Query         gi|254780699|ref|YP_003065112.1| hypothetical protein CLIBASIA_02930 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 97
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 23785
Date          Tue May 31 16:30:02 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780699.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 2z5b_A Protein YPL144W, DMP1;   23.2      29  0.0012   15.3   1.6   18   75-92     32-49  (151)
  2 1w8g_A YGGS, hypothetical UPF0  17.9      26  0.0011   15.5   0.5   11   85-95     79-89  (234)
  3 3cpg_A Uncharacterized protein  14.6      36  0.0015   14.7   0.5   11   85-95    117-127 (282)
  4 3hf5_A 4-methylmuconolactone m  14.0      63  0.0027   13.2   3.1   30   47-76     25-54  (116)
  5 2c0n_A A197; thermophilic prot  13.8      22 0.00092   16.0  -0.8   21   52-72    145-165 (203)
  6 1ct5_A Protein (yeast hypothet  13.4      40  0.0017   14.4   0.5   11   85-95     87-97  (256)
  7 1cmb_A Met APO-repressor; DNA-  10.7      67  0.0028   13.1   0.9   12   77-88     19-30  (104)
  8 3bz1_E Cytochrome B559 subunit   7.3      94  0.0039   12.2   0.5   25   48-72     29-57  (84)
  9 2rf4_B DNA-directed RNA polyme   7.0 1.2E+02  0.0049   11.6   2.7   26    6-31     38-68  (87)
 10 2kaf_A Non-structural protein    6.8 1.2E+02  0.0049   11.6   1.0   28   55-82     12-39  (67)

No 1  
>2z5b_A Protein YPL144W, DMP1; proteasome, chaperone; 1.96A {Saccharomyces cerevisiae} PDB: 2z5c_A
Probab=23.22  E-value=29  Score=15.27  Aligned_cols=18  Identities=44%  Similarity=0.654  Sum_probs=13.0

Q ss_pred             EECCCCCCEEEEEEECCC
Q ss_conf             703465210689960200
Q gi|254780699|r   75 IASQSKKIPVSIYIGNIQ   92 (97)
Q Consensus        75 iasqskkipvsiyigniq   92 (97)
                      ..-.|||+|+|+-+|--|
T Consensus        32 v~~~skK~PISlvv~~k~   49 (151)
T 2z5b_A           32 ADDRSKKIPISLVVGFKQ   49 (151)
T ss_dssp             SSCSSSSSCEEEEEEECC
T ss_pred             CCCCCCCCCEEEEEECCC
T ss_conf             676788787599984154


No 2  
>1w8g_A YGGS, hypothetical UPF0001 protein YGGS; structural genomics, hypothetical protein, putative enzyme with PLP-binding domain; HET: PLP ICT; 2.0A {Escherichia coli}
Probab=17.89  E-value=26  Score=15.50  Aligned_cols=11  Identities=45%  Similarity=0.664  Sum_probs=9.0

Q ss_pred             EEEEECCCCCC
Q ss_conf             89960200126
Q gi|254780699|r   85 SIYIGNIQKNK   95 (97)
Q Consensus        85 siyigniqknk   95 (97)
                      --+||++|.||
T Consensus        79 WHfIG~LQsNK   89 (234)
T 1w8g_A           79 WHFIGPLQSNK   89 (234)
T ss_dssp             EEECSCCCGGG
T ss_pred             EEEECCCCHHH
T ss_conf             99825741012


No 3  
>3cpg_A Uncharacterized protein; unknown protein, TIM barrel, monomer, structural genomics, PSI-2, protein structure initiative; 1.71A {Bifidobacterium adolescentis ATCC15703}
Probab=14.59  E-value=36  Score=14.71  Aligned_cols=11  Identities=45%  Similarity=0.573  Sum_probs=9.1

Q ss_pred             EEEEECCCCCC
Q ss_conf             89960200126
Q gi|254780699|r   85 SIYIGNIQKNK   95 (97)
Q Consensus        85 siyigniqknk   95 (97)
                      --+||.+|.||
T Consensus       117 WHfIG~LQsNK  127 (282)
T 3cpg_A          117 FHLIGQLQSNK  127 (282)
T ss_dssp             EEECSCCCGGG
T ss_pred             EEEECCCCHHH
T ss_conf             99944642000


