 218 NNYIASIMRKTATKTRSGAIAYAVRNNIV 246
             +++ ++ K   + R+ A+ +A  + +V
Sbjct: 180 KTHVSRVLTKLDLRDRAQAVVFAYESGLV 208


>gi|315302505|ref|ZP_07873346.1| sensory transduction protein LiaR [Listeria ivanovii FSL F6-596]
 gi|313629123|gb|EFR97415.1| sensory transduction protein LiaR [Listeria ivanovii FSL F6-596]
          Length = 212

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 79/239 (33%), Gaps = 31/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  + E     VS   +  D +  +   +                G     +    
Sbjct: 2   IKVLLVDDHEMVRIGVSAYLSVQDDMEVIGEAEN---------------GRQGADMALEL 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++      +  + +            +    +    F    +         
Sbjct: 47  RPDIILMDLVMDEMDGIEATKEIMQKW--------KEAKIIIVTSFIDDEKVYPALEAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + Y   T   + I   +   +    ++  +   ++            +         +LT
Sbjct: 99  SSYMLKTSTASEIADAIRATYGGDSVLEPEVTGKMMQRL--------TAKPEKNLHDDLT 150

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA ++++V
Sbjct: 151 NRENEILLLIAEGKSNQEIADELFITLKTVKTHVSNILSKLDVQDRTQAAIYAFKHDLV 209


>gi|308235176|ref|ZP_07665913.1| response regulator receiver domain protein [Gardnerella vaginalis
           ATCC 14018]
          Length = 240

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/241 (14%), Positives = 75/241 (31%), Gaps = 23/241 (9%)

Query: 23  VSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSD 81
           V  +    D           ++    M  + +   G     +   +      +D  + + 
Sbjct: 6   VIRVAIADDQELVRAGFAMVINSQKDMQVVAQASNGNEIVEVASKENPDVILMDVRMPNM 65

Query: 82  WPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIR 141
              +  R +   + +           +    F      +       + +     +   + 
Sbjct: 66  DGLEATRKILQEDANSN------THIIILTTFDLDEYVMAAIHTGASGFLLKDTEPETLL 119

Query: 142 IGLMLLFPKGRIILRDRLWEIGL----------LAAYQANMFKSYDVHWGKDF------E 185
             +  ++    II       +            +A+ + N   +       +       +
Sbjct: 120 NSIRTVYQGNAIIAPTATKRLIESMISKPSNESIASEEENTENASRSKQNANAYNSYLND 179

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  I+ G ++ EIA  L IS  TV  ++A I+ K   + R  A+ +A  N +
Sbjct: 180 LTDREREVLIEIAHGLSNQEIADKLFISLPTVKTHVAHILGKIDARDRVQAVVFAYENGL 239

Query: 246 V 246
           V
Sbjct: 240 V 240


>gi|171743289|ref|ZP_02919096.1| hypothetical protein BIFDEN_02418 [Bifidobacterium dentium ATCC
           27678]
 gi|171278903|gb|EDT46564.1| hypothetical protein BIFDEN_02418 [Bifidobacterium dentium ATCC
           27678]
          Length = 248

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/253 (15%), Positives = 74/253 (29%), Gaps = 23/253 (9%)

Query: 12  LNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQE 71
           ++ E   R              A +I     +    +        GA    L        
Sbjct: 1   MSEEQRIRVIIADDQELVRAGFAMVIGSQPDMMVAGQAR-----DGAEAVALAETLHPDV 55

Query: 72  QKLDSIVSSDWPFDLVRCMALSEKDKYYNVL----QRPTELFCPVFHTLPENITPPAGMD 127
             +D  +      +  R ++  +            +R   +    F      +       
Sbjct: 56  VLMDVRMPGMDGIEATRQISSLQHRFAATGAQTGPRRTRVIILTTFDLDEYVMAAINAGA 115

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEI--------------GLLAAYQANMF 173
           + +     +   +   +  +F    II       +                + A      
Sbjct: 116 SGFLLKDTEPETLLNSIRTVFQGNAIIAPSATKRLIERMMEGGLTDQDSLTIPASADTAP 175

Query: 174 KSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTR 233
                   +  ELT RE E L  I+ G ++ EIA  L IS  TV  ++A I+ K   + R
Sbjct: 176 SRPAYTDPELDELTDREREVLIEIAHGLSNQEIADRLFISLPTVKTHVAHILSKINARDR 235

Query: 234 SGAIAYAVRNNIV 246
             A+ +A  N++V
Sbjct: 236 VQAVVFAYENHLV 248


>gi|205372705|ref|ZP_03225516.1| two-component response regulator [Bacillus coahuilensis m4-4]
          Length = 212

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 76/239 (31%), Gaps = 33/239 (13%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++   + E     VS   +  + +  +   +                G+    L    
Sbjct: 2   IRVLFVDDHEMVRIGVSAYLSSQEDIQVVGEAED---------------GSEAIGLALTL 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++      +  R +                 +    F    +         
Sbjct: 47  RPDIILMDLVMKKMDGIEATRNIIEKW--------PEAKIIIVTSFIDDEKVYPALEAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y   T   + I   +        I+  +   ++                      ELT
Sbjct: 99  TSYMLKTSKASDIADAIRKTHGGQSILEPEVTGKM----------MSRMRKPSHPHEELT 148

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE+E L  ++EGKT+ EI   L I+  TV  ++++I+ K   + R+ A+ YA ++++V
Sbjct: 149 NREMEILLLMAEGKTNSEIGEDLFIAHKTVKTHVSNILSKLGVQDRTQAVIYAFQHSLV 207


>gi|182438916|ref|YP_001826635.1| putative two-component system response regulator [Streptomyces
           griseus subsp. griseus NBRC 13350]
 gi|326779572|ref|ZP_08238837.1| two component transcriptional regulator, LuxR family [Streptomyces
           cf. griseus XylebKG-1]
 gi|178467432|dbj|BAG21952.1| putative two-component system response regulator [Streptomyces
           griseus subsp. griseus NBRC 13350]
 gi|326659905|gb|EGE44751.1| two component transcriptional regulator, LuxR family [Streptomyces
           cf. griseus XylebKG-1]
          Length = 229

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/229 (15%), Positives = 69/229 (30%), Gaps = 9/229 (3%)

Query: 18  QRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI 77
            R   V          A ++     +             G     + R        +D  
Sbjct: 3   IRVIIVDDQAMVRAGFAALLSAQSDIDVVGEA-----ADGRQGVDVSRNQHPDVVLMDVR 57

Query: 78  VSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           +         R +     +    V+ RP  L    F              + +       
Sbjct: 58  MPEMDGLAAAREL----LNPPVGVVHRPKVLMLTTFDVDDYVYEALRAGASGFLLKDAPP 113

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
           A +   + ++     ++       +    A Q     +      +   LT RE E L  I
Sbjct: 114 ADLIAAVRVVAAGDALLAPSVTRRLIADFAAQRPSGATRGGQALRRHGLTPRESEVLELI 173

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + G ++ EIA  L ++  TV  +I  ++ K   + R+ A+ +A  + +V
Sbjct: 174 ARGLSNQEIAGRLVLAEQTVKTHIGRVLAKLDLRDRAQAVIFAYESGLV 222


>gi|199597190|ref|ZP_03210622.1| DNA-binding response regulator, CitB family (Rec-wHTH domains)
           [Lactobacillus rhamnosus HN001]
 gi|258508705|ref|YP_003171456.1| two-component response regulator [Lactobacillus rhamnosus GG]
 gi|199591994|gb|EDZ00069.1| DNA-binding response regulator, CitB family (Rec-wHTH domains)
           [Lactobacillus rhamnosus HN001]
 gi|257148632|emb|CAR87605.1| Two-component response regulator [Lactobacillus rhamnosus GG]
 gi|259650011|dbj|BAI42173.1| two-component response regulator [Lactobacillus rhamnosus GG]
          Length = 221

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 77/239 (32%), Gaps = 33/239 (13%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + +++  + E     +S        L  +   +                G     +   D
Sbjct: 2   IKVLIVDDHEMVRLGLSTYIGVQPDLEVVDQAEN---------------GQEGVEMALKD 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++      +  + +  +          +   +    F    +         
Sbjct: 47  RPDIILMDLVMPVKDGIEATKEILKAW--------PQARIIILTSFIDDAKVYPAMEAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y   T     I   +       R++      ++              +    +  ELT
Sbjct: 99  ASYILKTATAEEIAKAIRQTASGERVLEPQVTTKM----------MNRMNHPQSQYDELT 148

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  I++GK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA+++ +V
Sbjct: 149 NREREVLQLIAQGKSNQEIATELFITLKTVKTHVSNILAKLDVEDRTQAAIYALKHGLV 207


>gi|21221451|ref|NP_627230.1| two-component system response regulator [Streptomyces coelicolor
           A3(2)]
 gi|256787364|ref|ZP_05525795.1| two-component system response regulator [Streptomyces lividans
           TK24]
 gi|289771263|ref|ZP_06530641.1| two-component system response regulator [Streptomyces lividans
           TK24]
 gi|7799203|emb|CAB90919.1| putative two-component system response regulator [Streptomyces
           coelicolor A3(2)]
 gi|289701462|gb|EFD68891.1| two-component system response regulator [Streptomyces lividans
           TK24]
          Length = 252

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/234 (16%), Positives = 76/234 (32%), Gaps = 15/234 (6%)

Query: 13  NREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQ 72
            RE+  R   V         L  ++  +  +          E V  +  LL         
Sbjct: 31  AREEPIRVLVVDDHALFRRGLEIVLAAEEDIQVVGEAGDGAEAVEKAADLL-----PDIV 85

Query: 73  KLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCS 132
            +D  +      +    +          V      +   +     +           Y  
Sbjct: 86  LMDVRMPKRGGIEACTSIKE--------VAPSAKIIMLTISDEEADLYDAIKAGATGYLL 137

Query: 133 LTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVE 192
                  +   +  +      I      ++  L  +++ + ++ +        LT RE+E
Sbjct: 138 KEISTDEVATAIRAVADGQSQISPSMASKL--LTEFKSMIQRTDERRLVPAPRLTDRELE 195

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I+
Sbjct: 196 VLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKIL 249


>gi|228991252|ref|ZP_04151210.1| DNA-binding response regulator [Bacillus pseudomycoides DSM 12442]
 gi|228997351|ref|ZP_04156973.1| DNA-binding response regulator [Bacillus mycoides Rock3-17]
 gi|229004976|ref|ZP_04162703.1| DNA-binding response regulator [Bacillus mycoides Rock1-4]
 gi|228756324|gb|EEM05642.1| DNA-binding response regulator [Bacillus mycoides Rock1-4]
 gi|228762443|gb|EEM11368.1| DNA-binding response regulator [Bacillus mycoides Rock3-17]
 gi|228768476|gb|EEM17081.1| DNA-binding response regulator [Bacillus pseudomycoides DSM 12442]
          Length = 211

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 34/222 (15%), Positives = 68/222 (30%), Gaps = 16/222 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           L    D       L   +        + E   G      VR +      +D  +      
Sbjct: 5   LLLVEDHHIVRRGLVFFLKTKEEFEIIGEAENGEEALAFVRKERPDVVLMDLSMPKMDGI 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +  +        +Y   ++         F      +       + Y        ++   +
Sbjct: 65  EATKR-----LKQYDATIKILMLSS---FSEQDYVLPAMEAGADGYQLKEVQPDQLVASI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
           + +              +              +        LT RE E L  I++G+++ 
Sbjct: 117 IAVHQGNANFHPKVTPAL-------LGRPAVKEEKKDSFSMLTKREKEVLREIAKGRSNK 169

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA  L I+  TV  ++++++ K     R+ A  YAV+N +V
Sbjct: 170 EIAAELHITEQTVKTHVSNVLAKLEVDDRTQAALYAVKNGVV 211


>gi|182375406|emb|CAQ15951.1| vR protein [Pseudomonas fuscovaginae]
          Length = 239

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/233 (17%), Positives = 73/233 (31%), Gaps = 17/233 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           D    ++      +W   +    + +G S  L       + Q   + + S++P       
Sbjct: 5   DECIELLSAMDARTWFQSLVLSVQKLGYSQVLYALKPNKEAQNSTARIMSNFPDAWRDLY 64

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTL----------PENITPPAGMDNRYCSLTFDVARI 140
                     V+        P+                     AG+ +            
Sbjct: 65  DNENYSSIDPVVSHSFSSSLPILWEDKLYKTRREKEFAEDARRAGLSHGLTLPIHGPQGQ 124

Query: 141 RIGLMLLFP-----KGRIILRDRLWEIGLLAAYQANMFKSY--DVHWGKDFELTGREVEC 193
              L L        +   +L+  +    +L  Y      S            LT RE+E 
Sbjct: 125 VGMLSLSCAPMPQNEYLQVLQHSIAAASMLRDYAVTSGSSLFLHNSSSTAPHLTPRELEI 184

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W    KT+ EI  IL ++  TV  +  +I RK    +R  A+A A++ +++
Sbjct: 185 LHWAWAEKTTWEIGKILSLAEPTVEFHFKNIRRKLNVSSRRLAVARAIQLDLM 237


>gi|307324556|ref|ZP_07603763.1| two component transcriptional regulator, LuxR family [Streptomyces
           violaceusniger Tu 4113]
 gi|306889800|gb|EFN20779.1| two component transcriptional regulator, LuxR family [Streptomyces
           violaceusniger Tu 4113]
          Length = 225

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 29/229 (12%), Positives = 66/229 (28%), Gaps = 13/229 (5%)

Query: 18  QRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI 77
            R                ++  +  +    +        GA     V         +D  
Sbjct: 5   IRVLIADDQMMVRQGFTVLLNAEPDIEVVGQA-----VDGADAIDQVAELAPDVVLMDIR 59

Query: 78  VSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           +      +  R +                 L    F              + +       
Sbjct: 60  MPGVGGIEATRRLTE-------PAGATVKILVLTTFDLDEYVYEALRAGASGFLLKDASA 112

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
             +   + ++     ++  +    +    +   +          +  +LT RE E LT I
Sbjct: 113 DELAHAVRVVAAGDALLAPNITKRLIGEFSRV-SAAAPRGPLRDRVGDLTERETEVLTLI 171

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           ++G ++ EIA  L ++  TV  +++ I+ K   + R+ A  +A    +V
Sbjct: 172 AQGLSNAEIAARLVVAEQTVKTHVSRILFKLGLRDRTQAAVFAYETGLV 220


>gi|291616969|ref|YP_003519711.1| SdiA [Pantoea ananatis LMG 20103]
 gi|291151999|gb|ADD76583.1| SdiA [Pantoea ananatis LMG 20103]
 gi|327393397|dbj|BAK10819.1| cell division activating regulatory protein SdiA [Pantoea ananatis
           AJ13355]
          Length = 240

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/226 (17%), Positives = 74/226 (32%), Gaps = 15/226 (6%)

Query: 35  RMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSE 94
               L  T      +    + +G  +F           +    +   +P   ++      
Sbjct: 16  HFQALATTQQLKGLLQDYIQSLGFDYFAFFIQHRVPFTRPRVYLHDTYPKLWIKRYKEQN 75

Query: 95  KDKYYNVLQRPTELFCPVFHT--------LPENITPPAGMDNRYCSLTFDVARIRIGLML 146
                 VLQ        V  T                 G+ + +        R    ++ 
Sbjct: 76  YYAIDPVLQLCLRSGKGVEWTPELFSSAKEMWQDACNFGLLSGFSCSAMASNRAVG-ILS 134

Query: 147 LFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF------ELTGREVECLTWISEG 200
           +  K   I   R  E+ +   + A    S       +       + + RE+E L W +EG
Sbjct: 135 IGSKRPFITGSRRVELEVKLHFLAEQSLSLLERLNDEALMVQGNDFSQRELEILRWTAEG 194

Query: 201 KTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           KTS EI++IL IS +TVN Y  ++ ++     ++    YA    ++
Sbjct: 195 KTSQEISLILSISEHTVNFYQKNMKKRFNVSNKTQIACYAAAIGLI 240


>gi|16129863|ref|NP_416426.1| quorum-sensing transcriptional activator [Escherichia coli str.
           K-12 substr. MG1655]
 gi|89108751|ref|AP_002531.1| DNA-binding transcriptional activator [Escherichia coli str. K-12
           substr. W3110]
 gi|170081564|ref|YP_001730884.1| DNA-binding transcriptional activator [Escherichia coli str. K-12
           substr. DH10B]
 gi|238901125|ref|YP_002926921.1| DNA-binding transcriptional activator [Escherichia coli BW2952]
 gi|253773131|ref|YP_003035962.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|2506570|sp|P07026|SDIA_ECOLI RecName: Full=Regulatory protein SdiA
 gi|1736575|dbj|BAA15736.1| DNA-binding transcriptional activator [Escherichia coli str. K12
           substr. W3110]
 gi|1788224|gb|AAC74983.1| quorum-sensing transcriptional activator [Escherichia coli str.
           K-12 substr. MG1655]
 gi|169889399|gb|ACB03106.1| DNA-binding transcriptional activator [Escherichia coli str. K-12
           substr. DH10B]
 gi|238860878|gb|ACR62876.1| DNA-binding transcriptional activator [Escherichia coli BW2952]
 gi|253324175|gb|ACT28777.1| transcriptional regulator, LuxR family [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|260448967|gb|ACX39389.1| transcriptional regulator, LuxR family [Escherichia coli DH1]
 gi|315136553|dbj|BAJ43712.1| DNA-binding transcriptional activator SdiA [Escherichia coli DH1]
          Length = 240

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/231 (16%), Positives = 70/231 (30%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   ++        +    + +   ++ L         +      +++P   V 
Sbjct: 10  RRTMLLRFQRMETAEEVYHEIELQAQQLEYDYYSLCVRHPVPFTRPKVAFYTNYPEAWVS 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVARI 140
                       VL         +                    G+            R 
Sbjct: 70  YYQAKNFLAIDPVLNPENFSQGHLMWNDDLFSEAQPLWEAARAHGLRRGVTQYLMLPNRA 129

Query: 141 RIGLMLL---FPKGRIILRDRLWEIGLLAAYQANMFKSYDV--HWGKDFELTGREVECLT 195
              L        +  I+  +   ++ LL           +       +   + RE E L 
Sbjct: 130 LGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREKEILR 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|15802351|ref|NP_288377.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 EDL933]
 gi|15831908|ref|NP_310681.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. Sakai]
 gi|168751842|ref|ZP_02776864.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4113]
 gi|168758227|ref|ZP_02783234.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4401]
 gi|168771520|ref|ZP_02796527.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4486]
 gi|168777340|ref|ZP_02802347.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4196]
 gi|168790328|ref|ZP_02815335.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC869]
 gi|168802260|ref|ZP_02827267.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC508]
 gi|195939220|ref|ZP_03084602.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. EC4024]
 gi|208810274|ref|ZP_03252150.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4206]
 gi|208816575|ref|ZP_03257695.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4045]
 gi|208820421|ref|ZP_03260741.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4042]
 gi|209399275|ref|YP_002271030.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4115]
 gi|217329032|ref|ZP_03445113.1| regulatory protein SdiA [Escherichia coli O157:H7 str. TW14588]
 gi|254793566|ref|YP_003078403.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. TW14359]
 gi|261227589|ref|ZP_05941870.1| DNA-binding transcriptional activator [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261255819|ref|ZP_05948352.1| DNA-binding transcriptional activator [Escherichia coli O157:H7
           str. FRIK966]
 gi|291283093|ref|YP_003499911.1| DNA-binding transcriptional activator [Escherichia coli O55:H7 str.
           CB9615]
 gi|12516014|gb|AAG56931.1|AE005414_8 transcriptional regulator of ftsQAZ gene cluster [Escherichia coli
           O157:H7 str. EDL933]
 gi|13362122|dbj|BAB36077.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli
           O157:H7 str. Sakai]
 gi|187767387|gb|EDU31231.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4196]
 gi|188014167|gb|EDU52289.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4113]
 gi|189354905|gb|EDU73324.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4401]
 gi|189359736|gb|EDU78155.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4486]
 gi|189370214|gb|EDU88630.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC869]
 gi|189375707|gb|EDU94123.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC508]
 gi|208724790|gb|EDZ74497.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4206]
 gi|208730918|gb|EDZ79607.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4045]
 gi|208740544|gb|EDZ88226.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4042]
 gi|209160675|gb|ACI38108.1| regulatory protein SdiA [Escherichia coli O157:H7 str. EC4115]
 gi|209767028|gb|ACI81826.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli]
 gi|209767030|gb|ACI81827.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli]
 gi|209767032|gb|ACI81828.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli]
 gi|209767034|gb|ACI81829.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli]
 gi|209767036|gb|ACI81830.1| transcriptional regulator of ftsQAZ gene cluster [Escherichia coli]
 gi|217318379|gb|EEC26806.1| regulatory protein SdiA [Escherichia coli O157:H7 str. TW14588]
 gi|254592966|gb|ACT72327.1| DNA-binding transcriptional activator [Escherichia coli O157:H7
           str. TW14359]
 gi|290762966|gb|ADD56927.1| DNA-binding transcriptional activator [Escherichia coli O55:H7 str.
           CB9615]
 gi|320647124|gb|EFX15957.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H- str. 493-89]
 gi|320658009|gb|EFX25771.1| DNA-binding transcriptional activator SdiA [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|320658581|gb|EFX26275.1| DNA-binding transcriptional activator SdiA [Escherichia coli O55:H7
           str. USDA 5905]
 gi|320668479|gb|EFX35306.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. LSU-61]
 gi|326342324|gb|EGD66105.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. 1044]
 gi|326344831|gb|EGD68578.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. 1125]
          Length = 240

