RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780697|ref|YP_003065110.1| large conductance mechanosensitive channel protein [Candidatus Liberibacter asiaticus str. psy62] (141 letters) >d2oara1 f.16.1.1 (A:10-118) Gated mechanosensitive channel {Mycobacterium tuberculosis [TaxId: 1773]} Length = 109 Score = 101 bits (254), Expect = 2e-23 Identities = 35/121 (28%), Positives = 56/121 (46%), Gaps = 13/121 (10%) Query: 16 ARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLSSEIKSSLI 75 ARGN++DL+V ++IG AF +V + I+ PL+ + N ++ Sbjct: 1 ARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNAQS------------DVGIL 48 Query: 76 SEARKQGAVFAYGSFASVLVNFFILAGVV-FVLIQFMNKLVKQTENVKNPPAEVQLLTEI 134 G S +NFF++A V F+++ N L K+ E + +V LLTEI Sbjct: 49 RIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKKGEVEQPGDTQVVLLTEI 108 Query: 135 R 135 R Sbjct: 109 R 109 >d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Length = 382 Score = 30.1 bits (66), Expect = 0.071 Identities = 7/23 (30%), Positives = 11/23 (47%) Query: 4 GTPVFNEFKKFIARGNVIDLSVG 26 GT +F + + I+LS G Sbjct: 12 GTTIFTQMSALAQQHQAINLSQG 34 >d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Length = 418 Score = 29.8 bits (65), Expect = 0.086 Identities = 5/23 (21%), Positives = 11/23 (47%) Query: 4 GTPVFNEFKKFIARGNVIDLSVG 26 V+ E+ + A+ ++L G Sbjct: 12 TKSVWVEYIQLAAQYKPLNLGQG 34 >d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Length = 418 Score = 27.8 bits (60), Expect = 0.35 Identities = 6/23 (26%), Positives = 11/23 (47%) Query: 4 GTPVFNEFKKFIARGNVIDLSVG 26 + EF K + +V++L G Sbjct: 11 DYNPWVEFVKLASEHDVVNLGQG 33 >d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Length = 368 Score = 26.6 bits (57), Expect = 0.83 Identities = 4/23 (17%), Positives = 7/23 (30%) Query: 4 GTPVFNEFKKFIARGNVIDLSVG 26 +F R ++L G Sbjct: 11 KESIFPRMSGLAQRLGAVNLGQG 33 >d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 494 Score = 25.7 bits (56), Expect = 1.4 Identities = 13/57 (22%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Query: 52 VMGNGTDFSNYFLPLSSEIK----SSLISEARKQGAVFAYGSFASVLVNFFILAGVV 104 V+GN D P E + I+ +++GA G + +FI V Sbjct: 324 VVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVF 380 >d1fvga_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Cow (Bos taurus) [TaxId: 9913]} Length = 192 Score = 24.4 bits (52), Expect = 3.7 Identities = 11/38 (28%), Positives = 13/38 (34%) Query: 81 QGAVFAYGSFASVLVNFFILAGVVFVLIQFMNKLVKQT 118 Q AVF G F F+ L GV + F Sbjct: 38 QMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNP 75 >d1yuda1 b.82.1.16 (A:1-158) Hypothetical protein SO0799 {Shewanella oneidensis [TaxId: 70863]} Length = 158 Score = 24.1 bits (52), Expect = 4.5 Identities = 7/25 (28%), Positives = 13/25 (52%) Query: 48 LVGCVMGNGTDFSNYFLPLSSEIKS 72 LVGC++ G F ++ L + + Sbjct: 118 LVGCMVSPGFTFDDFELFSQEALLA 142 >d1v30a_ d.269.1.1 (A:) Hypothetical protein PH0828 {Pyrococcus horikoshii [TaxId: 53953]} Length = 118 Score = 24.1 bits (52), Expect = 4.7 Identities = 5/23 (21%), Positives = 9/23 (39%) Query: 84 VFAYGSFASVLVNFFILAGVVFV 106 + YG+ + L G F+ Sbjct: 4 IAVYGTLRKGKPLHWYLKGAKFL 26 >d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Length = 412 Score = 24.1 bits (51), Expect = 4.8 Identities = 7/29 (24%), Positives = 9/29 (31%), Gaps = 2/29 (6%) Query: 1 MFQGTPVFNEFKKFIA--RGNVIDLSVGI 27 Q VF F ++L VG Sbjct: 11 QAQPVLVFKLIADFREDPDPRKVNLGVGA 39 >d1xhsa_ d.269.1.1 (A:) Hypothetical protein YtfP {Escherichia coli [TaxId: 562]} Length = 113 Score = 24.2 bits (52), Expect = 5.2 Identities = 5/23 (21%), Positives = 8/23 (34%) Query: 84 VFAYGSFASVLVNFFILAGVVFV 106 +F YGS N + + Sbjct: 3 IFVYGSLRHKQGNSHWMTNAQLL 25 >d2i5nm1 f.26.1.1 (M:1-323) M (medium) subunit {Rhodopseudomonas viridis [TaxId: 1079]} Length = 323 Score = 23.9 bits (52), Expect = 5.3 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Query: 85 FAYGSFASVLVNFFILAGVVFVLIQFMNKLVKQTENVKNPPAEVQL 130 FA+GS A +++ F + A V F +QF + + P A+ + Sbjct: 59 FAFGSTAILIILFNMAAEVHFDPLQFFRQFF--WLGLYPPKAQYGM 102 >d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 Score = 23.6 bits (50), Expect = 7.5 Identities = 9/56 (16%), Positives = 16/56 (28%), Gaps = 2/56 (3%) Query: 22 DLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFSNYFLPLSSEIKSSLISE 77 D+ + +GG + + L GCV + L S + Sbjct: 133 DVVGILYVGGLPINYTTRRIGPVTYSLDGCV--RNLHMEQAPVDLDQPTSSFHVGT 186 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.325 0.141 0.395 Gapped Lambda K H 0.267 0.0381 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 495,695 Number of extensions: 20536 Number of successful extensions: 90 Number of sequences better than 10.0: 1 Number of HSP's gapped: 88 Number of HSP's successfully gapped: 17 Length of query: 141 Length of database: 2,407,596 Length adjustment: 77 Effective length of query: 64 Effective length of database: 1,350,386 Effective search space: 86424704 Effective search space used: 86424704 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.2 bits)