RPSBLAST alignment for GI: 254780694 and conserved domain: TIGR03020

>gnl|CDD|163106 TIGR03020, EpsA, transcriptional regulator EpsA. Proteins in this family include a C-terminal LuxR transcriptional regulator domain (pfam00196). These proteins are positioned proximal to either EpsH-containing exopolysaccharide biosynthesis operons of the Methylobacillus type, or the associated PEP-CTERM-containing genes. Length = 247
 Score = 63.3 bits (154), Expect = 6e-11
 Identities = 26/57 (45%), Positives = 38/57 (66%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           +T RE E L W+ +GKT++EIA ILGIS  TV N++  I +K   + R+ A+A A+ 
Sbjct: 191 ITAREAEILAWVRDGKTNEEIAAILGISSLTVKNHLQHIFKKLDVRNRAQAVAKAIA 247