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/231 (16%), Positives = 70/231 (30%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   ++        +    + +   ++ L         +      +++P   V 
Sbjct: 10  RRTMLLRFQRMETAEEVYHEIELQAQQLEYDYYSLCVRHPVPFTRPKVAFYTNYPEAWVS 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVARI 140
                       VL         +                    G+            R 
Sbjct: 70  YYQAKNFLAIDPVLNPENFSQGHLMWNDDLFNEAQPLWEAARAHGLRRGVTQYLMLPNRA 129

Query: 141 RIGLMLL---FPKGRIILRDRLWEIGLLAAYQANMFKSYDV--HWGKDFELTGREVECLT 195
              L        +  I+  +   ++ LL           +       +   + RE E L 
Sbjct: 130 LGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREKEILR 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|29827472|ref|NP_822106.1| two-component system response regulator [Streptomyces avermitilis
           MA-4680]
 gi|29604571|dbj|BAC68641.1| putative two-component system response regulator [Streptomyces
           avermitilis MA-4680]
          Length = 235

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 34/223 (15%), Positives = 70/223 (31%), Gaps = 10/223 (4%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D       L   V     + A +E   G     L R D      +D  +     
Sbjct: 13  RVLIADDQALLRGSLRVLVDTEPGLVATSEAATGTEAVRLARQDPPDVVLMDVRMPEMDG 72

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
            +  R +                 L   +F              + +       + +   
Sbjct: 73  IEATRQI------CGSPETADVKVLILTMFDLDEYVYAALRAGASGFLLKDTPPSELLAA 126

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           + ++     ++       +  +A +     +           +T RE E LT I+ G ++
Sbjct: 127 VRVIAAGEALLAPAVTRRL--IAEFVH-RPEPSRPLRRTLDGVTEREREVLTLIACGLSN 183

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            EIA  L +   TV  +++ ++ K AT+ R+  +  A  + +V
Sbjct: 184 TEIAERLYLGIATVKTHVSHLLTKLATRDRAQLVIVAYESGLV 226


>gi|218532854|ref|YP_002423670.1| LuxR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218525157|gb|ACK85742.1| transcriptional regulator, LuxR family [Methylobacterium
           chloromethanicum CM4]
          Length = 243

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/233 (18%), Positives = 79/233 (33%), Gaps = 18/233 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDL---FQEQKLDSIVSSDWPFDLV 87
           ++L  +            +      +G  + +     L       + + ++  +   +  
Sbjct: 11  EILKSLDRAHSREDILRAIMPRLNALGIEYVISAMIPLKRLPARTQKNYLILENTSDEWN 70

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTL-------------PENITPPAGMDNRYCSLT 134
           R            V+Q           +                N     G+ + +    
Sbjct: 71  RLYFSKGYMYTDPVVQATLSSTTGFRWSEIEPAGVLDPRSRQVMNEAGEFGLGDGFTVPL 130

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDV-HWGKDFELTGREVEC 193
             +   R GL    P+   I   +   + LLA+Y        D     +   LT RE E 
Sbjct: 131 ATLEEERGGLTFAGPR-LDISPGQRGMLTLLASYVVGQTLLIDNGPSERRMGLTPRERES 189

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W++EGKT  EI  ++GISR+ V+ ++ S   K    +R+ A+A   R  ++
Sbjct: 190 LQWVAEGKTDWEIGELMGISRHGVDFHLRSARVKLGCVSRTQAVAEGFRRGLI 242


>gi|219849670|ref|YP_002464103.1| LuxR family two component transcriptional regulator [Chloroflexus
           aggregans DSM 9485]
 gi|219543929|gb|ACL25667.1| two component transcriptional regulator, LuxR family [Chloroflexus
           aggregans DSM 9485]
          Length = 216

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/223 (16%), Positives = 67/223 (30%), Gaps = 11/223 (4%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D       +   +     +  +     G     L          +D  +     
Sbjct: 3   RILLVDDQTLVRQGIQTLLDLEEDLTVVGAAANGQQALELAEQLQPDVVLMDIRMPVMDG 62

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
               R +                 +    F      I         Y     D   I   
Sbjct: 63  VAATREITRRWPQIG--------VIILTTFDDDEYVIEGLKAGARGYMLKDADSHEIVEA 114

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           + ++     +I      ++  LA +         V       LT RE++ L  I+ GK++
Sbjct: 115 VRIVTRGEALIQPSITRKV--LAEFTRLAGGHTPVTSPLTEPLTEREMDVLHGIAAGKSN 172

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            EIA  L IS  TV N+++S++ K   + R+ AI  A    ++
Sbjct: 173 REIADQLCISEGTVKNHVSSLLAKLDVRDRTQAIIRARELRLI 215


>gi|16800090|ref|NP_470358.1| hypothetical protein lin1021 [Listeria innocua Clip11262]
 gi|16413480|emb|CAC96252.1| lin1021 [Listeria innocua Clip11262]
 gi|313609539|gb|EFR85084.1| sensory transduction protein LiaR [Listeria monocytogenes FSL
           F2-208]
 gi|313619559|gb|EFR91226.1| sensory transduction protein LiaR [Listeria innocua FSL S4-378]
          Length = 212

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 80/239 (33%), Gaps = 31/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  + E     VS   +  D +  +   +                G     +    
Sbjct: 2   IKVLLVDDHEMVRIGVSAYLSVQDDMEVVGEAEN---------------GREGADMALEL 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++      +  + +  +         +    +    F    +         
Sbjct: 47  RPDIILMDLVMDEMDGIEATKEIMKNW--------KEAKIIIVTSFIDDEKVYPALEAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + Y   T   + I   +   +    ++  +   ++            +         +LT
Sbjct: 99  SSYMLKTSTASEIADAIRATYGGDSVLEPEVTGKMMQRL--------TAKPEKNLHDDLT 150

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA ++++V
Sbjct: 151 NRENEILLLIAEGKSNQEIADELFITLKTVKTHVSNILSKLDVQDRTQAAIYAFKHDLV 209


>gi|262203966|ref|YP_003275174.1| response regulator receiver [Gordonia bronchialis DSM 43247]
 gi|262087313|gb|ACY23281.1| response regulator receiver [Gordonia bronchialis DSM 43247]
          Length = 230

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 34/239 (14%), Positives = 69/239 (28%), Gaps = 22/239 (9%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  +     S    L    D +  +                    GA    L R  
Sbjct: 5   IRVLLADDQPLVRSGFGALLDAEDDIDVIAQAGD---------------GAEAIELARSH 49

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 LD  +         R +  +        L     L    F          A   
Sbjct: 50  HPDVAILDIRMPGTDGLTATRTITAN------PDLAEVKVLILTTFELDEYVFEAVAAGA 103

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIG-LLAAYQANMFKSYDVHWGKDFEL 186
           + +         +   + ++     ++       +    A    +         G    L
Sbjct: 104 SGFLVKHTQPEELVRAVRVIAAGDALLSPSVTRRLISRFADAGRSPTTPVTPGGGPVSAL 163

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           T RE E +  +++G +++EIA    +S  TV  +++  M K   + R+  + +A R  +
Sbjct: 164 TERETEVVRLVADGLSNEEIAQRWVVSNATVRTHVSRAMTKLDARDRAQLVVFAYRLGL 222


>gi|92109564|ref|YP_571851.1| LuxR family transcriptional regulator [Nitrobacter hamburgensis
           X14]
 gi|91802646|gb|ABE65019.1| transcriptional regulator, LuxR family [Nitrobacter hamburgensis
           X14]
          Length = 231

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/230 (16%), Positives = 72/230 (31%), Gaps = 16/230 (6%)

Query: 33  LARMIPLDCTVSWTMRMYALTEYVGASHF---LLVRWDLFQEQKLDSIVSSDWPFDLVRC 89
           +  +            +  L    G +     ++        +    I+   +P   +  
Sbjct: 1   MEAVEQTRTAAEIEDCLLGLAAEFGFTGLFGGIVPTRPAPLAELRSRILFQRFPAQWLDR 60

Query: 90  MALSEKDKYYNVLQRPTELFCPVFHT-------------LPENITPPAGMDNRYCSLTFD 136
            +         ++Q       P                 L +      G+ + Y      
Sbjct: 61  YSRKGYVFRDPIIQHLFHERTPFTWHEGYKSCPQRSNVRLIQGEAAEFGLRDGYVVPIST 120

Query: 137 VARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTW 196
           +    + L    P       D        +                +  LT RE +CL W
Sbjct: 121 IDGEIVSLSFGGPGTLPASADLSVLNFAASYALGRHLHRIATWRRVNSNLTAREWDCLLW 180

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
             EGKT+ EI+ ILGIS++TV  +I +   K    +++ AIA A+R  ++
Sbjct: 181 AGEGKTNWEISAILGISKSTVTKHIMAARAKLGAVSKAHAIAMAIRTKLL 230


>gi|291485797|dbj|BAI86872.1| hypothetical protein BSNT_04924 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 211

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/239 (15%), Positives = 69/239 (28%), Gaps = 30/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  + E     ++        +  +                    G+    L    
Sbjct: 2   IRVLLIDDHEMVRMGLAAFLEAQPDIEVIGEASD---------------GSEGVRLAAEL 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++         + +                 +    F    +         
Sbjct: 47  SPDVILMDLVMEGMDGIQATKQICREL---SDP-----KIIVLTSFIDDDKVYPVIEAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y   T   A I   +         +           A    +  +    +      LT
Sbjct: 99  LSYLLKTSKAAEIADAIRAASKGEPKLESKV-------AGKVLSRLRHSGENELPHESLT 151

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE+E L  I+EGKT+ EI   L I+  TV  +I +I+ K     R+ A  YA RN++V
Sbjct: 152 KRELEILFLIAEGKTNKEIGEELFITIKTVKTHITNILSKLDVSDRTQAAVYAHRNHLV 210


>gi|289649319|ref|ZP_06480662.1| LuxR transcriptional regulator [Pseudomonas syringae pv. aesculi
           str. 2250]
          Length = 247

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 33/228 (14%), Positives = 71/228 (31%), Gaps = 23/228 (10%)

Query: 40  DCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYY 99
                          ++G   +        +  K   ++ S++P   ++    S      
Sbjct: 22  APLRQLIEDFENDLHHIGDFTYAYFSTPKTRNVKP--VILSNYPDSWLKSYVASNYHLID 79

Query: 100 NVLQRPTELFCPVFHTLPENIT------------PPAGMDNRYCSLTFDVARIRIGLMLL 147
            +++       P F     N                  + +       D + +   L L 
Sbjct: 80  PIIKHAWHSITPFFWREARNAAQGVETDDFLKRSAKYQLSSGATFTLHDASGLFAALSLC 139

Query: 148 FPKG----RIILRDRLWEIGLLAAYQANMFKSYDVHW-----GKDFELTGREVECLTWIS 198
             +        +R++  +I +      +                  +L+ RE   L W++
Sbjct: 140 NARQQKDFDQRIREKAADIQMSLIRFHDRLIKTRAPHELFPQPAQCKLSTRETGVLKWVA 199

Query: 199 EGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            GK+  EIA I  IS  TV  +++++  K   +T   A+  A+   +V
Sbjct: 200 MGKSYSEIAEIFSISERTVKFHMSNVSSKLEVRTAKQAVYKAINMGMV 247


>gi|302562273|ref|ZP_07314615.1| response regulator, two-component system [Streptomyces griseoflavus
           Tu4000]
 gi|302479891|gb|EFL42984.1| response regulator, two-component system [Streptomyces griseoflavus
           Tu4000]
          Length = 220

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/222 (16%), Positives = 75/222 (33%), Gaps = 10/222 (4%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D +     L   +     +    E   G +   L          +D  +     
Sbjct: 6   RVLVCDDQMLVRTGLVTIIDAQPDLEVAGECGDGRTAVDLAGRLRPDVVVMDVRMPVLDG 65

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
            +  R +A +              L    F+             + +       +++  G
Sbjct: 66  IEATRLLAGAGVPH------PVKVLVVTTFNLDEYVYEALRAGASGFLLKDAPPSQLLHG 119

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           +  +     ++  +   ++       A   +  +    +D  LT RE+E L  I++G ++
Sbjct: 120 IRTVAMGAALLDPEVTRQL---VGRYAARIRPVEDGAPRDLPLTPRELEVLRLIADGLSN 176

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
            EIA  L IS+ TV  +++ I+ K   + R  A+ YA R  +
Sbjct: 177 SEIAAALLISQETVKTFVSRILAKLGLRDRVQAVVYAYRRGL 218


>gi|16803062|ref|NP_464547.1| hypothetical protein lmo1022 [Listeria monocytogenes EGD-e]
 gi|46907254|ref|YP_013643.1| DNA-binding response regulator [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47096354|ref|ZP_00233950.1| DNA-binding response regulator [Listeria monocytogenes str. 1/2a
           F6854]
 gi|217964878|ref|YP_002350556.1| transcriptional regulatory protein DegU (Protease production
           enhancerprotein) [Listeria monocytogenes HCC23]
 gi|224500732|ref|ZP_03669081.1| transcriptional regulatory protein DegU (Protease production
           enhancerprotein) [Listeria monocytogenes Finland 1988]
 gi|224502663|ref|ZP_03670970.1| transcriptional regulatory protein DegU (Protease production
           enhancerprotein) [Listeria monocytogenes FSL R2-561]
 gi|226223640|ref|YP_002757747.1| two-component response regulator [Listeria monocytogenes Clip81459]
 gi|254823705|ref|ZP_05228706.1| DNA-binding response regulator [Listeria monocytogenes FSL J1-194]
 gi|254832231|ref|ZP_05236886.1| two-component response regulator [Listeria monocytogenes 10403S]
 gi|254852518|ref|ZP_05241866.1| DNA-binding response regulator [Listeria monocytogenes FSL R2-503]
 gi|254898804|ref|ZP_05258728.1| two-component response regulator [Listeria monocytogenes J0161]
 gi|254911707|ref|ZP_05261719.1| DNA-binding response regulator [Listeria monocytogenes J2818]
 gi|254931406|ref|ZP_05264765.1| DNA-binding response regulator [Listeria monocytogenes HPB2262]
 gi|254936033|ref|ZP_05267730.1| DNA-binding response regulator [Listeria monocytogenes F6900]
 gi|255520598|ref|ZP_05387835.1| two-component response regulator [Listeria monocytogenes FSL
           J1-175]
 gi|290893828|ref|ZP_06556807.1| DNA-binding response regulator [Listeria monocytogenes FSL J2-071]
 gi|300764232|ref|ZP_07074227.1| DNA-binding response regulator [Listeria monocytogenes FSL N1-017]
 gi|315281752|ref|ZP_07870312.1| sensory transduction protein LiaR [Listeria marthii FSL S4-120]
 gi|16410424|emb|CAC99100.1| lmo1022 [Listeria monocytogenes EGD-e]
 gi|46880521|gb|AAT03820.1| DNA-binding response regulator [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47015312|gb|EAL06249.1| DNA-binding response regulator [Listeria monocytogenes str. 1/2a
           F6854]
 gi|217334148|gb|ACK39942.1| transcriptional regulatory protein DegU (Protease production
           enhancerprotein) [Listeria monocytogenes HCC23]
 gi|225876102|emb|CAS04808.1| Putative two-component response regulator [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|258605826|gb|EEW18434.1| DNA-binding response regulator [Listeria monocytogenes FSL R2-503]
 gi|258608621|gb|EEW21229.1| DNA-binding response regulator [Listeria monocytogenes F6900]
 gi|290556655|gb|EFD90190.1| DNA-binding response regulator [Listeria monocytogenes FSL J2-071]
 gi|293582956|gb|EFF94988.1| DNA-binding response regulator [Listeria monocytogenes HPB2262]
 gi|293589656|gb|EFF97990.1| DNA-binding response regulator [Listeria monocytogenes J2818]
 gi|293592927|gb|EFG00688.1| DNA-binding response regulator [Listeria monocytogenes FSL J1-194]
 gi|300515222|gb|EFK42274.1| DNA-binding response regulator [Listeria monocytogenes FSL N1-017]
 gi|307570563|emb|CAR83742.1| DNA-binding response regulator, LuxR family [Listeria monocytogenes
           L99]
 gi|313614594|gb|EFR88178.1| sensory transduction protein LiaR [Listeria marthii FSL S4-120]
 gi|328466914|gb|EGF38023.1| two-component response regulator [Listeria monocytogenes 1816]
 gi|328475371|gb|EGF46144.1| two-component response regulator [Listeria monocytogenes 220]
 gi|332311431|gb|EGJ24526.1| Transcriptional regulatory protein [Listeria monocytogenes str.
           Scott A]
          Length = 212

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 80/239 (33%), Gaps = 31/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  + E     VS   +  D +  +   +                G     +    
Sbjct: 2   IKVLLVDDHEMVRIGVSAYLSVQDDMEVVGEAEN---------------GREGADMALEL 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++      +  + +  +         +    +    F    +         
Sbjct: 47  RPDIILMDLVMDEMDGIEATKEIMQNW--------KEAKIIIVTSFIDDEKVYPALEAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + Y   T   + I   +   +    ++  +   ++            +         +LT
Sbjct: 99  SSYMLKTSTASEIADAIRATYGGDSVLEPEVTGKMMQRL--------TAKPEKNLHDDLT 150

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA ++++V
Sbjct: 151 NRENEILLLIAEGKSNQEIADELFITLKTVKTHVSNILSKLDVQDRTQAAIYAFKHDLV 209


>gi|311895893|dbj|BAJ28301.1| putative two-component system response regulator [Kitasatospora
           setae KM-6054]
          Length = 225

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 34/229 (14%), Positives = 66/229 (28%), Gaps = 11/229 (4%)

Query: 18  QRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI 77
            R   V          A ++     +             G                +D  
Sbjct: 3   IRVLIVDDQAMVRAGFAALLNAQSDIDVVGDA-----ADGRQAVEASGRTHPDVVLMDVR 57

Query: 78  VSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           +      +  R +     D       RP  L    F              + +       
Sbjct: 58  MPEMDGLEAARRL----LDPPPGTAHRPRVLMLTTFDVDDYVYEALRAGASGFLLKDAPP 113

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
           A +   + ++     ++       +  +A +  N          +   LT RE E L  I
Sbjct: 114 ADLIAAVRVVAAGDALLAPSVTRRL--IADFARNRPAPRRDPRLRLNGLTPRETEVLELI 171

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + G ++ EIA  L ++  TV  ++  I+ K   + R+ A+  A  + +V
Sbjct: 172 ARGLSNQEIAAHLVLAEQTVKTHVGRILGKLDLRDRAQAVVLAYESGLV 220


>gi|7385149|gb|AAF61719.1|AF232769_1 acylhomoserine lactone dependent transcriptional regulator
           [Pseudomonas fluorescens]
          Length = 241

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/230 (17%), Positives = 72/230 (31%), Gaps = 15/230 (6%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCM 90
           DL   M+ L  +      +    +Y+G   +           +  + +   +P   +   
Sbjct: 13  DLRMEMLKLQESAQVFALLEREVQYLGFDFYAYGIRHSIPFTRPKTEIYGSYPQPWMERY 72

Query: 91  ALSEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVARIRI 142
                      +         V                    G+               +
Sbjct: 73  QQQNYAAIDPSILNGLRSTEMVVWNDVLFGKGSVLWGEAQDWGLRVGATVPIRTPDG-AL 131

Query: 143 GLMLLFPKGRIILRDRLWEIGL----LAAYQANMFKSYD--VHWGKDFELTGREVECLTW 196
            ++ +  +   I       I L    +    A                EL+ RE E L W
Sbjct: 132 SVLSVARRNTAISAVEREVIRLRLRCIIELAAGRLSELGHSNTQSDPQELSAREREILQW 191

