RPSBLAST alignment for GI: 254780694 and conserved domain: smart00421

>gnl|CDD|128698 smart00421, HTH_LUXR, helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon. Length = 58
 Score = 77.2 bits (191), Expect = 3e-15
 Identities = 25/55 (45%), Positives = 36/55 (65%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYA 240
           LT RE E L  ++EG T+ EIA  LGIS  TV  ++++IMRK   ++R+ A+  A
Sbjct: 4   LTPREREVLRLLAEGLTNKEIAERLGISEKTVKTHLSNIMRKLGVRSRTQAVRLA 58