No 4  
>3hf5_A 4-methylmuconolactone methylisomerase; ferredoxin, ferredoxin-like fold, beta-barrel, biodegradation, ortho- cleavage; HET: 3ML; 1.40A {Pseudomonas reinekei} PDB: 3hds_A* 3hfk_A* 2ifx_A*
Probab=14.04  E-value=63  Score=13.21  Aligned_cols=30  Identities=13%  Similarity=0.092  Sum_probs=22.5

Q ss_pred             HHHHHHHHHHHCCCHHCCCCCCEEEEEEEE
Q ss_conf             999999998634310003688237888870
Q gi|254780699|r   47 TKEFMEYWIAHSSRAWRTSKPRTYLNLHIA   76 (97)
Q Consensus        47 tkefmeywiahssrawrtskprtylnlhia   76 (97)
                      ..+|.+||-.|..-+-+...-+.|.--++.
T Consensus        25 ~eeF~~yw~~Hapl~~~~pgl~~y~~~~v~   54 (116)
T 3hf5_A           25 HEQFRKECVVHFQMSAGMPGLHKYEVRLVA   54 (116)
T ss_dssp             HHHHHHHHHHHHHHTTTCTTCSEEEEEEEE
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCEEEEEEC
T ss_conf             999999999999998648673308999752


No 5  
>2c0n_A A197; thermophilic protein, thermophilic virus, STIV; 1.86A {Sulfolobus turreted icosahedral virus}
Probab=13.84  E-value=22  Score=15.96  Aligned_cols=21  Identities=38%  Similarity=0.621  Sum_probs=16.0

Q ss_pred             HHHHHHCCCHHCCCCCCEEEE
Q ss_conf             999863431000368823788
Q gi|254780699|r   52 EYWIAHSSRAWRTSKPRTYLN   72 (97)
Q Consensus        52 eywiahssrawrtskprtyln   72 (97)
                      .-||....--+-|.|||||.-
T Consensus       145 phwigedvyff~thkprtyal  165 (203)
T 2c0n_A          145 PHWIGEDVYFFSTHKPRTYAL  165 (203)
T ss_dssp             ---CCHHHHHHHHHCCCEEEE
T ss_pred             CCCCCCEEEEEECCCCCHHHH
T ss_conf             861365069998168605245


No 6  
>1ct5_A Protein (yeast hypothetical protein, selenoMet); TIM barrel, pyridoxal-5'-phosphate, selenomethionine, MAD, structural genomics, PSI; HET: PLP; 2.00A {Saccharomyces cerevisiae} SCOP: c.1.6.2 PDB: 1b54_A*
Probab=13.39  E-value=40  Score=14.38  Aligned_cols=11  Identities=45%  Similarity=0.703  Sum_probs=8.5

Q ss_pred             EEEEECCCCCC
Q ss_conf             89960200126
Q gi|254780699|r   85 SIYIGNIQKNK   95 (97)
Q Consensus        85 siyigniqknk   95 (97)
                      --+||.+|.||
T Consensus        87 WHfIG~LQsNK   97 (256)
T 1ct5_A           87 WHFIGGLQTNK   97 (256)
T ss_dssp             EEECSCCCGGG
T ss_pred             EEEECCCCHHH
T ss_conf             89966532116


No 7  
>1cmb_A Met APO-repressor; DNA-binding regulatory protein; 1.80A {Escherichia coli} SCOP: a.43.1.5 PDB: 1cma_A 1cmc_A* 1mjl_A* 1mj2_A 1mjk_A* 1mjm_A 1mjo_A* 1mjp_A 1mjq_A*
Probab=10.73  E-value=67  Score=13.07  Aligned_cols=12  Identities=58%  Similarity=0.603  Sum_probs=6.4

