RPSBLAST alignment of GI: 254780694 and protein with PDBid: 1p4w

>1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 Length = 99
 Score = 77.2 bits (190), Expect = 4e-15
 Identities = 17/64 (26%), Positives = 26/64 (40%)

Query: 183 DFELTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVR 242
           D  L+ +E E L   +EG    EIA  L  S  T+++   S M K         + Y   
Sbjct: 32  DKRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVDNDIALLNYLSS 91

Query: 243 NNIV 246
            ++ 
Sbjct: 92  VSMT 95