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ++GK+S EIA+ILGIS NTVN ++  I +K     ++ A AYA    ++
Sbjct: 192 TADGKSSGEIALILGISVNTVNFHLKVIQKKFGAANKTLAAAYAAVLGLI 241


>gi|163853910|ref|YP_001641953.1| autoinducer-binding domain-containing protein [Methylobacterium
           extorquens PA1]
 gi|163665515|gb|ABY32882.1| Autoinducer-binding domain protein [Methylobacterium extorquens
           PA1]
          Length = 243

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/233 (18%), Positives = 78/233 (33%), Gaps = 18/233 (7%)

Query: 31  DLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDL---FQEQKLDSIVSSDWPFDLV 87
           ++L  +            +      +G  + +     L       + + ++  +   +  
Sbjct: 11  EILKSLDRAHSREDILRAIMPRLNALGIEYVISAMIPLKRLPARTQKNYLILENTSDEWN 70

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTL-------------PENITPPAGMDNRYCSLT 134
           R            V+Q           +                N     G+ + +    
Sbjct: 71  RLYFSKGYMYTDPVVQATLSSTTGFRWSEIEPAGVLDPRSRQVMNEAGEFGLGDGFTVPL 130

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDV-HWGKDFELTGREVEC 193
             +   R GL    P    I   +   + LLA+Y        D     +   LT RE E 
Sbjct: 131 ATLEEERGGLTFAGP-QLDISPGQRGMLTLLASYVVGQTLLIDNGPSERRMGLTPRERES 189

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L W++EGKT  EI  ++GISR+ V+ ++ S   K    +R+ A+A   R  ++
Sbjct: 190 LQWVAEGKTDWEIGELMGISRHGVDFHLRSARVKLGCVSRTQAVAEGFRRGLI 242


>gi|172064983|ref|YP_001815695.1| LuxR family transcriptional regulator [Burkholderia ambifaria
           MC40-6]
 gi|171997225|gb|ACB68142.1| transcriptional regulator, LuxR family [Burkholderia ambifaria
           MC40-6]
          Length = 239

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/231 (16%), Positives = 72/231 (31%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  LLA +  +         +      +G  ++  V        +   +  S++P     
Sbjct: 5   RESLLASLEQVKTASEAFDNLAPAVRALGFEYYAYVLRITIPITRPAIMGWSNYPEAWRT 64

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFH-------TLPENITPPAGMDNRYCSLTFDVARIR 141
                +      VL        P+                   G+   +   T D     
Sbjct: 65  HYTQRDYQHADPVLHYGQACTRPMPWPGPLPGYDAFWRDAAAFGLCYGWSQTTRDHRGAM 124

Query: 142 IGLMLLFPKGRIILRDRLW---EIGLLAAYQANMFKSY---DVHWGKDFELTGREVECLT 195
             + L+     I   +      E+     +      +    DV       L+ RE + L 
Sbjct: 125 GTVSLVRGGPPIAPDELRRTEPEMIWFCQFVHATMSNLIVSDVMPSGAMRLSLREKQVLH 184

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKT+ E+AVIL +S   V  +I + + K     ++ A   A    ++
Sbjct: 185 WTAEGKTAAEVAVILQLSERNVGFHIQNAIDKLDAANKTHATVKAAMLGLI 235


>gi|28871016|ref|NP_793635.1| transcriptional regulator PsyR [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|13182979|gb|AAK15017.1|AF234628_3 PsmR [Pseudomonas syringae pv. maculicola]
 gi|28854266|gb|AAO57330.1| transcriptional regulator PsyR [Pseudomonas syringae pv. tomato
           str. DC3000]
          Length = 247

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/228 (15%), Positives = 75/228 (32%), Gaps = 23/228 (10%)

Query: 40  DCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYY 99
                          ++G   +        ++ K   I+ S++P   ++    S      
Sbjct: 22  APLRQLIEDFENDLHHIGDFTYAYFTTPKARKAKP--IILSNYPDSWLKSYIASNYHLID 79

Query: 100 NVLQRPTELFCPVFHTLPEN------------ITPPAGMDNRYCSLTFDVARIRIGLMLL 147
            +++       P F     N             +    + +       D + +   L L 
Sbjct: 80  PIIKHAWHSITPFFWREARNAVQCVETDDFLKRSAKYQLSSGATFTLHDASGLFAALSLC 139

Query: 148 FPKG----RIILRDRLWEIGLLAAYQANMFKSYDVHWG-----KDFELTGREVECLTWIS 198
             K        +RD+  +I +      +                + +L+ RE + L W++
Sbjct: 140 NAKQQHDFDQRIRDKAADIQMSLIRFHDRLIKTRAPHELFPPTANCKLSSRETDILKWVA 199

Query: 199 EGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            GK   EIA I  IS  TV  +++++  K   +T   A+  A++  +V
Sbjct: 200 MGKAYSEIAEIFSISERTVKFHMSNVSSKLEVRTAKQAVYKAIKMGMV 247


>gi|297153818|gb|ADI03530.1| two-component system response regulator [Streptomyces
           bingchenggensis BCW-1]
          Length = 219

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/223 (16%), Positives = 75/223 (33%), Gaps = 11/223 (4%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D +     L   +     +  + E   G +   L      +   +D  +     
Sbjct: 6   RVLVCDDQVLVRTGLVTIIDAQPDLEVVGECEDGQAAVDLAGRLRPEVVVMDVRMPVLDG 65

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
            +  R +A +              L    F+             + +       +++  G
Sbjct: 66  IEATRLLAGAGVPH------PVKVLVVTTFNLDKYVYEALRAGASGFLLKEAPPSQLLHG 119

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           +  +     ++  +    +           +  +    +D  LT RE+E L  I++G ++
Sbjct: 120 IRTVATGAALLDPEVTRRL---VGTYVARIRPAED-TSRDIPLTPRELEVLRLIADGFSN 175

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            EIA  L IS  TV  +++ I+ K   + R  A+ YA R  +V
Sbjct: 176 SEIAAALQISPETVKTFVSRILTKLDLRDRVQAVVYAYRQGLV 218


>gi|301382983|ref|ZP_07231401.1| transcriptional regulator PsyR [Pseudomonas syringae pv. tomato
           Max13]
 gi|302062866|ref|ZP_07254407.1| transcriptional regulator PsyR [Pseudomonas syringae pv. tomato
           K40]
 gi|302131657|ref|ZP_07257647.1| transcriptional regulator PsyR [Pseudomonas syringae pv. tomato
           NCPPB 1108]
          Length = 247

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/228 (15%), Positives = 75/228 (32%), Gaps = 23/228 (10%)

Query: 40  DCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYY 99
                          ++G   +        ++ K   I+ S++P   ++    S      
Sbjct: 22  APLRQLIEDFENDLHHIGEFTYAYFTTPKARKAKP--IILSNYPDSWLKSYIASNYHLID 79

Query: 100 NVLQRPTELFCPVFHTLPEN------------ITPPAGMDNRYCSLTFDVARIRIGLMLL 147
            +++       P F     N             +    + +       D + +   L L 
Sbjct: 80  PIIKHAWHSITPFFWREARNAVQCVETDDFLKRSAKYQLSSGATFTLHDASGLFAALSLC 139

Query: 148 FPKG----RIILRDRLWEIGLLAAYQANMFKSYDVHWG-----KDFELTGREVECLTWIS 198
             K        +RD+  +I +      +                + +L+ RE + L W++
Sbjct: 140 NAKQQHDFDQRIRDKTADIQMSLIRFHDRLIKTRAPHELFPPTANCKLSSRETDILKWVA 199

Query: 199 EGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            GK   EIA I  IS  TV  +++++  K   +T   A+  A++  +V
Sbjct: 200 MGKAYSEIAEIFSISERTVKFHMSNVSSKLEVRTAKQAVYKAIKMGMV 247


>gi|320641764|gb|EFX11152.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           O157:H7 str. G5101]
          Length = 240

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/231 (16%), Positives = 70/231 (30%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   ++        +    + +   ++ L         +      +++P   V 
Sbjct: 10  RRTMLLRFQRMETAEEVYHEIELQAQQLEYDYYSLCVRHPVPFTRPKVAFYTNYPEAWVS 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVARI 140
                       VL         +                    G+            R 
Sbjct: 70  YYQAKNFLAIDPVLNPENFSQGHLMWNDDLFNEAQSLWEAARAHGLRRGVTQYLMLPNRA 129

Query: 141 RIGLMLL---FPKGRIILRDRLWEIGLLAAYQANMFKSYDV--HWGKDFELTGREVECLT 195
              L        +  I+  +   ++ LL           +       +   + RE E L 
Sbjct: 130 LGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREKEILR 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|320198610|gb|EFW73210.1| DNA-binding transcriptional activator SdiA [Escherichia coli
           EC4100B]
          Length = 240

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/231 (16%), Positives = 70/231 (30%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   ++        +    + +   ++ L         +      +++P   V 
Sbjct: 10  RRTMLLRFQRMETAEEVYHEIELQAQQLEYDYYSLCVRHPVPFTRPKVAFYTNYPEAWVN 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVARI 140
                       VL         +                    G+            R 
Sbjct: 70  YYQAKNFLAIDPVLNPENFSQGHLMWNDDLFSEAQPLWEAARAHGLRRGVTQYLMLPNRA 129

Query: 141 RIGLMLL---FPKGRIILRDRLWEIGLLAAYQANMFKSYDV--HWGKDFELTGREVECLT 195
              L        +  I+  +   ++ LL           +       +   + RE E L 
Sbjct: 130 LGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREKEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|290954729|ref|YP_003485911.1| two component system response regulator [Streptomyces scabiei
           87.22]
 gi|260644255|emb|CBG67336.1| putative two component system response regulator [Streptomyces
           scabiei 87.22]
          Length = 224

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 34/224 (15%), Positives = 75/224 (33%), Gaps = 7/224 (3%)

Query: 24  SHLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDW 82
           + +    D           ++    +  + E   GA    L R        +D  +    
Sbjct: 3   TRVIIVDDQAMVRAGFAALLAAQSDIDVVGEAPDGAQGVELSRRTHPDVVLMDVRMPEMD 62

Query: 83  PFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRI 142
             +  R +     +    V  RP  L    F              + +       A +  
Sbjct: 63  GLEAARRL----LEPAPGVTHRPRVLMLTTFDVDDYVYEALRAGASGFLLKDAPPADLIA 118

Query: 143 GLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKT 202
            + ++     ++       +  +A +             +   LT RE E LT ++ G++
Sbjct: 119 AVRVVASGDALLAPSVTRRL--IADFARQRPAVRGKPALRLKRLTERETEVLTLVARGQS 176

Query: 203 SDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + EIA  L ++  TV  +++ ++ K   + R+ A+ +A  + +V
Sbjct: 177 NGEIAQTLVLAEQTVKTHVSRVLTKLDLRDRAQAVVFAYESGLV 220


>gi|21224466|ref|NP_630245.1| two-component system response regulator [Streptomyces coelicolor
           A3(2)]
 gi|256784341|ref|ZP_05522772.1| two-component system response regulator [Streptomyces lividans
           TK24]
 gi|289768220|ref|ZP_06527598.1| two-component system response regulator [Streptomyces lividans
           TK24]
 gi|4007689|emb|CAA22374.1| putative two-component system response regulator [Streptomyces
           coelicolor A3(2)]
 gi|289698419|gb|EFD65848.1| two-component system response regulator [Streptomyces lividans
           TK24]
          Length = 219

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/218 (18%), Positives = 74/218 (33%), Gaps = 11/218 (5%)

Query: 30  SDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
            D       L   V     +  + E   G +   L R        +D  +      +  R
Sbjct: 11  DDQALIRTGLATIVDAQPDLEVVGECGDGQTGVDLARELRPDVVVMDIRMPVLDGLEATR 70

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLLF 148
            +A +       V      L    F+             + +        R+  G+  + 
Sbjct: 71  LLAGAG------VAHPVKVLVVTTFNLDEYVYEALRAGASGFLLKDAPPDRLLHGIRTVA 124

Query: 149 PKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAV 208
               ++  D    +       A   +  +    +D  LT RE E L  I++G ++ EIA 
Sbjct: 125 MGAALLDPDVTRRL---VGRYAARIRPAEGTA-RDIPLTPRETEVLRLIADGLSNSEIAA 180

Query: 209 ILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            L IS  TV  +++ I+ K   + R  A+ +A R+ +V
Sbjct: 181 ALVISPETVKTFVSRILTKLDLRDRVQAVVFAYRHGLV 218


>gi|311114585|ref|YP_003985806.1| two component system response regulator [Gardnerella vaginalis ATCC
           14019]
 gi|310946079|gb|ADP38783.1| two component system response regulator [Gardnerella vaginalis ATCC
           14019]
          Length = 243

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/241 (14%), Positives = 75/241 (31%), Gaps = 23/241 (9%)

Query: 23  VSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSD 81
           V  +    D           ++    M  + +   G     +   +      +D  + + 
Sbjct: 9   VIRVAIADDQELVRAGFAMVINSQKDMQVVAQASNGNEIVEVASKENPDVILMDVRMPNM 68

Query: 82  WPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIR 141
              +  R +   + +           +    F      +       + +     +   + 
Sbjct: 69  DGLEATRKILQEDANSN------THIIILTTFDLDEYVMAAIHTGASGFLLKDTEPETLL 122

Query: 142 IGLMLLFPKGRIILRDRLWEIGL----------LAAYQANMFKSYDVHWGKDF------E 185
             +  ++    II       +            +A+ + N   +       +       +
Sbjct: 123 NSIRTVYQGNAIIAPTATKRLIESMISKPSNESIASEEENTENASRSKQNANAYNSYLND 182

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           LT RE E L  I+ G ++ EIA  L IS  TV  ++A I+ K   + R  A+ +A  N +
Sbjct: 183 LTDREREVLIEIAHGLSNQEIADKLFISLPTVKTHVAHILGKIDARDRVQAVVFAYENGL 242

Query: 246 V 246
           V
Sbjct: 243 V 243


>gi|313624283|gb|EFR94330.1| sensory transduction protein LiaR [Listeria innocua FSL J1-023]
          Length = 212

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 80/239 (33%), Gaps = 31/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  + E     VS   +  D +  +   +                G     +    
Sbjct: 2   IKVLLVDDHEMVRIGVSAYLSVQDDMEVVGEAEN---------------GREGADMALEL 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++      +  + +  +         +    +    F    +         
Sbjct: 47  RPDIILMDLVMDEMDGIEATKEIMKNW--------KEAKIIIVTSFIDDEKVYPALEAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + Y   T   + I   +   +    ++  +   ++      +       D        LT
Sbjct: 99  SSYMLKTSTASEIADAIRATYGGDSVLEPEVTGKMMQRLTAKPEKKLHDD--------LT 150

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA ++++V
Sbjct: 151 NRENEILLLIAEGKSNQEIADELFITLKTVKTHVSNILSKLDVQDRTQAAIYAFKHDLV 209


>gi|229916670|ref|YP_002885316.1| two component transcriptional regulator, LuxR family
           [Exiguobacterium sp. AT1b]
 gi|229468099|gb|ACQ69871.1| two component transcriptional regulator, LuxR family
           [Exiguobacterium sp. AT1b]
          Length = 230

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 34/251 (13%), Positives = 74/251 (29%), Gaps = 30/251 (11%)

Query: 3   FEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFL 62
            E+ Q  I +  + E     +  +    D    +                    G     
Sbjct: 1   MEMTQTRIAIVDDHELFREGLKRIFDLEDEFTVVAEGRT---------------GREAIR 45

Query: 63  LVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITP 122
           +      +   +D  +      +  + ++L               L   +          
Sbjct: 46  IAGEQKPEILIMDINMPDMNGIEATKQLSLLS--------PETRVLILSIHDDESYITHA 97

Query: 123 PAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRL-------WEIGLLAAYQANMFKS 175
                + +         +   +  +   G  +              +      QA     
Sbjct: 98  LEAGASGFLLKEVASTELISAVRAVAKDGAYLHPKVTTNVLKEYRRLLQFKGEQAGRGVE 157

Query: 176 YDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSG 235
                     L+ REVE L  +++G+++ +I+ +L IS  TV N+++S++RK     R+ 
Sbjct: 158 SRTDDPVYQLLSRREVEVLHLLADGRSNRDISDMLFISEKTVKNHVSSVLRKMDVNDRTQ 217

Query: 236 AIAYAVRNNIV 246
           A+  A+R   V
Sbjct: 218 AVVDAIRRGWV 228


>gi|254392873|ref|ZP_05008042.1| two-component system response regulator [Streptomyces clavuligerus
           ATCC 27064]
 gi|294812928|ref|ZP_06771571.1| Two-component system response regulator [Streptomyces clavuligerus
           ATCC 27064]
 gi|197706529|gb|EDY52341.1| two-component system response regulator [Streptomyces clavuligerus
           ATCC 27064]
 gi|294325527|gb|EFG07170.1| Two-component system response regulator [Streptomyces clavuligerus
           ATCC 27064]
          Length = 269

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 32/242 (13%), Positives = 76/242 (31%), Gaps = 25/242 (10%)

Query: 5   IQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV 64
            + + +++  +       +  +  + + +  +                    GA      
Sbjct: 50  AEPIRVLVVDDHALFRRGLEIVLAQEEDIQVVGEAGD---------------GAEAVDKA 94

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
              L     +D  +      +    +          V      +   +     +      
Sbjct: 95  ADLLPDIVLMDVRMPRRGGIEACTSIKE--------VAPSAKIIMLTISDEEADLYDAIK 146

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF 184
                Y         +   +  +      I      ++  L  +++ + ++ +       
Sbjct: 147 AGATGYLLKEISTDEVATAIRAVADGQSQISPSMASKL--LTEFKSMIQRTDERRLVPAP 204

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            LT RE+E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  
Sbjct: 205 RLTDRELEVLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREK 264

Query: 245 IV 246
           I+
Sbjct: 265 IL 266


>gi|167828172|ref|ZP_02459643.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 9]
          Length = 210

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/210 (19%), Positives = 76/210 (36%), Gaps = 12/210 (5%)

Query: 49  MYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTEL 108
           M      +G  +        F       ++ S++P         +        ++     
Sbjct: 1   MTRAAATLGYEYAAYGMRRPFPISNPPILMVSNYPARWQERYIEARFANIDGAVKAALGS 60

Query: 109 FCPVFHTLP--------ENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLW 160
             PV  + P               G+ + + S +         L L   +  I   ++  
Sbjct: 61  DLPVTWSAPANASKSAFWAEALSFGIAHGWSSASRGADGAIGVLTLSRTQDPIDTAEKFR 120

Query: 161 E---IGLLAAYQANMFKSYDVHWGK-DFELTGREVECLTWISEGKTSDEIAVILGISRNT 216
               +  LA         +     + D +LT RE + L W ++GKT+ EIA+IL IS +T
Sbjct: 121 NESIVHWLANVAHASMAPFLPAADEFDPDLTRRETDVLKWTADGKTAYEIALILSISEST 180

Query: 217 VNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           VN ++ +I+ K  +  +  A+A A    ++
Sbjct: 181 VNFHVKNIVSKLGSTNKIQAVAKAALMGML 210


>gi|297194044|ref|ZP_06911442.1| two-component system response regulator [Streptomyces
           pristinaespiralis ATCC 25486]
 gi|297152083|gb|EFH31522.1| two-component system response regulator [Streptomyces
           pristinaespiralis ATCC 25486]
          Length = 253

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 32/240 (13%), Positives = 74/240 (30%), Gaps = 25/240 (10%)

Query: 7   QVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRW 66
            + +++  +       +  +    + +  +                    GA        
Sbjct: 36  PIRVLVVDDHALFRRGLEIVLAHEEGIEVVGEAGD---------------GAEAVDKAAD 80

Query: 67  DLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGM 126
            L     +D  +      +    +          V      +   +     +        
Sbjct: 81  LLPDIVLMDVRMPKRGGIEACTSIKE--------VAPSAKIIMLTISDEEADLYDAIKAG 132

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFEL 186
              Y         +   +  +      I      ++  L  +++ + ++ +        L
Sbjct: 133 ATGYLLKEISTDEVATAIRAVADGQSQISPSMASKL--LTEFKSMIQRTDERRLVPAPRL 190

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T RE+E L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I+
Sbjct: 191 TDRELEVLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKIL 250


>gi|256022426|ref|ZP_05436291.1| DNA-binding transcriptional activator SdiA [Escherichia sp.
           4_1_40B]
          Length = 240

