BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780697|ref|YP_003065110.1| large conductance mechanosensitive channel protein [Candidatus Liberibacter asiaticus str. psy62] (141 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780697|ref|YP_003065110.1| large conductance mechanosensitive channel protein [Candidatus Liberibacter asiaticus str. psy62] Length = 141 Score = 280 bits (717), Expect = 5e-78, Method: Compositional matrix adjust. Identities = 141/141 (100%), Positives = 141/141 (100%) Query: 1 MFQGTPVFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFS 60 MFQGTPVFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFS Sbjct: 1 MFQGTPVFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDIMMPLVGCVMGNGTDFS 60 Query: 61 NYFLPLSSEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVVFVLIQFMNKLVKQTEN 120 NYFLPLSSEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVVFVLIQFMNKLVKQTEN Sbjct: 61 NYFLPLSSEIKSSLISEARKQGAVFAYGSFASVLVNFFILAGVVFVLIQFMNKLVKQTEN 120 Query: 121 VKNPPAEVQLLTEIRDLLQKN 141 VKNPPAEVQLLTEIRDLLQKN Sbjct: 121 VKNPPAEVQLLTEIRDLLQKN 141 >gi|254780195|ref|YP_003064608.1| CTP synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 544 Score = 24.6 bits (52), Expect = 0.73, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 9/56 (16%) Query: 7 VFNEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVEDI-MMPLVGCVMGNGTDFSN 61 V NE K+FI +GN V IGG + DI +MP V + G +FS+ Sbjct: 118 VTNEIKEFITQGNEDADFVICEIGGT--------IGDIEVMPFVEAIRQFGNEFSH 165 >537021.9.peg.1142_1 Length = 218 Score = 22.3 bits (46), Expect = 3.7, Method: Compositional matrix adjust. Identities = 7/17 (41%), Positives = 13/17 (76%) Query: 31 GAFNRVVQSIVEDIMMP 47 GAFN V++ ++D++ P Sbjct: 179 GAFNHFVRNSIDDVLNP 195 >gi|254780576|ref|YP_003064989.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 597 Score = 22.3 bits (46), Expect = 4.0, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 20/35 (57%) Query: 88 GSFASVLVNFFILAGVVFVLIQFMNKLVKQTENVK 122 G+ SV+ + F++ G+ F+L L++Q+ K Sbjct: 33 GAMFSVIASKFVILGIPFLLKWVTESLIEQSTASK 67 >gi|254780184|ref|YP_003064597.1| excinuclease ABC subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 959 Score = 21.9 bits (45), Expect = 4.6, Method: Composition-based stats. Identities = 9/25 (36%), Positives = 14/25 (56%) Query: 115 VKQTENVKNPPAEVQLLTEIRDLLQ 139 ++Q NP + V +TEI D L+ Sbjct: 88 IEQKNTSHNPRSTVGTITEIHDYLR 112 >gi|254780439|ref|YP_003064852.1| carbamoyl phosphate synthase large subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 1162 Score = 20.8 bits (42), Expect = 9.1, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 17/35 (48%) Query: 9 NEFKKFIARGNVIDLSVGIIIGGAFNRVVQSIVED 43 N K ++ V D +I+GG NR+ Q I D Sbjct: 604 NFINKPVSEDKVSDRKKIVILGGGPNRIGQGIEFD 638 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.141 0.395 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,240 Number of Sequences: 1233 Number of extensions: 3306 Number of successful extensions: 16 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 9 length of query: 141 length of database: 328,796 effective HSP length: 66 effective length of query: 75 effective length of database: 247,418 effective search space: 18556350 effective search space used: 18556350 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 34 (17.7 bits)