RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254780699|ref|YP_003065112.1| hypothetical protein
CLIBASIA_02930 [Candidatus Liberibacter asiaticus str. psy62]
         (97 letters)



>gnl|CDD|144986 pfam01602, Adaptin_N, Adaptin N terminal region.  This family
           consists of the N terminal region of various alpha, beta
           and gamma subunits of the AP-1, AP-2 and AP-3 adaptor
           protein complexes. The adaptor protein (AP) complexes
           are involved in the formation of clathrin-coated pits
           and vesicles. The N-terminal region of the various
           adaptor proteins (APs) is constant by comparison to the
           C-terminal which is variable within members of the AP-2
           family; and it has been proposed that this constant
           region interacts with another uniform component of the
           coated vesicles.
          Length = 534

 Score = 26.1 bits (58), Expect = 2.4
 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 7/49 (14%)

Query: 5   NQFIENILKEDREDNNIKSLAQLQRIAIRTVLANRTKNIKSITKEFMEY 53
           N  I   L +D  D +I+  A    + +   L +   N+K I KE +EY
Sbjct: 314 NLKIFFCLSDD--DISIRLRA----LDLLYKLVDE-SNVKEIVKELLEY 355


>gnl|CDD|36263 KOG1045, KOG1045, KOG1045, Uncharacterized conserved protein
           HEN1/CORYMBOSA2 [Function unknown].
          Length = 404

 Score = 25.0 bits (54), Expect = 5.4
 Identities = 8/39 (20%), Positives = 15/39 (38%)

Query: 55  IAHSSRAWRTSKPRTYLNLHIASQSKKIPVSIYIGNIQK 93
              +   WR    R  L   + S+   +P+ +  GN+  
Sbjct: 82  FNETKSVWRGPSVRPILGDFLRSRQLPLPILLLSGNVVD 120


>gnl|CDD|99978 cd03806, GT1_ALG11_like, This family is most closely related to the
           GT1 family of glycosyltransferases. ALG11 in yeast is
           involved in adding the final 1,2-linked Man to the
           Man5GlcNAc2-PP-Dol synthesized on the cytosolic face of
           the ER. The deletion analysis of ALG11 was shown to
           block the early steps of core biosynthesis that takes
           place on the cytoplasmic face of the ER and lead to a
           defect in the assembly of lipid-linked
           oligosaccharides..
          Length = 419

 Score = 24.5 bits (54), Expect = 6.6
 Identities = 14/50 (28%), Positives = 20/50 (40%), Gaps = 8/50 (16%)

Query: 7   FIENILKEDREDNNIKSLAQ--------LQRIAIRTVLANRTKNIKSITK 48
            ++  L E   +N I S+AQ        LQ  A   +L    + IK   K
Sbjct: 226 LLKLPLDEKTRENQILSIAQFRPEKNHPLQLRAFAKLLKRLPEEIKEKIK 275


>gnl|CDD|36389 KOG1174, KOG1174, KOG1174, Anaphase-promoting complex (APC),
           subunit 7 [Cell cycle control, cell division, chromosome
           partitioning, Posttranslational modification, protein
           turnover, chaperones].
          Length = 564

 Score = 24.6 bits (53), Expect = 6.7
 Identities = 10/55 (18%), Positives = 18/55 (32%), Gaps = 3/55 (5%)

Query: 45  SITKEFMEYWIAHSSRAWRTSKPRTYLNL---HIASQSKKIPVSIYIGNIQKNKK 96
           +  K    +W  H+   +   K    LN     I S+ +     I  G +    +
Sbjct: 294 AKVKYTASHWFVHAQLLYDEKKFERALNFVEKCIDSEPRNHEALILKGRLLIALE 348


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.319    0.131    0.367 

Gapped
Lambda     K      H
   0.267   0.0755    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 1,078,592
Number of extensions: 43273
Number of successful extensions: 161
Number of sequences better than 10.0: 1
Number of HSP's gapped: 161
Number of HSP's successfully gapped: 13
Length of query: 97
Length of database: 6,263,737
Length adjustment: 65
Effective length of query: 32
Effective length of database: 4,859,152
Effective search space: 155492864
Effective search space used: 155492864
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (23.4 bits)