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/231 (16%), Positives = 70/231 (30%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   ++        +    + +   ++ L         +      +++P   V 
Sbjct: 10  RRTMLLRFQRMETAEEVYHEIELQAQQLEYDYYSLCVRHPVPFTRPKVAFYTNYPEAWVS 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVARI 140
                       VL         +                    G+            R 
Sbjct: 70  YYQAKNFLAIDPVLNPENFSQGHLMWNDDLFNEAQPLWEAARAHGLRRGVTQYLMLPNRA 129

Query: 141 RIGLMLL---FPKGRIILRDRLWEIGLLAAYQANMFKSYDV--HWGKDFELTGREVECLT 195
              L        +  I+  +   ++ LL           +       +   + RE E L 
Sbjct: 130 LGFLSFSRCSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNFSKREKEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|271965882|ref|YP_003340078.1| response regulator receiver protein [Streptosporangium roseum DSM
           43021]
 gi|270509057|gb|ACZ87335.1| response regulator receiver protein [Streptosporangium roseum DSM
           43021]
          Length = 219

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/223 (17%), Positives = 75/223 (33%), Gaps = 11/223 (4%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D           +     +  + E   G +   L R        +D  +     
Sbjct: 6   RVLVCDDQALIRTGFATIIDAQPGLEVVGECGDGRTAVDLARRLNPDIVVMDVRMPVLDG 65

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
            +  R +A +       V      L    F+             + +       A++  G
Sbjct: 66  IEATRRLAGAGV--ADPV----KVLVVTTFNLDEYVYEALRAGASGFLLKDAPPAQLLHG 119

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           +  +     ++  +   ++       A   +        +  LT RE+E L  I++G ++
Sbjct: 120 IRTVATGAALLAPEVTRQL---VGRYAARIRPAQA-TPAETALTPRELEVLRLIADGLSN 175

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            EIA  L IS+ TV  Y++ I+ K   + R  A+ YA R  +V
Sbjct: 176 SEIAATLVISQETVKTYVSRILTKLDLRDRVQAVVYAYRRGLV 218


>gi|56964850|ref|YP_176581.1| two-component response regulator of extracellular degradative
           enzyme [Bacillus clausii KSM-K16]
 gi|56911093|dbj|BAD65620.1| two-component response regulator of extracellular degradative
           enzyme [Bacillus clausii KSM-K16]
          Length = 235

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/251 (14%), Positives = 77/251 (30%), Gaps = 31/251 (12%)

Query: 4   EIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLL 63
           E Q++ IV+  +       V  + +  +    +   +                G+    L
Sbjct: 5   ETQEIRIVIIDDHPLFKEGVKRILSMEENFNVVADGED---------------GSEVIDL 49

Query: 64  VRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPP 123
           VR        +D  +      +  + +             +   +   +           
Sbjct: 50  VRQHQPDVILMDINMPKTNGVEATKDLIK--------AFPKVKVIILSIHDDESYVSHVL 101

Query: 124 AGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWG-- 181
               + Y     D   +   + ++   G  I       +       A   + Y    G  
Sbjct: 102 RTGASGYLLKEMDAESLVEAVKVVASGGAYIHPKVTSNLIKEYRRLARQDEQYQDSIGFR 161

Query: 182 ------KDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSG 235
                     LT RE E L  +++G+ +  I   L IS  TV N++++I++K     R+ 
Sbjct: 162 EVEYRKPLHILTRRECEVLQLMTDGQNNRAIGESLYISEKTVKNHVSNILQKMNVNDRTQ 221

Query: 236 AIAYAVRNNIV 246
           A+  +++   V
Sbjct: 222 AVVESIKKGYV 232


>gi|328883924|emb|CCA57163.1| putative two-component system response regulator [Streptomyces
           venezuelae ATCC 10712]
          Length = 222

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/227 (15%), Positives = 69/227 (30%), Gaps = 11/227 (4%)

Query: 23  VSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSD 81
           ++ +    D   +       +     M  + E   G     LV         +D  +   
Sbjct: 1   MTTVLIADDQPMQRFGFRMLLESQDDMTVVGEASNGTEAVRLVDRHHPDVVLMDIRMPGL 60

Query: 82  WPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIR 141
              +  R +  +          R   L    F              + +         + 
Sbjct: 61  DGIEATRRIITTG--------ARTRVLIVTTFDLDEYAYDGLRAGASGFLVKDAQPEELL 112

Query: 142 IGLMLLFPKGRIILRDRLWEI--GLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISE 199
            G+  +     ++       +    +     +     D    +   LT RE E LT I +
Sbjct: 113 AGIRAVASGDAVVAPSLTRRLLDAYIHHLPQSPTADPDPEDPRLATLTEREREILTVIGQ 172

Query: 200 GKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           G T+ EIA  L ++ +TV  ++  I+ KT  + R  A+  A    +V
Sbjct: 173 GWTNTEIAERLHLAESTVKTHVGRILAKTGARDRVQAVILAYDTQLV 219


>gi|289434290|ref|YP_003464162.1| DNA-binding response regulator, LuxR family [Listeria seeligeri
           serovar 1/2b str. SLCC3954]
 gi|289170534|emb|CBH27074.1| DNA-binding response regulator, LuxR family [Listeria seeligeri
           serovar 1/2b str. SLCC3954]
 gi|313633930|gb|EFS00643.1| sensory transduction protein LiaR [Listeria seeligeri FSL N1-067]
 gi|313638502|gb|EFS03673.1| sensory transduction protein LiaR [Listeria seeligeri FSL S4-171]
          Length = 212

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 80/239 (33%), Gaps = 31/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  + E     VS   +  D +  +   +                G     +    
Sbjct: 2   IKVLLVDDHEMVRIGVSAYLSVQDDMEVVGEAEN---------------GRQGADMALEL 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++      +  + +  +         +    +    F    +         
Sbjct: 47  RPDIILMDLVMDEMDGIEATKEIMQNW--------KEAKIIIVTSFIDDEKVYPALEAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + Y   T   + I   +   +    ++  +   ++            +         +LT
Sbjct: 99  SSYMLKTSTASEIADAIRATYGGDSVLEPEVTGKMMQRL--------TAKPEKNLHDDLT 150

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA ++++V
Sbjct: 151 NRENEILLLIAEGKSNQEIADELFITLKTVKTHVSNILSKLDVQDRTQAAIYAFKHDLV 209


>gi|311900005|dbj|BAJ32413.1| putative two-component system response regulator [Kitasatospora
           setae KM-6054]
          Length = 223

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 34/223 (15%), Positives = 68/223 (30%), Gaps = 9/223 (4%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D           +     +  + E   G      VR        +D  +     
Sbjct: 4   RVLLVDDQPLLRTGFRMILEAESDLVVVGEAGDGQQALDQVRALQPDVVLMDIRMPRMDG 63

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
            +  R +A  ++D           L    F      +       + +         +   
Sbjct: 64  VEATRRIAGPDRDG------PAKVLVLTTFDLDEYVVEALRAGASGFLLKDVPAEELVQA 117

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           + ++     ++       +  L  Y   +    +        LT REVE L  ++ G ++
Sbjct: 118 IRVVADGAAMLAPSVTRRL--LDMYATKLPSGDEAPPQALTVLTEREVEVLRLVARGLSN 175

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            EIA  L +S  TV  ++  ++ K   + R  A  YA  + +V
Sbjct: 176 AEIAAELFVSETTVKTHVGHVLTKLQLRDRVQAAVYAYESGLV 218


>gi|116872424|ref|YP_849205.1| LuxR family DNA-binding response regulator [Listeria welshimeri
           serovar 6b str. SLCC5334]
 gi|116741302|emb|CAK20424.1| DNA-binding response regulator; LuxR family [Listeria welshimeri
           serovar 6b str. SLCC5334]
          Length = 212

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 79/239 (33%), Gaps = 31/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  + E     VS   +  D +  +   +                G     +    
Sbjct: 2   IKVLLVDDHEMVRIGVSAYLSVQDDMEVVGEAEN---------------GREGADMALEL 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++      +  + +            +    +    F    +         
Sbjct: 47  RPDIILMDLVMDEMDGIEATKEIMQKW--------KEAKIIIVTSFIDDEKVYPALEAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + Y   T   + I   +   +    ++  +   ++            +         +LT
Sbjct: 99  SSYMLKTSTASEIADAIRATYGGDSVLEPEVTGKMMQRL--------TAKPEKNLHDDLT 150

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  I+EGK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA ++++V
Sbjct: 151 NRENEILLLIAEGKSNQEIADELFITLKTVKTHVSNILSKLDVQDRTQAAIYAFKHDLV 209


>gi|242374097|ref|ZP_04819671.1| response regulator [Staphylococcus epidermidis M23864:W1]
 gi|242348222|gb|EES39824.1| response regulator [Staphylococcus epidermidis M23864:W1]
          Length = 207

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/238 (15%), Positives = 77/238 (32%), Gaps = 33/238 (13%)

Query: 9   NIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDL 68
            +VL  +       +  L +  + L  +       S+   +                 + 
Sbjct: 3   KVVLVDDHHIVRQGLEFLLSTVEDLEVVKGFSDGQSFLSFLKE--------------NEQ 48

Query: 69  FQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDN 128
                LD ++      ++          K Y  ++         +      I+      +
Sbjct: 49  PDIVLLDLVMPEMNGIEITEI-----LKKQYPQIKVL---VLTSYVDDEHVISAIDKGAD 100

Query: 129 RYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTG 188
            Y     +  ++   +  +    RII  +    I  ++                  +L+ 
Sbjct: 101 GYEMKDVEPQKLIETIHKVLNGERIIHPEAKNVIEAVSKKPHF-----------TNKLSK 149

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           REVE L  + +GKT+ EIA  L +S  T+  +++ I  K     R+ A  YA+ N ++
Sbjct: 150 REVEVLREMVKGKTNKEIAQTLFVSEKTIKTHVSHIFNKLQVTDRTQAAIYAMENKLI 207


>gi|269925421|ref|YP_003322044.1| two component transcriptional regulator, LuxR family [Thermobaculum
           terrenum ATCC BAA-798]
 gi|269789081|gb|ACZ41222.1| two component transcriptional regulator, LuxR family [Thermobaculum
           terrenum ATCC BAA-798]
          Length = 224

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 28/243 (11%), Positives = 70/243 (28%), Gaps = 34/243 (13%)

Query: 6   QQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLV 64
           + + +V+  +          L  +                   +  + E   G     L 
Sbjct: 10  EAIRVVIAEDHALVREGTKELLEK-----------------RGIRVIGEASNGEEAVELA 52

Query: 65  RWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPA 124
           +        +D  +      D  + +     +           L    +           
Sbjct: 53  QKLQPDLILMDVSMPKLNGIDATKIIKQKHPNI--------AVLVLSAYDDDQYVFALLQ 104

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMF-KSYDVHWGKD 183
                Y         +   +  +     ++          +A    + F           
Sbjct: 105 AGAAGYILKDAHADEVVNAVKAVANGESVLAPS-------IAKKVLSRFTSPSTQPEHPS 157

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             LT RE++ L   ++G+++  IA  L +S  TV  ++++I  K    +R+ A+ +A++ 
Sbjct: 158 PVLTDRELDVLRLAAKGESNKAIAQQLHLSPRTVQVHLSNIFNKFGVASRTEAVLHALKL 217

Query: 244 NIV 246
            ++
Sbjct: 218 GLI 220


>gi|134098288|ref|YP_001103949.1| two component system response regulator [Saccharopolyspora
           erythraea NRRL 2338]
 gi|291004292|ref|ZP_06562265.1| two component system response regulator [Saccharopolyspora
           erythraea NRRL 2338]
 gi|133910911|emb|CAM01024.1| two component system response regulator [Saccharopolyspora
           erythraea NRRL 2338]
          Length = 225

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 32/222 (14%), Positives = 67/222 (30%), Gaps = 8/222 (3%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           +    D           ++    M  + E   G     L          +D  +      
Sbjct: 5   VLVVDDQAMVRAGFAALLAAQPDMEVVGEADDGERGVALSHEHGPDVVLMDVRMPVLNGI 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +  R +          +   P  L    F              + +       A +  G+
Sbjct: 65  EATRRLLDPPAH----ITHVPRVLMLTTFDIDDYVYEALRAGASGFLLKDALPADLIAGV 120

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
            ++     ++       +     + +        +  +   LT RE E L  ++ G ++ 
Sbjct: 121 RVVAGGQALLAPTVTRRLI---EHFSRTAAPPITNPPRLDVLTDREREVLVHVARGLSNT 177

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA  L I+  TV ++++ I+ K   + R  A+  A    +V
Sbjct: 178 EIADALFIAEQTVKSHVSRILGKLGVRDRVQAVVVAYETGLV 219


>gi|120612451|ref|YP_972129.1| LuxR family transcriptional regulator [Acidovorax citrulli AAC00-1]
 gi|120590915|gb|ABM34355.1| transcriptional regulator, LuxR family [Acidovorax citrulli
           AAC00-1]
 gi|227167429|gb|ACP19743.1| LuxR-like protein [Acidovorax citrulli]
          Length = 242

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 44/236 (18%), Positives = 73/236 (30%), Gaps = 19/236 (8%)

Query: 30  SDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV----RWDLFQEQKLDS-IVSSDWPF 84
            D + R                    +G  HF L     R D     +    ++S ++P 
Sbjct: 4   RDFIQRANQALTQTELLACFEQAVLLLGYQHFSLCYVQLRQDGSGTSQPPIGVLSHNYPS 63

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFH----------TLPENITPPAGMDNRYCSLT 134
             V             V +   +   P                 +    AG+ +      
Sbjct: 64  RWVSHYIARNYYLEDPVRRHAPQAMSPYRWKDVSAQGDREAHIMDEATDAGLADGLGLPI 123

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQAN----MFKSYDVHWGKDFELTGRE 190
            +         +   +   +  D       L           F +         +LT RE
Sbjct: 124 HEPGGRIFLATVASHQQLTLGNDACVRTYALVTAFHALYTMRFATEQTQIPTAVKLTSRE 183

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECLTW++ GK+S EI  I+ IS +TVN ++ + M K  T +R  A   A    ++
Sbjct: 184 AECLTWVAYGKSSWEIGRIMRISEHTVNFHLKNAMAKFDTASRVTAAVRAANLGLI 239


>gi|33326387|gb|AAQ08608.1| putative transcription regulator [Agrobacterium vitis]
          Length = 248

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 41/251 (16%), Positives = 82/251 (32%), Gaps = 27/251 (10%)

Query: 19  RTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIV 78
               V+HL      LA            + +  L E+    ++ LVR     +  +  ++
Sbjct: 1   MRVSVNHLIQ---FLAVSQGCRSREELILELEKLLEFYKFDYYGLVRSPKPDQNPMSLVL 57

Query: 79  SSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHT----------------LPENITP 122
           +  WP    +     +       ++   +   P   +                       
Sbjct: 58  AGRWPEKWPQVYITKKFVLIDPAIRYLAQAQRPFRWSETLTAFSQDPHFKRMQRMMMDAQ 117

Query: 123 PAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDV---- 178
             G++  Y         + +  M +  +   +    +     +A          +     
Sbjct: 118 RFGLEEGYIFPIHGRGGL-LANMTIGGRSVELTPIEIMLFDTVAKCAFWRLAEINGEDEL 176

Query: 179 ---HWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSG 235
                  D  LT RE+E L ++ EG TS+E++ +L IS +TV+ Y+  +  K   K R  
Sbjct: 177 LSMVQKVDVRLTRRELEILNYLGEGMTSNEMSKLLEISNHTVDWYVNELQDKLNAKNRQH 236

Query: 236 AIAYAVRNNIV 246
            +A A R  ++
Sbjct: 237 MVAIAYRLGLI 247


>gi|222087763|ref|YP_002546300.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
 gi|221725211|gb|ACM28367.1| transcriptional regulator protein [Agrobacterium radiobacter K84]
          Length = 246

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 38/238 (15%), Positives = 75/238 (31%), Gaps = 24/238 (10%)

Query: 32  LLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMA 91
           LL  +   +   +    + ++        + L+R        +  +++  WP        
Sbjct: 9   LLVVVEECNQPKNVVTELESVLRSYKFDFYGLLRHPRPAVDIVSVMLAGRWPDKWPLTYV 68

Query: 92  LSEKDKYYNVLQRPTELFCPVFHTLPENI----------------TPPAGMDNRYCSLTF 135
             +       ++   +   P                             G+ + Y    F
Sbjct: 69  ARKYVLVDPTMRYLGQAQRPFRWRDAMAALKGDPLRRRMEQMMADARANGLVDGYIFPIF 128

Query: 136 DVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGK-------DFELTG 188
             + +   +  +      +    L     +A                       + +LT 
Sbjct: 129 GRSGLLGTM-TIGGNSVDLSPAELSLFDAVAKKVFWRLLELRDEARPLEEAPAIEAKLTR 187

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE+E L  ++EG TS +I+  L IS +TV+ Y+ SI  K   + R   +A A RN +V
Sbjct: 188 REIEVLNHLAEGMTSMDISRTLKISNHTVDWYMNSIQDKLNARNRQHIVAIAFRNGLV 245


>gi|282863833|ref|ZP_06272891.1| two component transcriptional regulator, LuxR family [Streptomyces
           sp. ACTE]
 gi|282561534|gb|EFB67078.1| two component transcriptional regulator, LuxR family [Streptomyces
           sp. ACTE]
          Length = 219

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 38/223 (17%), Positives = 75/223 (33%), Gaps = 11/223 (4%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEY-VGASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D +     L   +     +    E   G +   L          +D  +     
Sbjct: 6   RVLICDDQVLIRTGLSTIIDAQPDLEVAGECGDGRAAVDLAAKLRPDVVVMDVRMPVLDG 65

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
            +  R +A +              L    F+               +       +++  G
Sbjct: 66  IEATRLLAGAGVPH------PVKVLVVTTFNLDEYVYEALRAGAGGFLLKDAPPSQLLQG 119

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTS 203
           +  +     ++  +   ++       A   +       +D  LT RE+E L  I++G ++
Sbjct: 120 IRTVAAGAALLDPEVTRQL---VGRYAARIRPTGDAA-RDIPLTPRELEVLRLIADGLSN 175

Query: 204 DEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +EIA  L ISR TV  +++ I+ K   + R  A+ YA R  +V
Sbjct: 176 NEIAAALVISRETVKTFVSRILTKLGLRDRVQAVIYAYRQGLV 218


>gi|239940914|ref|ZP_04692851.1| putative two-component system response regulator [Streptomyces
           roseosporus NRRL 15998]
 gi|239987390|ref|ZP_04708054.1| putative two-component system response regulator [Streptomyces
           roseosporus NRRL 11379]
          Length = 229

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 35/229 (15%), Positives = 69/229 (30%), Gaps = 9/229 (3%)

Query: 18  QRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI 77
            R   V          A ++     +             G     + R        +D  
Sbjct: 3   IRVIIVDDQAMVRAGFAALLAAQSDIDVVGEA-----ADGRQGVDVSRNHHPDVVLMDVR 57

Query: 78  VSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           +         R +     +    V+ RP  L    F              + +       
Sbjct: 58  MPEMDGLAAAREL----LNPPVGVVHRPKVLMLTTFDVDDYVYEALRAGASGFLLKDAPP 113

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
           A +   + ++     ++       +    A Q     +      +   LT RE E L  I
Sbjct: 114 ADLIAAVRVVAAGDALLAPSVTRRLIADFAAQRPAGATRTGQALRLNGLTPRESEVLELI 173

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + G ++ EIA  L ++  TV  +I  ++ K   + R+ A+ +A  + +V
Sbjct: 174 ARGLSNQEIAGRLVLAEQTVKTHIGRVLAKLDLRDRAQAVIFAYESGLV 222


>gi|229172958|ref|ZP_04300510.1| DNA-binding response regulator [Bacillus cereus MM3]
 gi|228610478|gb|EEK67748.1| DNA-binding response regulator [Bacillus cereus MM3]
          Length = 215

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 30/220 (13%), Positives = 66/220 (30%), Gaps = 16/220 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           L    D       L   +        + E   G      ++ +      +D  +      
Sbjct: 5   LLLVEDHHIVRRGLVFFLKTREEFEIVGEAENGEEALTFIQTERPDVVLMDLSMPKMDGI 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +  + +      +Y   ++         F      +       + Y        ++   +
Sbjct: 65  EATKRI-----KQYDETIKILILSS---FSEQDYVLPALEAGADGYQLKEVQPEQLVASI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
           + +              +                       LT RE E L  I++G+++ 
Sbjct: 117 IAVHEGNANFHPKVTPAL-------FGRSAVKKEKENPFSMLTKREQEVLREIAKGRSNK 169

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EIA  L I+  TV  ++++++ K     R+ A  YAV++ 
Sbjct: 170 EIAAELHITEQTVKTHVSNVLAKLEVDDRTQAALYAVKHG 209


