RPSBLAST alignment of GI: 254780694 and protein with PDBid: 1x3u

>1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} Length = 79
 Score = 71.3 bits (175), Expect = 2e-13
 Identities = 17/61 (27%), Positives = 28/61 (45%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE + L+ +  G  +  IA  L IS  TV  + A++M K   K+    +  A+    
Sbjct: 17  LSERERQVLSAVVAGLPNKSIAYDLDISPRTVEVHRANVMAKMKAKSLPHLVRMALAGGF 76

Query: 246 V 246
            
Sbjct: 77  G 77