RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780697|ref|YP_003065110.1| large conductance mechanosensitive channel protein [Candidatus Liberibacter asiaticus str. psy62] (141 letters) >gnl|CDD|32153 COG1970, MscL, Large-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane]. Length = 130 Score = 121 bits (305), Expect = 7e-29 Identities = 62/140 (44%), Positives = 89/140 (63%), Gaps = 19/140 (13%) Query: 7 VFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPL 66 + EFK+F RGNV+DL+VG+IIG AF ++V S+V DI+MPL+G ++G G DFSN F+ L Sbjct: 3 MLKEFKEFALRGNVVDLAVGVIIGAAFGKIVTSLVNDIIMPLIGLLVG-GLDFSNLFITL 61 Query: 67 SSEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVVFVLIQFMNKLVKQTENVKN--- 123 V AYG+F ++NF I+A +F++++ +NKL ++ E + Sbjct: 62 ------------GIPAVVIAYGAFIQAVINFLIIAFAIFLVVKAINKLRRKLEKEEPEAP 109 Query: 124 ---PPAEVQLLTEIRDLLQK 140 PPAE LLTEIRDLL+K Sbjct: 110 APAPPAEEVLLTEIRDLLKK 129 >gnl|CDD|145084 pfam01741, MscL, Large-conductance mechanosensitive channel, MscL. Length = 127 Score = 105 bits (263), Expect = 6e-24 Identities = 57/133 (42%), Positives = 83/133 (62%), Gaps = 14/133 (10%) Query: 9 NEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLSS 68 EFK+F RGNV+DL+VG++IGGAF ++V S+V DI+MPL+G ++G G DFS+ + L Sbjct: 3 KEFKEFAMRGNVVDLAVGVVIGGAFGKIVSSLVADIIMPLIGRLLG-GVDFSDLSITLIG 61 Query: 69 EIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVVFVLIQFMNKLVKQTE---NVKNPP 125 ++ YG F ++NF I+A +F++I+ +NKL K+ E P Sbjct: 62 DVG----------AVTLNYGLFIQAVINFLIIAFAIFLVIKAINKLRKKEEVEEAEAVPD 111 Query: 126 AEVQLLTEIRDLL 138 A+ LLTEIRDLL Sbjct: 112 AQEVLLTEIRDLL 124 >gnl|CDD|39764 KOG4564, KOG4564, KOG4564, Adenylate cyclase-coupled calcitonin receptor [Signal transduction mechanisms]. Length = 473 Score = 26.9 bits (59), Expect = 2.0 Identities = 7/21 (33%), Positives = 12/21 (57%) Query: 89 SFASVLVNFFILAGVVFVLIQ 109 ++LVNF L +V +L+ Sbjct: 316 ILLAILVNFIFLINIVRILVT 336 >gnl|CDD|143404 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2. Methylmalonate semialdehyde dehydrogenase (MMSDH, EC=1.2.1.27) [acylating] from Bacillus subtilis is involved in valine metabolism and catalyses the NAD+- and CoA-dependent oxidation of methylmalonate semialdehyde into propionyl-CoA. Mitochondrial human MMSDH ALDH6A1 and Arabidopsis MMSDH ALDH6B2 are also present in this CD. Length = 478 Score = 26.7 bits (60), Expect = 2.4 Identities = 17/66 (25%), Positives = 26/66 (39%), Gaps = 10/66 (15%) Query: 23 LSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLSSE-----IKSSLISE 77 LSV + +G + + +VE VG G D P+ S I+ LI Sbjct: 281 LSVAVAVGDEADEWIPKLVERAKKLKVGAGDDPGADMG----PVISPAAKERIE-GLIES 335 Query: 78 ARKQGA 83 ++GA Sbjct: 336 GVEEGA 341 >gnl|CDD|30370 COG0020, UppS, Undecaprenyl pyrophosphate synthase [Lipid metabolism]. Length = 245 Score = 26.4 bits (58), Expect = 3.1 Identities = 17/57 (29%), Positives = 25/57 (43%) Query: 78 ARKQGAVFAYGSFASVLVNFFILAGVVFVLIQFMNKLVKQTENVKNPPAEVQLLTEI 134 A+K+G G A IL + + I+++ TEN K P EV L E+ Sbjct: 31 AKKRGLPRIEGHKAGAKALREILEWCLELGIKYLTLYAFSTENWKRPKEEVSFLMEL 87 >gnl|CDD|144739 pfam01255, Prenyltransf, Putative undecaprenyl diphosphate synthase. Previously known as uncharacterized protein family UPF0015, a single member of this family has been identified as an undecaprenyl diphosphate synthase. Length = 222 Score = 26.0 bits (58), Expect = 3.7 Identities = 10/24 (41%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Query: 118 TENVKNPPAEVQLLTE-IRDLLQK 140 TEN K P EV L E + + L++ Sbjct: 49 TENWKRPKEEVDFLMELLEEKLRR 72 >gnl|CDD|38080 KOG2869, KOG2869, KOG2869, Meiotic cell division protein Pelota/DOM34 [Translation, ribosomal structure and biogenesis]. Length = 379 Score = 26.0 bits (57), Expect = 4.1 Identities = 9/31 (29%), Positives = 14/31 (45%) Query: 95 VNFFILAGVVFVLIQFMNKLVKQTENVKNPP 125 V ++A FV QFM+ L +Q + Sbjct: 202 VKCVVVASPGFVKDQFMDYLFQQAVKLDLKL 232 >gnl|CDD|33296 COG3493, CitS, Na+/citrate symporter [Energy production and conversion]. Length = 438 Score = 25.9 bits (57), Expect = 4.3 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 11/89 (12%) Query: 18 GNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLSSEIKSSLISE 77 G V +VGI++G F Q + +++P++G MG G +PL SEI SS+ Sbjct: 147 GMVGAAAVGILVGLLFGLSFQDTMMYVVLPIMGGGMGAGA------VPL-SEIYSSIT-- 197 Query: 78 ARKQGAVFAYGSFASVLVNFF--ILAGVV 104 Q F+ A + N F I A ++ Sbjct: 198 GGSQEEYFSQLIPALTIGNVFAIICAALL 226 >gnl|CDD|143938 pfam00171, Aldedh, Aldehyde dehydrogenase family. This family of dehydrogenases act on aldehyde substrates. Members use NADP as a cofactor. The family includes the following members: The prototypical members are the aldehyde dehydrogenases EC:1.2.1.3. Succinate-semialdehyde dehydrogenase EC:1.2.1.16. Lactaldehyde dehydrogenase EC:1.2.1.22. Benzaldehyde dehydrogenase EC:1.2.1.28. Methylmalonate-semialdehyde dehydrogenase EC:1.2.1.27. Glyceraldehyde-3-phosphate dehydrogenase EC:1.2.1.9. Delta-1-pyrroline-5-carboxylate dehydrogenase EC: 1.5.1.12. Acetaldehyde dehydrogenase EC:1.2.1.10. Glutamate-5-semialdehyde dehydrogenase EC:1.2.1.41. This family also includes omega crystallin, an eye lens protein from squid and octopus that has little aldehyde dehydrogenase activity. Length = 459 Score = 25.6 bits (57), Expect = 4.7 Identities = 27/107 (25%), Positives = 46/107 (42%), Gaps = 24/107 (22%) Query: 21 IDLSVGIIIGGAF----------NR--VVQSIVEDIMMPLV----GCVMGNGTDFSNYFL 64 +D +V + GAF +R V +SI ++ + LV +G+ D Sbjct: 250 LDAAVEGAVFGAFGNAGQVCTAGSRLLVHESIYDEFVERLVEAAKSLKVGDPLDPDTDIG 309 Query: 65 PLSSEIKS----SLISEARKQGAVFAYGSFASVLVNFF----ILAGV 103 PL S+ + S I +A+++GA G A + +F +LA V Sbjct: 310 PLISKKQRERVLSYIEDAKEEGAKLLCGGEAGLEKGYFVEPTVLADV 356 >gnl|CDD|36292 KOG1076, KOG1076, KOG1076, Translation initiation factor 3, subunit c (eIF-3c) [Translation, ribosomal structure and biogenesis]. Length = 843 Score = 25.0 bits (54), Expect = 7.2 Identities = 11/28 (39%), Positives = 16/28 (57%) Query: 113 KLVKQTENVKNPPAEVQLLTEIRDLLQK 140 K V + ENVK P ++ L E+ D L + Sbjct: 92 KEVDEKENVKVPRFYIKTLVELEDFLNE 119 >gnl|CDD|147666 pfam05625, PAXNEB, PAXNEB protein. PAXNEB or PAX6 neighbour is found in several eukaryotic organisms. PAXNED is an RNA polymerase II Elongator protein subunit. It is part of the HAP subcomplex of Elongator, which is a six-subunit component of the RNA polymerase II holoenzyme. The HAP subcomplex is required for Elongator structural integrity and histone acetyltransferase activity. This protein family has a P-loop motif. However its sequence has degraded in many members of the family. Length = 353 Score = 24.6 bits (54), Expect = 9.8 Identities = 21/59 (35%), Positives = 26/59 (44%), Gaps = 18/59 (30%) Query: 64 LPLSSEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVV-----FVLI---QFMNKL 114 LPL S S LI E FASVL+ +F GVV FV Q++ +L Sbjct: 43 LPLGS---SLLIEEDG-------TTDFASVLLRYFAAEGVVQNHHVFVASLPEQWLREL 91 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.325 0.141 0.395 Gapped Lambda K H 0.267 0.0736 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,647,277 Number of extensions: 81807 Number of successful extensions: 378 Number of sequences better than 10.0: 1 Number of HSP's gapped: 371 Number of HSP's successfully gapped: 28 Length of query: 141 Length of database: 6,263,737 Length adjustment: 84 Effective length of query: 57 Effective length of database: 4,448,581 Effective search space: 253569117 Effective search space used: 253569117 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (23.8 bits)