>gi|217959776|ref|YP_002338328.1| DNA-binding response regulator, LuxR family [Bacillus cereus AH187]
 gi|229138969|ref|ZP_04267547.1| DNA-binding response regulator [Bacillus cereus BDRD-ST26]
 gi|217064042|gb|ACJ78292.1| DNA-binding response regulator, LuxR family [Bacillus cereus AH187]
 gi|228644509|gb|EEL00763.1| DNA-binding response regulator [Bacillus cereus BDRD-ST26]
          Length = 209

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 36/220 (16%), Positives = 69/220 (31%), Gaps = 18/220 (8%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           L    D       L   +        + E   G   F  VR +      +D  +      
Sbjct: 5   LLLVEDHHIVRRGLVFFLKTREEFEIVGEAENGEEAFTFVRTERPDVVLMDLSMPKMDGI 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +  + +      +Y   ++         F      I       + Y        ++   +
Sbjct: 65  EATKRI-----KQYDETIKILILSS---FSEQDYVIPALEAGADGYQLKEVQPEQLVASI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
           + +              +           +S          LT RE E L  I++G+++ 
Sbjct: 117 VAVHQGNANFHPKITPALL---------GRSAVKKENPFSMLTKREQEVLREIAKGRSNK 167

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EIA  L I+  TV  ++++I+ K     R+ A  YAV++ 
Sbjct: 168 EIAAELHITEQTVKTHVSNILAKLEVDDRTQAALYAVKHG 207


>gi|294631853|ref|ZP_06710413.1| two-component system, regulatory protein [Streptomyces sp. e14]
 gi|292835186|gb|EFF93535.1| two-component system, regulatory protein [Streptomyces sp. e14]
          Length = 229

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 38/238 (15%), Positives = 67/238 (28%), Gaps = 17/238 (7%)

Query: 12  LNRED---EQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDL 68
           + RED     R           + +  ++ L   +             G     LV    
Sbjct: 1   MTREDGKKPARVVVADDQTVVREGIVMLLGLLPGIEVVGAAGD-----GDEAVKLVAELA 55

Query: 69  FQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDN 128
                +D  +      +  R +                 +    F               
Sbjct: 56  PDVVLMDLRMPRCDGVEATRRIRTEHPGTQ--------VVVLTTFADDDSLFPALRAGAR 107

Query: 129 RYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTG 188
            Y +       I   +  +      +       +    +       +       D  LT 
Sbjct: 108 GYLTKDAGGDEIVRAVESVLSGEAGLAPSIQRRLLEHLSEPEPEPWATPADQAPD-GLTA 166

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE E +  I+EG ++ EIA  L +S  TV  +I ++  KT  K R+ A+ YA    +V
Sbjct: 167 RECEVVVLIAEGLSNQEIARRLHVSTATVKTHINNLFAKTGLKDRAQAVRYAYAKGLV 224


>gi|253573655|ref|ZP_04850998.1| two-component system response regulator [Paenibacillus sp. oral
           taxon 786 str. D14]
 gi|251847183|gb|EES75188.1| two-component system response regulator [Paenibacillus sp. oral
           taxon 786 str. D14]
          Length = 215

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/230 (17%), Positives = 71/230 (30%), Gaps = 20/230 (8%)

Query: 17  EQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDS 76
           + R   V   P   + +  ++  D +              G          +     +D 
Sbjct: 2   KVRVLVVDDHPHAREAIGEILAEDDSFEIVAYAE-----DGDEAIAQTERWMPDLILMDI 56

Query: 77  IVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFD 136
            +      +  R + L      Y  ++            L E           Y     +
Sbjct: 57  RMPGKDGLETTREIKL-----RYPYVKIVLITVSDDAAHLFE---ALKQGAQGYLLKNLE 108

Query: 137 VARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTW 196
                  L  +      +  +       LA      F       G+   LT RE E L W
Sbjct: 109 PGTWLEYLRAIASDEAPLSSE-------LALRILQEFPVNRRTSGEQPPLTAREREILGW 161

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           +++G T+ EIA +L IS  TV N++ +I++K   + R     YA+    +
Sbjct: 162 VAQGMTNREIAGVLHISDQTVKNHLKNILQKLHLENRVQLTRYALEQGWI 211


>gi|239940608|ref|ZP_04692545.1| putative two-component system response regulator [Streptomyces
           roseosporus NRRL 15998]
 gi|239987090|ref|ZP_04707754.1| putative two-component system response regulator [Streptomyces
           roseosporus NRRL 11379]
          Length = 233

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 34/231 (14%), Positives = 63/231 (27%), Gaps = 14/231 (6%)

Query: 15  EDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKL 74
           +   R   V   P   D +AR    +            T   G       +        L
Sbjct: 14  DRPIRVMVVDDHPMWRDAVAR-DLTESGFDVV-----ATAGDGPQAVRRAKAVSPDVLVL 67

Query: 75  DSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLT 134
           D  +       + + +  S              L         + +         Y   +
Sbjct: 68  DLNLPGMPGVQVCKELVGSH--------PGLRVLVLSASGEHADVLEAVKSGATGYLLKS 119

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECL 194
                +   +        +        +       A+          K  +LT RE E L
Sbjct: 120 ASTQELTDAVRSTAAGDPVFTPGLAGLVLGEYRRLASDPAPVASDEPKAPQLTDRETEVL 179

Query: 195 TWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
             +++G +  +IA  L IS  TV N++ + + K     R   + YA+   +
Sbjct: 180 RLVAKGLSYKQIAERLVISHRTVQNHVQNTLGKLQLHNRVELVRYAIERGL 230


>gi|320011566|gb|ADW06416.1| two component transcriptional regulator, LuxR family [Streptomyces
           flavogriseus ATCC 33331]
          Length = 214

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 35/227 (15%), Positives = 70/227 (30%), Gaps = 17/227 (7%)

Query: 19  RTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSI 77
               +  +    D       L   +     +  + E   GA               +D  
Sbjct: 1   MADKIIKVLLVDDHQVVRRGLRTFLEIQDDIEVVGEASDGAEGVARTEELRPDVVLMDIK 60

Query: 78  VSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           +      + +R +   E             L    F      +       + Y     D 
Sbjct: 61  MPGTDGIEALRRLRELENP--------ARVLIVTSFTEQRTVVPALRAGASGYVYKDVDP 112

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
             +   +  +     ++  +    +           +      G+   LT RE E L  I
Sbjct: 113 DALAGAIRSVHAGHVLLQPEVAGALL--------AQEDTGNGTGRGSTLTEREREVLGLI 164

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           ++G+++ EIA  L +S  TV  ++++I+ K     R+ A  +AVR+ 
Sbjct: 165 ADGRSNREIARALVLSEKTVKTHVSNILMKLDLSDRTQAALWAVRHG 211


>gi|269925915|ref|YP_003322538.1| two component transcriptional regulator, LuxR family [Thermobaculum
           terrenum ATCC BAA-798]
 gi|269789575|gb|ACZ41716.1| two component transcriptional regulator, LuxR family [Thermobaculum
           terrenum ATCC BAA-798]
          Length = 226

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 43/242 (17%), Positives = 81/242 (33%), Gaps = 27/242 (11%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  +       VSH  +    L  +                    G +   LV   
Sbjct: 3   IKVLLVDDHPLFRQGVSHALSNFPDLEVVGEASD---------------GQAAIRLVDKL 47

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      +  R +     +           +   +     +         
Sbjct: 48  SPDVVVVDINLEGLNGLEATRVIRRRYPN--------VGVVILTMHEDDEQLFNAIKAGA 99

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKD---F 184
             Y +      R+   +  +     II  + + +   +A+     F+       ++    
Sbjct: 100 AAYVTKDTSPDRLVDIIRRVGKGEYIINENLITK-PFVASRVLKQFRDLAALEDEENLFT 158

Query: 185 ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            LT REVE L  I+ G ++ EIA  + IS  TV N+I SI+RK A   R+ A+ YA++  
Sbjct: 159 PLTSREVEILDCIARGMSNKEIARQMSISDQTVKNHITSILRKLAVNDRTQAVIYALKRG 218

Query: 245 IV 246
            +
Sbjct: 219 WI 220


>gi|163940056|ref|YP_001644940.1| two component LuxR family transcriptional regulator [Bacillus
           weihenstephanensis KBAB4]
 gi|163862253|gb|ABY43312.1| two component transcriptional regulator, LuxR family [Bacillus
           weihenstephanensis KBAB4]
          Length = 213

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 31/220 (14%), Positives = 67/220 (30%), Gaps = 16/220 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           L    D       L   +        + E   G      V+ +      +D  +      
Sbjct: 5   LLLVEDHHIVRRGLVFFLKTREEFEIIGEAANGEEALTFVQTERPDVVLMDLSMPKMDGI 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +  + +      +Y   ++         F      +       + Y        ++   +
Sbjct: 65  EATKRI-----KQYDETIKILMLSS---FSEQDYVLPALEAGADGYQLKEVQPDQLVASI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
           + ++             +                       LT RE E L  I++G+++ 
Sbjct: 117 VAVYQGNANFHPKVTPAL-------LGRSAVKKEKENPFSMLTKREQEVLREIAKGRSNK 169

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EIA  L I+  TV  ++++++ K     R+ A  YAV++ 
Sbjct: 170 EIAAELHITEQTVKTHVSNVLAKLEVDDRTQAALYAVKHG 209


>gi|223043570|ref|ZP_03613615.1| two-component response regulator [Staphylococcus capitis SK14]
 gi|222443058|gb|EEE49158.1| two-component response regulator [Staphylococcus capitis SK14]
          Length = 207

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/238 (15%), Positives = 76/238 (31%), Gaps = 33/238 (13%)

Query: 9   NIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDL 68
            +VL  +       +  L +  D L  +       ++   +                  L
Sbjct: 3   KVVLVDDHHIVRQGLEFLLSTVDDLEVVKGFSDGKTFLSYIEQ--------------HHL 48

Query: 69  FQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDN 128
                LD ++      ++   +             +   L    +      I+      +
Sbjct: 49  PDIVLLDLVMPEMNGIEITEVLKRQ--------YPQVKVLVLTSYVDDEHVISAIDKGAD 100

Query: 129 RYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTG 188
            Y     +  ++   +  +    RII  +    I  ++                  +L+ 
Sbjct: 101 GYEMKDVEPQKLIETIHKVLNGERIIHPEAKSVIETVSKKPHF-----------TNKLSK 149

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           REVE L  + +GKT+ EIA  L +S  T+  +++ I  K     R+ A  YA+ N ++
Sbjct: 150 REVEVLREMVKGKTNKEIAQTLFVSEKTIKTHVSHIFNKLQVTDRTQAAIYAMENKLI 207


>gi|330870194|gb|EGH04903.1| putative LuxR family regulatory protein [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 280

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 45/247 (18%), Positives = 84/247 (34%), Gaps = 22/247 (8%)

Query: 18  QRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI 77
            R +  S +       + +        W   +  +   +G +H+L+    +         
Sbjct: 11  ARRTAPSTVLQA---FSELAREHNPCDWERHLRKVMRQLGFAHYLISLSPMRPWTGNPLA 67

Query: 78  -VSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFH-----------TLPENITPPAG 125
            V + +P   + C           +L+   +   P+F                      G
Sbjct: 68  GVITTFPRTWLDCYCCDGLLDIDPILKHCRQELVPMFWAQQGRRARGRTRHFWQRREEHG 127

Query: 126 MDNRYCSLTFDVARIRIGLMLLFPKGRIILRD-----RLWEIGLLAAYQANMFKSYDVHW 180
           + +          R+R  L + F    +   D         + +L  Y  +         
Sbjct: 128 LCHGLSIP-LRYERLRGTLSVAFDGTGVHEDDGFAHPAAALLFMLVPYLVSGLGRRWQTD 186

Query: 181 GK-DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
              + +LT RE+ECL W S GKTS EI+ IL  S  TV+ ++ +  RK  + +R  A+  
Sbjct: 187 NPCNDDLTPRELECLYWASAGKTSWEISHILTRSERTVDFHLLNARRKLGSVSRQQAVGS 246

Query: 240 AVRNNIV 246
           A    ++
Sbjct: 247 AAARGLL 253


>gi|260461224|ref|ZP_05809472.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|319785401|ref|YP_004144877.1| Autoinducer-binding domain protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|259032761|gb|EEW34024.1| transcriptional regulator, LuxR family [Mesorhizobium opportunistum
           WSM2075]
 gi|317171289|gb|ADV14827.1| Autoinducer-binding domain protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 248

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/227 (17%), Positives = 76/227 (33%), Gaps = 19/227 (8%)

Query: 39  LDCTVSWTMRMYALTEYVGASHFLLVRWDLFQ----EQKLDSIVSSDWPFDLVRCMALSE 94
           +  +      + A                  Q      + DS +  ++P +         
Sbjct: 20  VAESEQLFELLSAFALNFDCPWIAYGPLAPEQRVLKPTRPDSAMMWNYPDEWQERYLKMG 79

Query: 95  KDKYYNVLQRPTELFCPVFHTLPE-------------NITPPAGMDNRYCSLTFDVARIR 141
             K   ++++  +   P   +                +     G+ +         A   
Sbjct: 80  YAKIDPLIKKGRKGVGPFRWSEVYTHESTTENERRVLDEAGTFGLKSGVTVPLHGPAGSF 139

Query: 142 IGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKD--FELTGREVECLTWISE 199
             +         +    +  + + A                +  ++++ RE EC+ WIS+
Sbjct: 140 KLMCFAKSADCELENRAITYLQIAAVQFHLRVAKLGTQRSSEHAYKISDRERECIHWISK 199

Query: 200 GKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           GKTS EI  ILG S+NTV+ ++ ++MRK  T  R+   A AV   I+
Sbjct: 200 GKTSGEIGTILGRSQNTVDFHVKNVMRKLDTTRRTALAAKAVELGII 246


>gi|319787738|ref|YP_004147213.1| LuxR family transcriptional regulator [Pseudoxanthomonas suwonensis
           11-1]
 gi|317466250|gb|ADV27982.1| two component transcriptional regulator, LuxR family
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 213

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 32/239 (13%), Positives = 76/239 (31%), Gaps = 27/239 (11%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + + L  +       +  L      +  +                    G     ++   
Sbjct: 2   IRVCLVDDQTLVRQGIKSLLALDGSIEVVAEAGD---------------GRQAVEMIPQV 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D  +      + ++ ++ +         Q P  +    F      +       
Sbjct: 47  APDVVLMDMRMPVMSGLEALQTLSQAG--------QLPPTIILTTFDDDQLVLAGLKAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y      + ++   +  +   G ++       +     +  N F S      +   LT
Sbjct: 99  RGYLLKDVSLEQLVGAIQTVASGGSLVQPAVTQRLLSGLEHMRNDFVSL----DRPDPLT 154

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  ++ G ++ EIA  LG++  T+ N++++I+ K   + R+ A+  A    +V
Sbjct: 155 DRETEILRLMASGFSNKEIANSLGVAEGTIKNHVSNILSKLGVRDRTRAVLKAFELQLV 213


>gi|271967187|ref|YP_003341383.1| response regulator receiver protein [Streptosporangium roseum DSM
           43021]
 gi|270510362|gb|ACZ88640.1| response regulator receiver protein [Streptosporangium roseum DSM
           43021]
          Length = 227

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 31/229 (13%), Positives = 66/229 (28%), Gaps = 10/229 (4%)

Query: 18  QRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI 77
            R   V   P        ++  +  V+            G +     R  +     +D  
Sbjct: 3   IRVLLVDDQPLLRTGFRLILEAEPDVTVVGEAGD-----GKAAQDQSRALMPDVVLMDIR 57

Query: 78  VSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           +      +  R +              P  L    F      +       + +       
Sbjct: 58  MPGVDGIEATRRIVREAVS----GAHVPKVLVLTTFDLDEYIVEALRAGASGFLLKDVPP 113

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
             +   + ++     I+       +      +            +   LT RE+E L  I
Sbjct: 114 DELVQAIRVVAAGDAIVAPSVTRRLLDRFGARLPSAHQQPTPA-RLDRLTEREMEVLRLI 172

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + G ++ EIA  L +S  TV  ++ +++ K   + R  A+  A    ++
Sbjct: 173 ARGMSNAEIAAELVVSETTVKTHVGNVLTKLGLRDRVQAVVLAYETGLI 221


>gi|241206852|ref|YP_002977948.1| LuxR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860742|gb|ACS58409.1| transcriptional regulator, LuxR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 251

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 41/243 (16%), Positives = 80/243 (32%), Gaps = 29/243 (11%)

Query: 32  LLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQE-----QKLDSIVSSDWPFDL 86
           LL  +       +    +  +    G  ++ L             +   + ++  WP   
Sbjct: 9   LLVILEECSNPEAVITELEQILRGCGFEYYGLPHHLPQSPLQQNPEPWAAALAGRWPEQW 68

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFHTLPENI----------------TPPAGMDNRY 130
            +  A  +      +++       P                             G+++ Y
Sbjct: 69  PQIYAAKKYALIDPMVRYLAHAQRPFRWREAMAAFRKDAYHRRMEQMMVDAFGHGLEDGY 128

Query: 131 CSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFK-------SYDVHWGKD 183
                  + I   L L   K   +    +  +  +A               + +     D
Sbjct: 129 IFPIHGRSGILGSLSLAG-KPIELSPVEIALLEAVARKAFWRLLDLKGEAQALETVLPAD 187

Query: 184 FELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRN 243
             LT RE+E L +++EG TS EI+ +L IS +TV+ Y+  +  K   K R  A+A A R+
Sbjct: 188 TPLTRREMEILHYLAEGMTSMEISKMLKISNHTVDWYMNGLQDKLKAKNRQHAVALAFRH 247

Query: 244 NIV 246
            ++
Sbjct: 248 GLI 250


>gi|283832684|ref|ZP_06352425.1| regulatory protein SdiA [Citrobacter youngae ATCC 29220]
 gi|291072359|gb|EFE10468.1| regulatory protein SdiA [Citrobacter youngae ATCC 29220]
          Length = 240

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 42/231 (18%), Positives = 79/231 (34%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   +         +   T+++    + L         +  + + + +P   V 
Sbjct: 10  RRSMLLRFQEMATAEDVYNELQQQTQHLEFDFYALCVRHPVPFTRPKTSLYTTYPKAWVA 69

Query: 89  CMALSEKDKYYNVLQR--PTELFCPVFHTLP------ENITPPAGMDNRYCSLTFDVARI 140
                       VL+    ++   P   TL        +     G+            R 
Sbjct: 70  HYQSENYFAIDPVLKPENFSQGHLPWSDTLFRDAQPLWDAARNHGLRKGMTQCLMLPNRA 129

Query: 141 RI--GLMLLFPKGRIILRDRLW-EIGLLAAYQANMF--KSYDVHWGKDFELTGREVECLT 195
                +     +   +  D +   + LL     ++      D+    +   + RE E L 
Sbjct: 130 LGFLSVSRANIRNSRLANDEVELRMQLLVRESLSVLMRLEDDMVMVPEMRFSKREKEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSSEIAIILSISENTVNFHQKNMQKKFNAPNKTQIACYAAATGLI 240


>gi|257487581|ref|ZP_05641622.1| LuxR transcriptional regulator [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|331012605|gb|EGH92661.1| LuxR transcriptional regulator [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 247

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 33/228 (14%), Positives = 72/228 (31%), Gaps = 23/228 (10%)

Query: 40  DCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYY 99
                          ++G   +        +  K   ++ S++P   ++    S      
Sbjct: 22  APLRQLIEDFENDLHHIGDFTYAYFSTPKTRNVKP--VILSNYPDSWLKSYVASNYHLID 79

Query: 100 NVLQRPTELFCPVFHTLPEN------------ITPPAGMDNRYCSLTFDVARIRIGLMLL 147
            +++       P F     N             +    + +       D + +   L L 
Sbjct: 80  PIIKHAWHSITPFFWREARNAVQGVETDDFLKRSAKYQLSSGATFTLHDASGLFAALSLC 139

Query: 148 FPKG----RIILRDRLWEIGLLAAYQANMFKSYDVHW-----GKDFELTGREVECLTWIS 198
             +        +R++  +I +      +                  +L+ RE   L W++
Sbjct: 140 NARQQNDFDQRIREKAADIQMSLIRFHDRLIKTRAPHELFPQPAQCKLSTRETGVLKWVA 199

Query: 199 EGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            GK+  EIA I  IS  TV  +++++  K   +T   A+  A+   +V
Sbjct: 200 MGKSYSEIAEIFSISERTVKFHMSNVSSKLKVRTAKQAVYKAINMGMV 247