Q ss_pred             CCCCCCEEEEEE
Q ss_conf             346521068996
Q gi|254780699|r   77 SQSKKIPVSIYI   88 (97)
Q Consensus        77 sqskkipvsiyi   88 (97)
                      .|-|||.|||-+
T Consensus        19 eqVKKiTVsIP~   30 (104)
T 1cmb_A           19 EQVKKITVSIPL   30 (104)
T ss_dssp             CCEEEEEEEEEH
T ss_pred             HHHHEEEEEEEH
T ss_conf             555035676108


No 8  
>3bz1_E Cytochrome B559 subunit alpha; electron transport photosystem, membrane complex, transmembrane alpha-helix; HET: CLA PHO HEM PL9 BCR DGD LHG SQD LMG LMT; 2.90A {Thermosynechococcus elongatus} PDB: 1s5l_E* 1w5c_E* 2axt_E* 3bz2_E* 3kzi_E* 1izl_E* 3a0b_E* 3a0h_E*
Probab=7.29  E-value=94  Score=12.19  Aligned_cols=25  Identities=24%  Similarity=0.574  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHCC----CHHCCCCCCEEEE
Q ss_conf             999999986343----1000368823788
Q gi|254780699|r   48 KEFMEYWIAHSS----RAWRTSKPRTYLN   72 (97)
Q Consensus        48 kefmeywiahss----rawrtskprtyln   72 (97)
                      --|..-|+--|+    .+.-|..|..|..
T Consensus        29 slFiaGwLFVstGLAYdvFGtPrpneYft   57 (84)
T 3bz1_E           29 ALFIAGWLFVSTGLAYDVFGTPRPDSYYA   57 (84)
T ss_dssp             HHHHHHHHHHHTSHHHHHTTCCCTTCSSC
T ss_pred             HHHHHHHHHEECCCCCCCCCCCCCCCCCC
T ss_conf             89872255301473200268998111124


No 9  
>2rf4_B DNA-directed RNA polymerase I subunit RPA4; transferase DNA/RNA, DNA-binding, phosphorylation, POL I, POLI, rpoli, nuclear protein; 3.10A {Saccharomyces cerevisiae}
Probab=6.96  E-value=1.2e+02  Score=11.65  Aligned_cols=26  Identities=46%  Similarity=0.703  Sum_probs=14.3

Q ss_pred             HHHHHHH--HHCCC--CCH-HHHHHHHHHHH
Q ss_conf             8999997--50002--001-68899998899
Q gi|254780699|r    6 QFIENIL--KEDRE--DNN-IKSLAQLQRIA   31 (97)
Q Consensus         6 qfienil--kedre--dnn-ikslaqlqria   31 (97)
                      ||.+...  ||+--  |.| -.+|+||.|+.
T Consensus        38 qFL~~FI~eKE~~~~~Dt~lssaLaQLKRvq   68 (87)
T 2rf4_B           38 QFLESFIDEKENIIDIDTNLSSSISQLKRIQ   68 (87)
T ss_dssp             HHHHHHHHHHHSSSCCCTTHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             9999999876654200003457899999998


No 10 
>2kaf_A Non-structural protein 3; SARS-unique domain-C, automation in structure determination, viral protein; NMR {Sars coronavirus}
Probab=6.84  E-value=1.2e+02  Score=11.61  Aligned_cols=28  Identities=36%  Similarity=0.502  Sum_probs=0.0

Q ss_pred             HHHCCCHHCCCCCCEEEEEEEECCCCCC
Q ss_conf             8634310003688237888870346521
Q gi|254780699|r   55 IAHSSRAWRTSKPRTYLNLHIASQSKKI   82 (97)
Q Consensus        55 iahssrawrtskprtylnlhiasqskki   82 (97)
                      .|.+-|.|.-|..||-|....-....||
T Consensus        12 lag~yrdwsysgqrtelgveflkrgdki   39 (67)
T 2kaf_A           12 LAGSYRDWSYSGQRTELGVEFLKRGDKI   39 (67)
T ss_dssp             HHTEETTEECCCCEETTEEEEEEETTEE
T ss_pred             ECCEECCCCCCCCCHHHHHHHHHCCCEE
T ss_conf             0120113443572203466888568889


Done!