RPSBLAST alignment of GI: 254780694 and protein with PDBid: 3clo

>3clo_A Transcriptional regulator; NP_811094.1, bacterial regulatory proteins, LUXR family, structural genomics; 2.04A {Bacteroides thetaiotaomicron vpi-5482} Length = 258
 Score = 75.5 bits (185), Expect = 1e-14
 Identities = 22/61 (36%), Positives = 31/61 (50%)

Query: 186 LTGREVECLTWISEGKTSDEIAVILGISRNTVNNYIASIMRKTATKTRSGAIAYAVRNNI 245
           L+ RE E L  I +G +S EIA  L IS NTVN +  +I+ K +      A   A    +
Sbjct: 198 LSEREKEILRCIRKGLSSKEIAATLYISVNTVNRHRQNILEKLSVGNSIEACRAAELMKL 257

Query: 246 V 246
           +
Sbjct: 258 L 258