>gi|257893584|ref|ZP_05673237.1| regulatory protein [Enterococcus faecium 1,231,408]
 gi|260560505|ref|ZP_05832679.1| regulatory protein [Enterococcus faecium C68]
 gi|261209022|ref|ZP_05923427.1| regulatory protein [Enterococcus faecium TC 6]
 gi|289565166|ref|ZP_06445618.1| response regulator LiaR [Enterococcus faecium D344SRF]
 gi|293563601|ref|ZP_06678047.1| DNA-binding response regulator, LuxR family [Enterococcus faecium
           E1162]
 gi|293569319|ref|ZP_06680617.1| DNA-binding response regulator, LuxR family [Enterococcus faecium
           E1071]
 gi|294615290|ref|ZP_06695166.1| DNA-binding response regulator, LuxR family [Enterococcus faecium
           E1636]
 gi|294619055|ref|ZP_06698550.1| DNA-binding response regulator, LuxR family [Enterococcus faecium
           E1679]
 gi|314939788|ref|ZP_07847008.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133a04]
 gi|314942017|ref|ZP_07848877.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133C]
 gi|314950011|ref|ZP_07853304.1| response regulator receiver domain protein [Enterococcus faecium
           TX0082]
 gi|314953533|ref|ZP_07856445.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133A]
 gi|314992148|ref|ZP_07857595.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133B]
 gi|314995132|ref|ZP_07860248.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133a01]
 gi|257829963|gb|EEV56570.1| regulatory protein [Enterococcus faecium 1,231,408]
 gi|260073507|gb|EEW61835.1| regulatory protein [Enterococcus faecium C68]
 gi|260077061|gb|EEW64783.1| regulatory protein [Enterococcus faecium TC 6]
 gi|289162987|gb|EFD10835.1| response regulator LiaR [Enterococcus faecium D344SRF]
 gi|291588025|gb|EFF19875.1| DNA-binding response regulator, LuxR family [Enterococcus faecium
           E1071]
 gi|291591848|gb|EFF23481.1| DNA-binding response regulator, LuxR family [Enterococcus faecium
           E1636]
 gi|291594716|gb|EFF26098.1| DNA-binding response regulator, LuxR family [Enterococcus faecium
           E1679]
 gi|291604451|gb|EFF33939.1| DNA-binding response regulator, LuxR family [Enterococcus faecium
           E1162]
 gi|313590623|gb|EFR69468.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133a01]
 gi|313593289|gb|EFR72134.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133B]
 gi|313594456|gb|EFR73301.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133A]
 gi|313599194|gb|EFR78039.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133C]
 gi|313640928|gb|EFS05508.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133a04]
 gi|313643658|gb|EFS08238.1| response regulator receiver domain protein [Enterococcus faecium
           TX0082]
          Length = 210

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/239 (16%), Positives = 79/239 (33%), Gaps = 31/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  + E     VS   +  + +  +   +                G   +      
Sbjct: 2   IKVLLVDDHEMVRLGVSSYLSIQEDIEVIGEAEN---------------GRQGYEKAMAL 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++      +  + +             +   +    F    +         
Sbjct: 47  RPDVILMDLVMEEMDGIESTKAILKDW--------PKAKIIIVTSFIDDEKVYPAIEAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y   T     I   +       R++  +   ++         M +  D    +  ELT
Sbjct: 99  AGYLLKTSTAHEIADAIRATQRGERVLEPEVTTKM------MEKMSRRNDPVLHE--ELT 150

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  ISEGK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA ++ +V
Sbjct: 151 NRENEILMLISEGKSNQEIADELFITLKTVKTHVSNILAKLEVEDRTQAAIYAFKHGLV 209


>gi|296130675|ref|YP_003637925.1| two component transcriptional regulator, LuxR family [Cellulomonas
           flavigena DSM 20109]
 gi|296022490|gb|ADG75726.1| two component transcriptional regulator, LuxR family [Cellulomonas
           flavigena DSM 20109]
          Length = 226

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 34/231 (14%), Positives = 68/231 (29%), Gaps = 15/231 (6%)

Query: 23  VSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSD 81
           ++ +    D           V     +  + E   G      V         +D  +   
Sbjct: 1   MTTVLLVDDQPLLRTGFRLVVESEPDLEVVGEAADGRVALSQVAGLAPDVVLMDIRMPGM 60

Query: 82  WPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIR 141
              +  R +     D           L    F              + +   +     + 
Sbjct: 61  DGVEATRRIVAEHPD--------SRVLVLTTFDVDDLAFAALRAGASGFLLKSARPDELV 112

Query: 142 IGLMLLFPKGRIILRDRLWE-IGLLAAYQANMFKSYDV-----HWGKDFELTGREVECLT 195
             +  +     ++    L   + L A +     +  D         +   LT RE++ L 
Sbjct: 113 DAIRTVAAGTSVVAPRVLRRMLDLFAPHLPAGAEDGDPQERTGPHPRLRGLTPRELDVLR 172

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            I+EG ++ EIA  L +S  TV  ++ ++  K   + R  A+  A    +V
Sbjct: 173 LIAEGASNAEIAAELVVSETTVKTHVGNVFAKLGARDRVQAVIIAYECGVV 223


>gi|83747411|ref|ZP_00944450.1| SolR [Ralstonia solanacearum UW551]
 gi|207744773|ref|YP_002261165.1| transcriptional activator protein solr [Ralstonia solanacearum
           IPO1609]
 gi|83725868|gb|EAP73007.1| SolR [Ralstonia solanacearum UW551]
 gi|206596183|emb|CAQ63110.1| transcriptional activator protein solr [Ralstonia solanacearum
           IPO1609]
          Length = 236

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 36/234 (15%), Positives = 72/234 (30%), Gaps = 14/234 (5%)

Query: 27  PTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDL 86
           P   D        +        + ++   +G  +            K    +   +P   
Sbjct: 3   PGFQDAYHAFRTAEDERQLFREIASIARQLGFDYCCYGARMPLPVSKPAVAIFDTYPAGW 62

Query: 87  VRCMALSEKDKYYNVLQRPTELFCPVFH--------TLPENITPPAGMDNRYCSLTFDVA 138
           ++    +        ++        +              +    AG++      ++   
Sbjct: 63  MQHYQANGFLDIDPTVRAGASSGDMIVWPVSIRDEAARLWSDARDAGLNVGVARSSWTAH 122

Query: 139 RIRIGLMLLFPKGRIILRD------RLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVE 192
                L L      +   +          +  LA    + F    +    +  LT RE E
Sbjct: 123 GAFGLLTLARHADPLTAAELGRLSIATHWLANLAHTLMSPFLVPKLVPESNAVLTARERE 182

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            L W  EGKT+ EI  IL IS  TVN ++ +++ K A   +  A+  A+   ++
Sbjct: 183 VLCWTGEGKTAYEIGQILHISERTVNFHVNNVLLKLAATNKVQAVVKAIATGLI 236


>gi|6716341|gb|AAF26601.1|AF110468_3 PsyR [Pseudomonas syringae pv. tabaci]
          Length = 246

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 33/227 (14%), Positives = 72/227 (31%), Gaps = 22/227 (9%)

Query: 40  DCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYY 99
                          ++G   +        +  K   ++ S++P   ++    S      
Sbjct: 22  APLRQLIEDFENDLHHIGDFTYAYFSTPKTRNVKP--VILSNYPDSWLKSYVASNYHLID 79

Query: 100 NVLQRPTELFCPVFHTLPEN-----------ITPPAGMDNRYCSLTFDVARIRIGLMLLF 148
            +++       P F    E             +    + +       D + +   L L  
Sbjct: 80  PIIKHAWHSITPFFWREAECCSGRRTDDFLKRSAKYQLSSGATFTLHDASWLFAALSLCN 139

Query: 149 PKG----RIILRDRLWEIGLLAAYQANMFKSYDVHW-----GKDFELTGREVECLTWISE 199
            +        +R++  +I +      +                  +L+ RE   L W++ 
Sbjct: 140 ARQQNDFDQRIREKAADIQMSLIRFHDRLIKTRAPHELFPQPAQCKLSTRETGVLKWVAM 199

Query: 200 GKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           GK+  EIA I  IS  TV  +++++  K   +T   A+  A+   +V
Sbjct: 200 GKSYSEIAEIFSISERTVKFHMSNVSSKLKVRTAKQAVYKAINMGMV 246


>gi|21230586|ref|NP_636503.1| two-component system regulatory protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66769421|ref|YP_244183.1| two-component system regulatory protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188992608|ref|YP_001904618.1| Two-component system regulatory protein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21112164|gb|AAM40427.1| two-component system regulatory protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66574753|gb|AAY50163.1| two-component system regulatory protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167734368|emb|CAP52578.1| Two-component system regulatory protein [Xanthomonas campestris pv.
           campestris]
          Length = 213

 Score =  132 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 73/229 (31%), Gaps = 17/229 (7%)

Query: 18  QRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI 77
            R   V         +  ++ LD  +             G      +         +D  
Sbjct: 2   IRVCLVDDQTLVRQGIRSLLALDAGIEVVAEA-----ADGRQAVEQIPQIQPDVVLMDMR 56

Query: 78  VSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           +      + ++ ++ +              +    F      +         Y      +
Sbjct: 57  MPVMSGLEALQMLSRNGTLP--------PTIILTTFDDDQLVLAGLKAGAKGYLLKDVSL 108

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
            ++   +  +   G ++       +     +  N F S      +   LT RE E L  +
Sbjct: 109 EQLVGAIRTVADGGSLVQPAVTQRLLSGLEHMRNEFVSL----DRPDPLTDRETEILRLM 164

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + G ++ EIA  LG++  T+ N++++I+ K   + R+ A+  A    +V
Sbjct: 165 ASGFSNKEIANSLGVAEGTIKNHVSNILSKLGVRDRTRAVLKAFELQLV 213


>gi|294812452|ref|ZP_06771095.1| Putative two-component system response regulator [Streptomyces
           clavuligerus ATCC 27064]
 gi|326441089|ref|ZP_08215823.1| putative two-component system response regulator [Streptomyces
           clavuligerus ATCC 27064]
 gi|294325051|gb|EFG06694.1| Putative two-component system response regulator [Streptomyces
           clavuligerus ATCC 27064]
          Length = 236

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 35/230 (15%), Positives = 71/230 (30%), Gaps = 10/230 (4%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D           +S    +  + E   G +     R        +D  +     
Sbjct: 4   RVLIVDDQAMVRAGFAALLSAQPDIEVVGEAADGRAGVAAARTARPDVVLMDVRMPELDG 63

Query: 84  FDLVRCMALSEKDKYYNV-------LQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFD 136
               R +  +               +  P  L    F              + +      
Sbjct: 64  LAATREILAARPPASEPAPSSGPEGVSGPRVLMLTTFDVDDYVYEALRSGASGFLLKDAP 123

Query: 137 VARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTW 196
            A +   + ++     ++       +  +A + A           +  ELT RE E L  
Sbjct: 124 PADLIAAVRVVAAGEALLAPSVTRRL--IADFAARHPAPRKGTGHRPKELTPRETEVLEL 181

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           I++G ++ EIA  L ++  TV  +I  I+ K   + R+ A+ +A  + +V
Sbjct: 182 IAQGLSNLEIAERLVVAEQTVKTHIGRILAKLRLRDRAQAVIFAYESGLV 231


>gi|300869019|ref|ZP_07113622.1| two-component response regulator [Oscillatoria sp. PCC 6506]
 gi|300332999|emb|CBN58814.1| two-component response regulator [Oscillatoria sp. PCC 6506]
          Length = 228

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/239 (16%), Positives = 80/239 (33%), Gaps = 26/239 (10%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + I+L  +DE     +     +   L  +   +                G +   L +  
Sbjct: 7   LRILLVEDDELFRLGLQTRLQQEQCLQVIAEAED---------------GETAVELTQEH 51

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
           L     LD  +      +  + +     +    VL   +    P+           A   
Sbjct: 52  LPDVVVLDIGLPGIGGIEACKQIKQHHPEI--PVLVLTSHSQKPLI------ERLIAAGV 103

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             YC        + + +  +        +    E   + +   N    +      +  LT
Sbjct: 104 QGYCLKGIAAETLVLAIRSVAAGASWWDKAATTE---IRSAITNNESKFVPKSELENPLT 160

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  ++ GK++ EIA IL I+  TV  ++ +I++K   + R+ A   A++  +V
Sbjct: 161 KREQEILALVAAGKSNQEIAQILYIASGTVRVHVHAILQKLEVRDRTQAAVVAIQKGLV 219


>gi|192290718|ref|YP_001991323.1| LuxR family transcriptional regulator [Rhodopseudomonas palustris
           TIE-1]
 gi|192284467|gb|ACF00848.1| transcriptional regulator, LuxR family [Rhodopseudomonas palustris
           TIE-1]
          Length = 240

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 42/225 (18%), Positives = 71/225 (31%), Gaps = 15/225 (6%)

Query: 36  MIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLD---SIVSSDWPFDLVRCMAL 92
           +   D   +  + + A  +  G SH +            +   ++V   WP    R    
Sbjct: 16  VERADTPDAVALALLAAVQVHGFSHVIAGVIPTPGTSAKEQIANVVLHQWPDVWSRRYFS 75

Query: 93  SEKDKYYNVLQRPTELFCPVFHTLPEN-----------ITPPAGMDNRYCSLTFDVARIR 141
                    ++R T    P   T   +                G+   +      +    
Sbjct: 76  KGYIFTDPAIRRVTSSMVPFSWTELWDHDSPAGHRILGEAAEFGLKEGFTVPMVTLDGHS 135

Query: 142 IGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGK 201
            GL +       +       + ++A Y                 LT RE + L WI+EGK
Sbjct: 136 AGLSIAGAMTE-LPPHLRGPVQMMAIYSFARAAHLRERPPAPVTLTIREADVLHWIAEGK 194

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T  EIA IL +S + V+     I  K     R  A+  A+R  ++
Sbjct: 195 TDWEIARILQVSEHLVDKVARQIKSKFQVVNRVQAVVQAMRAGVI 239


>gi|198283772|ref|YP_002220093.1| LuxR family transcriptional regulator [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218665417|ref|YP_002426403.1| autoinducer-binding transcriptional regulator, LuxR family
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|71044540|gb|AAV53702.2| AfeR [Acidithiobacillus ferrooxidans]
 gi|198248293|gb|ACH83886.1| transcriptional regulator, LuxR family [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218517630|gb|ACK78216.1| autoinducer-binding transcriptional regulator, LuxR family
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 237

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 42/231 (18%), Positives = 75/231 (32%), Gaps = 14/231 (6%)

Query: 30  SDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRC 89
            DLL     ++C          +   +   +            +  +++ S++P      
Sbjct: 6   EDLLQTFQSIECERQVLAMASEMARKLEFDYCAYGLRMPLPLVRPKTVLFSNYPAVWQAR 65

Query: 90  MALSEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVARIR 141
               E       ++       PV  +                 G+         D   + 
Sbjct: 66  YQAQEYQAIDPTVRHAMRSPSPVVWSDDLFAPARELWEEARSFGLRAGLAHTCRDAGGMG 125

Query: 142 IGLMLLFPKGRIILRD----RLWEIGLLAAYQANMFKSYDVHWGKD--FELTGREVECLT 195
             L L      +   +        + L+ A   +M +        +   +L+ REVE L 
Sbjct: 126 GMLTLARAGETVTTAEWQAKACHILWLVQAVHLSMIRVIAPKLQPEIAVQLSCREVEVLR 185

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W  EGKTS EIA IL I+  TVN +I+  M K     ++ A+  A    ++
Sbjct: 186 WTGEGKTSGEIANILNITERTVNFHISKAMAKLNAVNKTAAVLQAAMLGLL 236


>gi|167742620|ref|ZP_02415394.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 14]
 gi|167914947|ref|ZP_02502038.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei 112]
 gi|167922782|ref|ZP_02509873.1| autoinducer-binding transcriptional regulator, LuxR family protein
           [Burkholderia pseudomallei BCC215]
          Length = 210

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/210 (19%), Positives = 76/210 (36%), Gaps = 12/210 (5%)

Query: 49  MYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTEL 108
           M      +G  +        F       ++ S++P         +        ++     
Sbjct: 1   MTRAAATLGYEYAAYGMRRPFPISNPPILMVSNYPARWQERYIEARFANIDGAVKAALGS 60

Query: 109 FCPVFHTLP--------ENITPPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLW 160
             PV  + P               G+ + + S +         L L   +  I   ++  
Sbjct: 61  DRPVTWSAPANASKSAFWAEALSFGIAHGWSSASRGADGAIGVLTLSRTQDPIDTAEKFR 120

Query: 161 E---IGLLAAYQANMFKSYDVHWGK-DFELTGREVECLTWISEGKTSDEIAVILGISRNT 216
               +  LA         +     + D +LT RE + L W ++GKT+ EIA+IL IS +T
Sbjct: 121 NESIVHWLANVAHASMAPFLPAADEFDPDLTRRETDVLKWTADGKTAYEIALILSISEST 180

Query: 217 VNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           VN ++ +I+ K  +  +  A+A A    ++
Sbjct: 181 VNFHVKNIVSKLGSTNKIQAVAKAALMGML 210


>gi|298242112|ref|ZP_06965919.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
 gi|297555166|gb|EFH89030.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
          Length = 273

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 34/245 (13%), Positives = 67/245 (27%), Gaps = 32/245 (13%)

Query: 3   FEIQQVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFL 62
             +  + +++  + +     V  L      +                       G     
Sbjct: 57  KSMDPLTVLIVDDHQFFRDGVQALLDAQPDIECAGEATT---------------GCEAIR 101

Query: 63  LVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITP 122
           L          +D  + S    D  R +  +        ++         F         
Sbjct: 102 LAAERQPDVVFMDVHMPSMSGVDATRQIVSN-----SPQIRVLVVTM---FEDDHLVFAA 153

Query: 123 PAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGK 182
                  Y         +   +  +     I           +A    + F +       
Sbjct: 154 MRAGARGYLLKGVRHEDMVRAIRAVGSGDAIFSPA-------IATRLVSYFSALQPEHPS 206

Query: 183 DF--ELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
               EL+ RE + L  +++G  + EIA  L +S  TV NY+++I+ K     R+ AI  A
Sbjct: 207 QIFPELSHRERDILALLAQGCKNAEIAERLVVSPKTVRNYVSNIISKLQVADRAQAILRA 266

Query: 241 VRNNI 245
               +
Sbjct: 267 KDAGL 271


>gi|239979247|ref|ZP_04701771.1| putative two-component system response regulator [Streptomyces
           albus J1074]
          Length = 227

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 32/229 (13%), Positives = 65/229 (28%), Gaps = 11/229 (4%)

Query: 18  QRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI 77
            R   V          A ++     +             G S   + R        +D  
Sbjct: 3   IRVIIVDDQGMVRAGFAALLSAQSDIDVVGEA-----ADGRSGIEVSRKTHPDIVLMDVR 57

Query: 78  VSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDV 137
           +         R +             RP  +    F              + +       
Sbjct: 58  MPEMDGLTATREL----LSPEPGTAHRPKVIMLTTFDVDDYVYEALHAGASGFLLKDSPP 113

Query: 138 ARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWI 197
           A +   + ++     ++          +        +       +   LT RE E L  +
Sbjct: 114 ASLVSAVRVIHGGNALLDPAVTRR--FIEDIVRRRPRPRRDPRLQLNGLTPRETEVLELV 171

Query: 198 SEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           + G ++ EIA  L ++  TV  +I+ I+ K   + R+ A+  A  + +V
Sbjct: 172 ARGLSNLEIAEQLVLAEQTVKTHISRILSKLGIRDRAQAVIAAYESGLV 220


>gi|91976651|ref|YP_569310.1| regulatory protein, LuxR [Rhodopseudomonas palustris BisB5]
 gi|91683107|gb|ABE39409.1| regulatory protein, LuxR [Rhodopseudomonas palustris BisB5]
          Length = 240

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 42/225 (18%), Positives = 71/225 (31%), Gaps = 15/225 (6%)

Query: 36  MIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLD---SIVSSDWPFDLVRCMAL 92
           +   D   +  + + A  +  G SH +            +   ++V   WP    R    
Sbjct: 16  VERADTPDAVALALLAAVQVHGFSHVIAGVIPTPGTSAKEQIANVVLHQWPDVWSRRYFS 75

Query: 93  SEKDKYYNVLQRPTELFCPVFHTLPEN-----------ITPPAGMDNRYCSLTFDVARIR 141
                    ++R T    P   T   +                G+   +      +    
Sbjct: 76  KGYIFTDPAIRRVTSSMVPFSWTELWDHDSPAGHRILGEAAEFGLKEGFTVPMVTLDGHS 135

Query: 142 IGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGK 201
            GL +       +       + ++A Y                 LT RE + L WI+EGK
Sbjct: 136 AGLSIAGAITE-LPPHLRGPVQMMAIYSFARAAHLRERPPAPVTLTIREADVLHWIAEGK 194

Query: 202 TSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T  EIA IL +S + V+     I  K     R  A+  A+R  ++
Sbjct: 195 TDWEIARILQVSEHLVDKVARQIKSKFQVVNRVQAVVQAMRAGVI 239


>gi|148258315|ref|YP_001242900.1| LuxR family transcriptional regulator [Bradyrhizobium sp. BTAi1]
 gi|146410488|gb|ABQ38994.1| transcriptional regulator, LuxR family [Bradyrhizobium sp. BTAi1]
          Length = 242

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 36/232 (15%), Positives = 80/232 (34%), Gaps = 17/232 (7%)

Query: 28  TRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
              D +  +     + S   +   +   +G   +++       +    +I+++ WP +  
Sbjct: 9   RALDYVDAIEASKTSASVLSQFEKMIGDLGFHAYIMAGVPAPGQSLQHTILANGWPSEWF 68

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFH-------------TLPENITPPAGMDNRYCSLT 134
              A  +  +Y  + +       P                           ++  +C   
Sbjct: 69  DLYAREQFHRYDPIPRHCLSTLNPFAWSEAPYDRNDEPGAHEVMTRARDFRLNEGFCVPI 128

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHW--GKDFELTGREVE 192
                    + L   +   +  D    + L++ +  +  ++       G+   L+  E E
Sbjct: 129 HYDDA-VGAVSLAG-ERPNLAPDARGALHLISIFTHSRLRALARATSGGQSRRLSRIEAE 186

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
            L+W + GKT+ E A ILG+S   V  ++    RK  TK ++  +A A+ N 
Sbjct: 187 VLSWAARGKTAWETARILGVSERNVRWHLEEAQRKLETKNKTATVATALVNG 238


>gi|220913015|ref|YP_002488324.1| LuxR family transcriptional regulator [Arthrobacter
           chlorophenolicus A6]
 gi|219859893|gb|ACL40235.1| two component transcriptional regulator, LuxR family [Arthrobacter
           chlorophenolicus A6]
          Length = 242

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 33/234 (14%), Positives = 67/234 (28%), Gaps = 7/234 (2%)

Query: 15  EDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKL 74
            D  R + V            +I     +   +      E + A     +         +
Sbjct: 10  ADRIRVALVDDQQLVRSGFGMLINSQPDLDVVVEAGNGLEALQA-----LGAVAADVVLM 64

Query: 75  DSIVSSDWPFDLVRCMALSEKDKYYNVLQR-PTELFCPVFHTLPENITPPAGMDNRYCSL 133
           D  +      +  R +  S         +     +    F      +       + +   
Sbjct: 65  DVRMPGMDGIEATRRLMESALAAPAGSARAELRVVVLTTFDLDEYALAAIQAGASGFLLK 124

Query: 134 TFDVARIRIGLMLLFPKGRIILRDRLWEIG-LLAAYQANMFKSYDVHWGKDFELTGREVE 192
                 +   +  +     +I       +   +A    +       H      LT RE E
Sbjct: 125 DAPPEELLEAIRTVHRGDAVIAPSTTRRLLDHVAPLLRSQGNERPEHHAAVQRLTTRERE 184

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
               I++G+++ EIA  L +S  TV  ++  I+ K   + R  A+  A    +V
Sbjct: 185 VFQLIAQGRSNPEIAAGLFVSEATVKTHVGHILAKLGARDRVQAVVIAYETGVV 238


>gi|229017580|ref|ZP_04174475.1| DNA-binding response regulator [Bacillus cereus AH1273]
 gi|229023797|ref|ZP_04180282.1| DNA-binding response regulator [Bacillus cereus AH1272]
 gi|228737482|gb|EEL87992.1| DNA-binding response regulator [Bacillus cereus AH1272]
 gi|228743723|gb|EEL93828.1| DNA-binding response regulator [Bacillus cereus AH1273]
          Length = 211

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 31/220 (14%), Positives = 68/220 (30%), Gaps = 16/220 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           L    D       L   +        + E   G      V+ +      +D  +      
Sbjct: 5   LLLVEDHHIVRRGLVFFLKTREEFEIIGEAENGEEALTFVQTERPDVVLMDLSMPKMDGI 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +  + +      +Y   ++         F      +       + Y        ++   +
Sbjct: 65  EATKRI-----KQYDETIKILMLSS---FSEQDYVLPAIEAGADGYQLKEVQPDQLVASI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
           + ++             +            +          LT RE E L  I++G+++ 
Sbjct: 117 VAVYQGNANFHPKVTPAL-------LGRSAAKKKKENPFSMLTKREQEVLREIAKGRSNK 169

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EIA  L I+  TV  ++++++ K     R+ A  YAV++ 
Sbjct: 170 EIAAELHITEQTVKTHVSNVLAKLEVDDRTQAALYAVKHG 209


>gi|253575856|ref|ZP_04853190.1| response regulator [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251844650|gb|EES72664.1| response regulator [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 242

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 34/252 (13%), Positives = 71/252 (28%), Gaps = 36/252 (14%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  + +     +  +    + +  +               L               
Sbjct: 12  IKVLLADDHQLFREGLKRILNMEEDIEVVGECGDGAQVLESCLQL--------------- 56

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
             +   +D  +      D    +           L     +   +               
Sbjct: 57  QPEIVLMDINMPLLNGVDATAELRE--------ALPDVKVIILSIHDDESYVFETLRKGA 108

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEI-------------GLLAAYQANMFK 174
             Y     +   +   +  +      I      ++             G +A   A    
Sbjct: 109 TGYLLKDMEAESLINAIRTVAEGNAFIHPKVTGKLIQQLRRMEYLSETGAIAEDTAIREA 168

Query: 175 SYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRS 234
                 G D  LT RE E L  ++EG+++  I   L IS  TV N+++SI++K     R+
Sbjct: 169 GVKFVAGDDNPLTRREAEVLRLMAEGRSNKMIGEHLFISEKTVKNHVSSILQKMDVDDRT 228

Query: 235 GAIAYAVRNNIV 246
            A+  A++   V
Sbjct: 229 QAVINAIKFGWV 240


>gi|330878281|gb|EGH12430.1| transcriptional regulator PsyR [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 247

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 36/228 (15%), Positives = 75/228 (32%), Gaps = 23/228 (10%)

Query: 40  DCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYY 99
                          ++G   +        ++ K   I+ S++P   ++    S      
Sbjct: 22  APLRQLIEDFENDLHHIGDFTYAYFTTPKARKAKP--IILSNYPDSWLKSYIASNYHLID 79

Query: 100 NVLQRPTELFCPVFHTLPEN------------ITPPAGMDNRYCSLTFDVARIRIGLMLL 147
            +++       P F     N             +    + +       D + +   L L 
Sbjct: 80  PIIKHAWHSITPFFWREARNAVQCVETDDFLKRSAKYQLSSGATFTLHDASGLFAALSLC 139

Query: 148 FPKG----RIILRDRLWEIGLLAAYQANMFKSYDVHWG-----KDFELTGREVECLTWIS 198
             K        +RD+  +I +      +                + +L+ RE + L W++
Sbjct: 140 NAKQQHDFDQRIRDKAADIQMSLIRFHDRLIKTRAPHELFPPTVNCKLSSRETDILKWVA 199

Query: 199 EGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            GK   EIA I  IS  TV  +++++  K   +T   A+  A++  +V
Sbjct: 200 MGKAYSEIAEIFSISERTVKFHMSNVSSKLEVRTAKQAVYKAIKMGMV 247


>gi|167755537|ref|ZP_02427664.1| hypothetical protein CLORAM_01051 [Clostridium ramosum DSM 1402]
 gi|237734285|ref|ZP_04564766.1| response regulator [Mollicutes bacterium D7]
 gi|167704476|gb|EDS19055.1| hypothetical protein CLORAM_01051 [Clostridium ramosum DSM 1402]
 gi|229382515|gb|EEO32606.1| response regulator [Coprobacillus sp. D7]
          Length = 224

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 33/237 (13%), Positives = 78/237 (32%), Gaps = 23/237 (9%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + +++  + E     +  +    + L  +  ++        +                  
Sbjct: 2   IKVLIADDQELIRESLKIVLNTHEDLQVIDTVEDGFGVLDSLKR---------------- 45

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                  D I+       +          + Y  ++    +    F       +      
Sbjct: 46  ----NIPDVILMDIRMPRMDGVYCTKMVKEAYPDVKI---IILTTFDDDDFVFSALKFGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + Y      +  +   ++ +   G +I  D   ++  L +  AN   + +V+     EL 
Sbjct: 99  SGYLLKGVSMDGLYQAILTVVSGGAMINPDIATKVFRLFSKMANTNYAINVNDDNVRELN 158

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
             E + +  +  G ++ EIA  L +S  TV NY++SI+ K   + R+    +AV+  
Sbjct: 159 KPEWKVIQQVGFGLSNKEIAQKLFLSEGTVRNYLSSILSKLELRDRTQLAIWAVQTG 215


>gi|229085213|ref|ZP_04217456.1| DNA-binding response regulator [Bacillus cereus Rock3-44]
 gi|228698080|gb|EEL50822.1| DNA-binding response regulator [Bacillus cereus Rock3-44]
          Length = 211

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 32/222 (14%), Positives = 69/222 (31%), Gaps = 16/222 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           L    D       L   +        + E   G      V+ +      +D  +      
Sbjct: 5   LLLVEDHHIVRRGLVFFLKTKEEFEIIGEAENGEEALAFVQKERPDVVLMDVSMPKMDGI 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +  +        +    ++         F      +       + Y        ++   +
Sbjct: 65  EATKR-----LKQQDATIKILMLSS---FSEQDYVLPALEAGADGYQLKEVQPDQLVASI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
           + ++             +  +           +        LT RE E L  I++G+++ 
Sbjct: 117 IAVYQGNANFHPKVTPALLGI-------LSVKEEKQDSFSMLTKREKEVLREITKGRSNK 169

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           EIA  L I+  TV  ++++++ K     R+ A  YAV+N +V
Sbjct: 170 EIAAELHITEQTVKTHVSNVLAKLEVDDRTQAALYAVKNGVV 211


>gi|222150233|ref|YP_002551190.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
 gi|221737215|gb|ACM38178.1| transcriptional regulator LuxR family [Agrobacterium vitis S4]
          Length = 246

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 41/249 (16%), Positives = 82/249 (32%), Gaps = 27/249 (10%)

Query: 21  SFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSS 80
             V+HL      LA            + +  L E+    ++ LVR     +  +  +++ 
Sbjct: 1   MSVNHLIQ---FLAVSQGCRSREELILELEKLLEFYKFDYYGLVRSPKPDQNPMSLVLAG 57

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHT----------------LPENITPPA 124
            WP    +     +       ++   +   P   +                         
Sbjct: 58  RWPEKWPQVYITKKFVLIDPAIRYLAQAQRPFRWSETLTAFSQDPHFKRMQRMMMDAQRF 117

Query: 125 GMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSY-------D 177
           G++  Y         + +  M +  +   +    +     +A                  
Sbjct: 118 GLEEGYIFPIHGRGGL-LANMTIGGRPVELTPIEIMLFDTVAKCAFWRLAEINGEDELLS 176

Query: 178 VHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAI 237
           +    D  LT RE+E L ++ EG TS+E++ +L IS +TV+ Y+  +  K   K R   +
Sbjct: 177 MVQKVDVRLTRRELEILNYLGEGMTSNEMSKLLEISNHTVDWYVNELQDKLNAKNRQHMV 236

Query: 238 AYAVRNNIV 246
           A A R  ++
Sbjct: 237 AIAYRLGLI 245


>gi|261418763|ref|YP_003252445.1| LuxR family transcriptional regulator [Geobacillus sp. Y412MC61]
 gi|297531272|ref|YP_003672547.1| LuxR family transcriptional regulator [Geobacillus sp. C56-T3]
 gi|319765579|ref|YP_004131080.1| LuxR family transcriptional regulator [Geobacillus sp. Y412MC52]
 gi|261375220|gb|ACX77963.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. Y412MC61]
 gi|297254524|gb|ADI27970.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. C56-T3]
 gi|317110445|gb|ADU92937.1| two component transcriptional regulator, LuxR family [Geobacillus
           sp. Y412MC52]
          Length = 210

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 38/239 (15%), Positives = 75/239 (31%), Gaps = 31/239 (12%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  + E     VS   +    +  +   +                G     L    
Sbjct: 2   IKVLLVDDHEMVRLGVSAYLSAQPDMEVIGEAED---------------GKKGVELALQL 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++         R +  +              +    F              
Sbjct: 47  RPDVILMDLVMEPMDGIAATREIIGAW--------PEAKIIVVTSFLDDENVFAALEAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
             Y   T   + I   +   F    +   +   ++      Q               +LT
Sbjct: 99  TSYLLKTSKASEIADAIRATFHGQSVFEPEVAGKVMRNYRKQEERL--------PHEQLT 150

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE+E L  +++GKT+ E+A  L IS  TV  ++++I+ K   + R+ A+ YA R+ +V
Sbjct: 151 SREMEVLLLMAQGKTNQEMADELFISLKTVKVHVSNILAKLGVQDRTQAVIYAFRHGLV 209


>gi|154685393|ref|YP_001420554.1| YhcZ [Bacillus amyloliquefaciens FZB42]
 gi|154351244|gb|ABS73323.1| YhcZ [Bacillus amyloliquefaciens FZB42]
          Length = 214

 Score =  132 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/217 (17%), Positives = 67/217 (30%), Gaps = 16/217 (7%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
             D       L    +    +  + E   GA               +D  +      +  
Sbjct: 6   ADDHHVVRKGLRYFFATQEDIEVVGEASTGAEALQQAEKTEPDIILMDLSMPDMDGIEAA 65

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGLMLL 147
           + +A         V+          +      I         Y         +   L  +
Sbjct: 66  K-IAAERFPDISIVV-------LTSYSDQEHVIPALKAGAKAYQLKDAQPDDLVKTLREV 117

Query: 148 FPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSDEIA 207
           +     +  D       +  +        D    K  +LT RE + L  I++GK++ EIA
Sbjct: 118 YSGRYRLSAD-------IVPHVLTHMVQDDQDKEKYDQLTPREKDVLQEIAKGKSNKEIA 170

Query: 208 VILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
             L IS  TV  ++++++ K     R+ A  YAV+ N
Sbjct: 171 AALFISEKTVKTHVSNLLSKLNLSDRTQAALYAVKYN 207


>gi|329935958|ref|ZP_08285759.1| two-component system response regulator [Streptomyces
           griseoaurantiacus M045]
 gi|329304565|gb|EGG48442.1| two-component system response regulator [Streptomyces
           griseoaurantiacus M045]
          Length = 254

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/234 (15%), Positives = 77/234 (32%), Gaps = 15/234 (6%)

Query: 13  NREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQ 72
           +R++  R   V         L  ++  +  +          E V  +  LL         
Sbjct: 33  SRKEPIRVLVVDDHALFRRGLEIVLAAEEDIQVVGEAGDGAEAVDKAADLL-----PDIV 87

Query: 73  KLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCS 132
            +D  +      +    +          V      +   +     +           Y  
Sbjct: 88  LMDVRMPRRGGIEACTSIKE--------VAPSAKIIMLTISDEEADLYEAIKAGATGYLL 139

Query: 133 LTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVE 192
                  +   +  +      I      ++  L  +++ + ++ +        LT RE+E
Sbjct: 140 KEISTDEVATAIRAVADGQSQISPSMASKL--LTEFKSMIQRTDERRLVPAPRLTDRELE 197

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            L  ++ G  + +IA  L IS NTV N++ +I+ K    +R  A+ YA+R  I+
Sbjct: 198 VLKLVATGMNNRDIAKELFISENTVKNHVRNILEKLQLHSRMEAVVYAMREKIL 251


>gi|271962958|ref|YP_003337154.1| response regulator receiver protein [Streptosporangium roseum DSM
           43021]
 gi|270506133|gb|ACZ84411.1| response regulator receiver protein [Streptosporangium roseum DSM
           43021]
          Length = 234

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 38/233 (16%), Positives = 71/233 (30%), Gaps = 14/233 (6%)

Query: 14  REDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQK 73
             D  R   V         L   +  +  +             G     L          
Sbjct: 13  SGDPIRVLIVDDHALIRRSLEMALSAETDIEVVGEA-----SDGQEAVELADRLTPDVML 67

Query: 74  LDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSL 133
           +D  +      +  R +  S        +     +   V     +           Y   
Sbjct: 68  MDVRMPRRSGIEAARAIKAS--------VPSTRIIMLTVSDEEEDLFEAIKAGATGYLLK 119

Query: 134 TFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVEC 193
              +  +   +  +     +I      ++    A   +  ++          LT RE+E 
Sbjct: 120 NVQLDEVPEAVRGVHEGQSLINPAMAAKLITEFAN-MSRKEAERPPQLPVPRLTDREMEV 178

Query: 194 LTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           L  +++G  + EIA  L IS NTV N++ +I+ K    +R  A+ YAVR  ++
Sbjct: 179 LRLVAKGMNNREIAKQLFISENTVKNHVRNILDKLQLHSRMEAVVYAVRERML 231


>gi|239944210|ref|ZP_04696147.1| putative two-component system response regulator [Streptomyces
           roseosporus NRRL 15998]
 gi|239990666|ref|ZP_04711330.1| putative two-component system response regulator [Streptomyces
           roseosporus NRRL 11379]
 gi|291447682|ref|ZP_06587072.1| two-component system regulator [Streptomyces roseosporus NRRL
           15998]
 gi|291350629|gb|EFE77533.1| two-component system regulator [Streptomyces roseosporus NRRL
           15998]
          Length = 224

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 29/230 (12%), Positives = 66/230 (28%), Gaps = 14/230 (6%)

Query: 17  EQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDS 76
             R                ++  +  +    +        G      V         +D 
Sbjct: 4   PIRAVIADDQMMVRQGFTVLLNAEPDIEVVGQA-----VNGLDAIDKVAGLAPDVVLMDI 58

Query: 77  IVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFD 136
            +      +  R +                 L    F              + +      
Sbjct: 59  RMPELGGIEATRRIT-------SPEGSTVKVLVLTTFDLDEYVYEALRAGASGFLLKDAS 111

Query: 137 VARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTW 196
              +   + ++     ++  +    + +  +  A   +       +  +LT RE E LT 
Sbjct: 112 ADELAHAVRVVASGDALLSPNITKRLIVEFSRTAGAPR--APLKERVGDLTERETEVLTL 169

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           I+ G ++ EIA  L ++  TV  ++  I+ K   + R+ A  +A  + +V
Sbjct: 170 IASGLSNAEIARQLIVAEQTVKTHVGRILVKLGLRDRTQAAVFAYESGLV 219


>gi|297202869|ref|ZP_06920266.1| two-component system response regulator [Streptomyces sviceus ATCC
           29083]
 gi|197715208|gb|EDY59242.1| two-component system response regulator [Streptomyces sviceus ATCC
           29083]
          Length = 230

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 40/234 (17%), Positives = 64/234 (27%), Gaps = 16/234 (6%)

Query: 13  NREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQ 72
                 R           + +  ++ L   V             G     LV        
Sbjct: 5   AETKPARVVVADDQTVVREGIVMLLGLLPGVEVVGAAGD-----GEEAVELVAELAPDVV 59

Query: 73  KLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCS 132
            +D  +      +  R +        Y   Q         F                Y +
Sbjct: 60  LMDLRMPRCDGVEATRRIRAE-----YPATQVV---VLTTFADDESLFPALKAGARGYLT 111

Query: 133 LTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVE 192
                  I   +  +      +       +       ++              LT REVE
Sbjct: 112 KDAGGDEIVRAVQSVLSGDAGLSPSIQRRL---LERLSDPEPPQPAPAEAPDGLTAREVE 168

Query: 193 CLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            L  I+EG T+ EIA  L +S  TV  +I ++  KT  K R+ A+ YA    +V
Sbjct: 169 VLALIAEGLTNQEIARELHVSTATVKTHINNLFAKTGIKDRAQAVRYAYAKGLV 222


>gi|269837643|ref|YP_003319871.1| two component transcriptional regulator, LuxR family [Sphaerobacter
           thermophilus DSM 20745]
 gi|269786906|gb|ACZ39049.1| two component transcriptional regulator, LuxR family [Sphaerobacter
           thermophilus DSM 20745]
          Length = 234

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 43/227 (18%), Positives = 80/227 (35%), Gaps = 14/227 (6%)

Query: 25  HLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGA-SHFLLVRWDLFQEQKLDSIVSSDWP 83
            +    D       +  ++     +  + E   A                LD  +     
Sbjct: 5   EVLIVDDHPLFRRGIRWSLEEERDIRVVGEASDAQEAMRAADMLSPNVVLLDLNLPGMSG 64

Query: 84  FDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIG 143
            +L R +             +   +   +     +  +      + YC+   D A +   
Sbjct: 65  LELCRVLKRRH--------PQAAIVVLTMHEDDEQLFSSIRVGASAYCTKDIDPAELVTV 116

Query: 144 LMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDF----ELTGREVECLTWISE 199
           +  +     +I  + L     +A+   + F+               LT REVE L  ++ 
Sbjct: 117 IRRVARGEYLINENVLSR-PFVASRVLDQFRELAQIDEVSSGVFSPLTPREVEILDCVAR 175

Query: 200 GKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           G ++ EIA +L IS  TV N+I SI+RK A   R+ A+ YA+R+  +
Sbjct: 176 GNSNKEIARLLNISDQTVKNHITSILRKLAVNDRTQAVIYALRHGWI 222


>gi|146454419|gb|ABQ41883.1| LuxR [Acidovorax citrulli]
          Length = 242

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 44/236 (18%), Positives = 73/236 (30%), Gaps = 19/236 (8%)

Query: 30  SDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLV----RWDLFQEQKLDS-IVSSDWPF 84
            D + R                    +G  HF L     R D     +    ++S ++P 
Sbjct: 4   RDFIQRANQALTQTELLACFEQAVLLLGYQHFSLCYVQLRQDGSGTSQPPIGVLSHNYPS 63

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFH----------TLPENITPPAGMDNRYCSLT 134
             V             V +   +   P                 +    AG+ +      
Sbjct: 64  RWVSHYIARNYYLEDPVRRHAPQAMSPYRWKDVSAQGDREAHIMDEATDAGLADGLGLPI 123

Query: 135 FDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQAN----MFKSYDVHWGKDFELTGRE 190
            +         +   +   +  D       L           F +         +LT RE
Sbjct: 124 HEPGGRIFLATVASHQQLTLGNDACVRAYALVTAFHALYTMRFATEQTQIPTAVKLTSRE 183

Query: 191 VECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            ECLTW++ GK+S EI  I+ IS +TVN ++ + M K  T +R  A   A    ++
Sbjct: 184 AECLTWVAYGKSSREIGRIMRISEHTVNFHLKNAMAKFDTASRVTAAVRAANLGLI 239


>gi|330941017|gb|EGH43939.1| putative LuxR family regulatory protein [Pseudomonas syringae pv.
           pisi str. 1704B]
          Length = 262

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 43/232 (18%), Positives = 80/232 (34%), Gaps = 19/232 (8%)

Query: 33  LARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSI-VSSDWPFDLVRCMA 91
            + +        W   +  +   +G +H+L+    +          V + +P   + C  
Sbjct: 5   FSELAREHNPCDWERHLRKVMRQLGFAHYLISLSPMRPWTGNPLAGVITTFPRTWLDCYC 64

Query: 92  LSEKDKYYNVLQRPTELFCPVFH-----------TLPENITPPAGMDNRYCSLTFDVARI 140
                    +L+   +   P+F                      G+ +          R+
Sbjct: 65  CDGLLDIDPILKHCRQELVPMFWAQQGRRARGRTRHFWQRREEHGLCHGLSIP-LRYERL 123

Query: 141 RIGLMLLFPKGRIILRD-----RLWEIGLLAAYQANMFKSYDVHWGK-DFELTGREVECL 194
           R  L + F    +   D         + +L  Y  +            + +LT RE+ECL
Sbjct: 124 RGTLSVAFDGTGVHEDDGFAHPAAALLFMLVPYLVSGLGRRWQTDNPCNDDLTPRELECL 183

Query: 195 TWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            W S GKTS EI+ IL  S  TV+ ++ +  RK  + +R  A+  A    ++
Sbjct: 184 YWASAGKTSWEISHILTRSERTVDFHLLNARRKLGSVSRQQAVGSAAARGLL 235


>gi|319943177|ref|ZP_08017460.1| autoinducer-binding transcriptional regulator [Lautropia mirabilis
           ATCC 51599]
 gi|319743719|gb|EFV96123.1| autoinducer-binding transcriptional regulator [Lautropia mirabilis
           ATCC 51599]
          Length = 236

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 38/231 (16%), Positives = 75/231 (32%), Gaps = 15/231 (6%)

Query: 29  RSDLLARMIP-LDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLV 87
           + DL+  +             +   +  +G  H            +      +D+P D  
Sbjct: 5   QDDLIGAVSGDSASEREVFECIQRASRALGFQHVSYGFQAPLPLSRPKFTWLNDYPGDWQ 64

Query: 88  RCMALSEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVAR 139
                +        + R  +   P                     G+ + +   T     
Sbjct: 65  THYMDAGYPAVDPRIIRARQSSEPFIWNETLFSEVPELWADLQARGIQHGWSQSTLHEPG 124

Query: 140 IRIGLMLLFPK---GRIILRDR--LWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECL 194
               L L        + +      +  + LLA    +      +       LT RE+E L
Sbjct: 125 GIGMLSLCRSTPITEQDLQTRLQHMQWLALLAHKAFSKLIRARIASNAPS-LTERELEVL 183

Query: 195 TWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
            W ++GK++ +IA IL +S+NTV+ +I + + K     ++ A+  AV   +
Sbjct: 184 RWTADGKSAQDIAEILLLSKNTVDFHIRNSINKLDVPNKTAAVVRAVLLGL 234


>gi|111017172|ref|YP_700144.1| response regulator, two-component system [Rhodococcus jostii RHA1]
 gi|110816702|gb|ABG91986.1| response regulator, two-component system [Rhodococcus jostii RHA1]
          Length = 219

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 33/240 (13%), Positives = 71/240 (29%), Gaps = 26/240 (10%)

Query: 7   QVNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRW 66
            + ++L  + E     ++ +    D +  +                    GA+    VR 
Sbjct: 2   PITVLLVDDQELMRMGLNMVLDAQDDITVVGEASD---------------GAAAVAAVRT 46

Query: 67  DLFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGM 126
                  +D  +           +  S              L    F      +      
Sbjct: 47  LEPDVVLMDVRMPVVDGVSATAQILESGV--------ASRVLVMTTFDLDEHAMGALRAG 98

Query: 127 DNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFEL 186
            + +         +   +  +     ++       +  LA +  +           D  L
Sbjct: 99  ASGFLLKDTPSEDLVSAIRSVAAGDAVVSPKVTRRL--LAKFLDDGPGPLRDPEVLDV-L 155

Query: 187 TGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           T RE E L  ++ G ++ EIA  L +S +T+ +++  I+ K   + R  A+  A    +V
Sbjct: 156 TEREREVLQLVATGLSNTEIAGQLFLSESTIKSHVGRILTKLNVRDRVQAVVLAYETGLV 215


>gi|315641236|ref|ZP_07896313.1| DNA-binding response regulator [Enterococcus italicus DSM 15952]
 gi|315483003|gb|EFU73522.1| DNA-binding response regulator [Enterococcus italicus DSM 15952]
          Length = 209

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 38/239 (15%), Positives = 81/239 (33%), Gaps = 32/239 (13%)

Query: 8   VNIVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWD 67
           + ++L  + E     VS   +  D +  +   +                GA         
Sbjct: 2   IRVLLVDDHEMVRIGVSAYLSIQDDIDVIAQAEN---------------GAIGVEKALDL 46

Query: 68  LFQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMD 127
                 +D ++      +  + +  +              +    F    +         
Sbjct: 47  RPDVILMDLVMDVMDGIEATKEILHAW--------PEAKIIIVTSFIDDEKVYPAIEAGA 98

Query: 128 NRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELT 187
           + Y   T     I   +  ++  GR++      ++           ++ + ++    ELT
Sbjct: 99  SGYLLKTSAAHDIAQAIRTIYQGGRVVEPQVSNKL---------RNETSNRNFHLHDELT 149

Query: 188 GREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
            RE E L  IS GK++ EIA  L I+  TV  ++++I+ K   + R+ A  YA ++  +
Sbjct: 150 NREKEVLQLISNGKSNQEIADELFITLKTVKTHVSNILSKLEVEDRTQAAIYAFKHGYI 208


>gi|16519915|ref|NP_444035.1| LuxR-type transcription regulator BxrH [Sinorhizobium fredii
           NGR234]
 gi|2495427|sp|P55629|Y4QH_RHISN RecName: Full=Putative HTH-type transcriptional regulator y4qH
 gi|2182594|gb|AAB92463.1| LuxR-type transcription regulator BxrH [Sinorhizobium fredii
           NGR234]
          Length = 326

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 43/247 (17%), Positives = 75/247 (30%), Gaps = 22/247 (8%)

Query: 19  RTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIV 78
           R  +V  L    DL   +            + A     G             +       
Sbjct: 81  RDEYVVELGRLLDLTDGVAQPKKLFDL---LSAFAFKFGCKWLAYGPLTSDHKALNRVKC 137

Query: 79  SS----DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPE-------------NIT 121
            S    ++P            +    V++       P+  +                +  
Sbjct: 138 DSEEILNYPDGWRERCLEMGYETIAPVIKESRMGAGPIRWSDMYSDASTTEYERRMFDEA 197

Query: 122 PPAGMDNRYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDV--H 179
              G+ +               +       R      +  + L A +             
Sbjct: 198 AMFGLRSGITVPLRGPRGSCAIMSFARHCEREFHDRTIAYLQLAATHFHLRVAKIANLNA 257

Query: 180 WGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAY 239
             K   L+ RE EC+ W++ GK+S +I VI+ IS NTVN +I ++MRK  T +R+ A   
Sbjct: 258 VQKIPALSLREKECVLWVARGKSSWDIGVIMRISENTVNFHIKNVMRKLGTSSRTVAAIK 317

Query: 240 AVRNNIV 246
           A+   I+
Sbjct: 318 AISLGII 324


>gi|224476907|ref|YP_002634513.1| putative two-component response regulator [Staphylococcus carnosus
           subsp. carnosus TM300]
 gi|222421514|emb|CAL28328.1| putative two-component response regulator [Staphylococcus carnosus
           subsp. carnosus TM300]
          Length = 209

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 31/178 (17%), Positives = 65/178 (36%), Gaps = 14/178 (7%)

Query: 69  FQEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDN 128
            Q+   D ++      ++       +  K +  ++         +      I+      +
Sbjct: 46  AQKILPDIVLLDLVMPEMNGIEVTEKLKKEFPSIKIL---VLTSYADDEHVISAINKGAD 102

Query: 129 RYCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTG 188
            Y     +   +   +  +    +II  +    I  +A    +             +L+ 
Sbjct: 103 GYEMKDVEPDELIQSIHKVLEGNKIIHPEVQKVIEDVAKKPHH-----------INKLSN 151

Query: 189 REVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           RE E L  +++GKT+ EIA  L +S  TV  +++ I  K     R+ A  YA+ N ++
Sbjct: 152 RETEVLKEMAKGKTNKEIAEALYVSEKTVKTHVSHIFSKLQVTDRTQAAIYAMENKLI 209


>gi|197344637|gb|ACH69668.1| LuxR family transcriptional regulator [uncultured proteobacterium]
          Length = 246

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 42/230 (18%), Positives = 74/230 (32%), Gaps = 15/230 (6%)

Query: 32  LLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVRCMA 91
           L+A +I          RM A     G  H L               ++S +P        
Sbjct: 16  LIASVIEATDEADLLKRMQAAAVASGFEHVLFGIELRRPFLDPIQHITSGYPDSYQEIYR 75

Query: 92  LSEKDKYYNVLQRPTELFCPVFHTLPE---------NITPPAGMDNRYCSLTFDVARIRI 142
                     +        P+                 +   G+ + +     D   +  
Sbjct: 76  TKGFISRDPSVAYCQTHTKPLIWGEDMYLADSYEIMEESTKYGLSHGFSVPVRDGPHVVS 135

Query: 143 GLMLLFPKGRIILRD--RLWEIGLLAAYQANMFKSYDVHWGKDFEL----TGREVECLTW 196
            L L   K      +   + + G++ A   ++     +    +  L    + RE ECL W
Sbjct: 136 MLSLARDKPFESAAEKKLVVDAGMVLANCVHVASKNIIVPDVETTLRPKLSRREHECLKW 195

Query: 197 ISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           I+EGK++  I+ +L IS  TV  +I ++  K    TR  A    V   ++
Sbjct: 196 IAEGKSNGVISDLLKISEPTVEFHIRNLFTKLNVATRVQAAVVGVLMGLI 245


>gi|229133094|ref|ZP_04261931.1| DNA-binding response regulator [Bacillus cereus BDRD-ST196]
 gi|228650370|gb|EEL06368.1| DNA-binding response regulator [Bacillus cereus BDRD-ST196]
          Length = 211

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 31/220 (14%), Positives = 67/220 (30%), Gaps = 16/220 (7%)

Query: 26  LPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSSDWPF 84
           L    D       L   +        + E   G      V+ +      +D  +      
Sbjct: 5   LLLVEDHHIVRRGLVFFLKTREEFEIIGEAANGEEALTFVQTERPDVVLMDLSMPKMDGI 64

Query: 85  DLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIRIGL 144
           +  + +      +Y   ++         F      +       + Y        ++   +
Sbjct: 65  EATKRI-----KQYDETIKILMLSS---FSEQDYVLPALEAGADGYQLKEVQPDQLVASI 116

Query: 145 MLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGREVECLTWISEGKTSD 204
           + ++             +                       LT RE E L  I++G+++ 
Sbjct: 117 VAVYQGNANFHPKVTPAL-------LGRSAVKKEKENPFSMLTKREQEVLREIAKGRSNK 169

Query: 205 EIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNN 244
           EIA  L I+  TV  ++++++ K     R+ A  YAV++ 
Sbjct: 170 EIAAELHITEQTVKTHVSNVLAKLEVDDRTQAALYAVKHG 209


>gi|298253881|ref|ZP_06977468.1| response regulator of two-component system [Gardnerella vaginalis
           5-1]
 gi|297532024|gb|EFH70999.1| response regulator of two-component system [Gardnerella vaginalis
           5-1]
          Length = 257

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 38/254 (14%), Positives = 75/254 (29%), Gaps = 35/254 (13%)

Query: 22  FVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYV-GASHFLLVRWDLFQEQKLDSIVSS 80
            V  +    D           ++    M+ + +   G+    L +        +D  +  
Sbjct: 8   GVIRVAIADDQELVRAGFAMVINSQQDMHVVYQASNGSQIVELSKSQNPDIILMDVRMPV 67

Query: 81  DWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARI 140
               +  R +   + ++          +    F      +       + +     +   +
Sbjct: 68  MDGLEATRKILQQKTNEN------TKIIILTTFDLDEYVMAAIHAGASGFLLKDTEPETL 121

Query: 141 RIGLMLLFPKGRIILRDRLWEIG----------------------------LLAAYQANM 172
              +  ++    II       +                             + A   A  
Sbjct: 122 LNSIRTVYQGNAIIAPTATKRLIENMIQQGKVATNTTENSAANYTAQVSYDVQANPAAQE 181

Query: 173 FKSYDVHWGKDFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKT 232
            +S         ELT RE E L  I+ G ++ EIA  L IS  TV  ++A I+ K   + 
Sbjct: 182 TQSCAYTNSAITELTDREREVLVEIAHGLSNQEIADKLFISLPTVKTHVAHILGKIGARD 241

Query: 233 RSGAIAYAVRNNIV 246
           R  A+ +A  N +V
Sbjct: 242 RVQAVVFAYENGLV 255


>gi|119715674|ref|YP_922639.1| response regulator receiver [Nocardioides sp. JS614]
 gi|119536335|gb|ABL80952.1| response regulator receiver [Nocardioides sp. JS614]
          Length = 213

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 33/237 (13%), Positives = 72/237 (30%), Gaps = 27/237 (11%)

Query: 10  IVLNREDEQRTSFVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLF 69
           +++  + E     ++ L      +  +                    G     L      
Sbjct: 1   MLVVDDQELFRRGLTMLLGTEAGIEVVGEAGD---------------GVEGTNLAATAAP 45

Query: 70  QEQKLDSIVSSDWPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNR 129
               LD  +      +    +           +     +   V     +         + 
Sbjct: 46  DVVLLDIRMPKRSGIEACLAIKE--------AVPSAKIIMLTVSDEEADLYEAVKSGASG 97

Query: 130 YCSLTFDVARIRIGLMLLFPKGRIILRDRLWEIGLLAAYQANMFKSYDVHWGKDFELTGR 189
           Y      +  +   + ++     +I      ++      +       +        LT R
Sbjct: 98  YLLKDSSIEEVAQAVRVVADGQSLISPSMAVKL----IDEFKQMSRPERDHVPGLRLTER 153

Query: 190 EVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E+E L  +++G  + EIA  L IS NTV N++ +I+ K    +R  A+ YAV+  ++
Sbjct: 154 ELEVLRLVAKGMNNREIAKELFISENTVKNHVRNILEKLQLHSRMEAVMYAVKEKLL 210


>gi|322382401|ref|ZP_08056304.1| two-component response regulator-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321153618|gb|EFX45997.1| two-component response regulator-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 230

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 33/237 (13%), Positives = 68/237 (28%), Gaps = 25/237 (10%)

Query: 22  FVSHLPTRSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSD 81
                    + L R+I ++  +             G     L          +D  +  +
Sbjct: 5   LADDHQLFREGLKRIINMEDDMEVVGECG-----DGIQVIELCNEIQPDVVLMDINMPLE 59

Query: 82  WPFDLVRCMALSEKDKYYNVLQRPTELFCPVFHTLPENITPPAGMDNRYCSLTFDVARIR 141
                   + L        +      +   +               + Y     +   + 
Sbjct: 60  NGVVATERLKL--------IFPDIKIIILSIHDDESYVFETLRKGASGYLLKDMEAESLI 111

Query: 142 IGLMLLFPKGRIILRDRLWEI------------GLLAAYQANMFKSYDVHWGKDFELTGR 189
             +  +      I      ++              +A        +          LT R
Sbjct: 112 NAIRSVVAGHAYIHPKVTGKLINQLRRMTYLDHTGVAGGNPAHDSALRYIDSPSSPLTKR 171

Query: 190 EVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           E E L  ++EG+++  I   L IS  TV N+++SI++K     R+ A+  A++N  V
Sbjct: 172 EAEVLRLMAEGRSNKSIGEYLYISEKTVKNHVSSILQKMEVDDRTQAVIIAIKNGWV 228


>gi|193066393|ref|ZP_03047441.1| regulatory protein SdiA [Escherichia coli E22]
 gi|192925978|gb|EDV80624.1| regulatory protein SdiA [Escherichia coli E22]
          Length = 240

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 38/231 (16%), Positives = 70/231 (30%), Gaps = 13/231 (5%)

Query: 29  RSDLLARMIPLDCTVSWTMRMYALTEYVGASHFLLVRWDLFQEQKLDSIVSSDWPFDLVR 88
           R  +L R   ++        +    + +   ++ L         +      +++P   V 
Sbjct: 10  RRTMLLRFQRMEAAEEVYHEIELQAQQLEYDYYSLCVRHPVPFTRPKVAFYTNYPEAWVS 69

Query: 89  CMALSEKDKYYNVLQRPTELFCPVFHTL--------PENITPPAGMDNRYCSLTFDVARI 140
                       VL         +                    G+            R 
Sbjct: 70  YYQAKNFLAIDPVLNPENFSQGHLMWNDDLFSEAQPLWEAARAHGLRRGVTQYLMLPNRA 129

Query: 141 RIGLMLLF---PKGRIILRDRLWEIGLLAAYQANMFKSYDV--HWGKDFELTGREVECLT 195
              L        +  I+  +   ++ LL           +       +   + RE E L 
Sbjct: 130 LGFLSFSRCSTREIPILSDELQLKMQLLVCESLMALMRLNDEIVMTPEMNFSKREKEILK 189

Query: 196 WISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNIV 246
           W +EGKTS EIA+IL IS NTVN +  ++ +K     ++    YA    ++
Sbjct: 190 WTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI 240


>gi|256376857|ref|YP_003100517.1| LuxR family transcriptional regulator [Actinosynnema mirum DSM
           43827]
 gi|255921160|gb|ACU36671.1| two component transcriptional regulator, LuxR family [Actinosynnema