BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780699|ref|YP_003065112.1| hypothetical protein
CLIBASIA_02930 [Candidatus Liberibacter asiaticus str. psy62]
         (97 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780699|ref|YP_003065112.1| hypothetical protein CLIBASIA_02930 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 97

 Score =  197 bits (500), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 97/97 (100%), Positives = 97/97 (100%)

Query: 1  MLFDNQFIENILKEDREDNNIKSLAQLQRIAIRTVLANRTKNIKSITKEFMEYWIAHSSR 60
          MLFDNQFIENILKEDREDNNIKSLAQLQRIAIRTVLANRTKNIKSITKEFMEYWIAHSSR
Sbjct: 1  MLFDNQFIENILKEDREDNNIKSLAQLQRIAIRTVLANRTKNIKSITKEFMEYWIAHSSR 60

Query: 61 AWRTSKPRTYLNLHIASQSKKIPVSIYIGNIQKNKKI 97
          AWRTSKPRTYLNLHIASQSKKIPVSIYIGNIQKNKKI
Sbjct: 61 AWRTSKPRTYLNLHIASQSKKIPVSIYIGNIQKNKKI 97


>gi|254780546|ref|YP_003064959.1| hypothetical protein CLIBASIA_02165 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 423

 Score = 25.4 bits (54), Expect = 0.19,   Method: Composition-based stats.
 Identities = 10/17 (58%), Positives = 13/17 (76%)

Query: 55 IAHSSRAWRTSKPRTYL 71
          IAHS  +W+ SKP+T L
Sbjct: 82 IAHSVVSWKNSKPQTGL 98


>gi|254781160|ref|YP_003065573.1| 16S rRNA m3U1498 methyltransferase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 245

 Score = 24.3 bits (51), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 22/39 (56%)

Query: 4   DNQFIENILKEDREDNNIKSLAQLQRIAIRTVLANRTKN 42
           D Q+I + +K +R D  I+   ++   AIR V+   T+N
Sbjct: 81  DVQYIFSPIKTNRLDYMIQKSVEMGMGAIRPVITRYTQN 119


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.319    0.131    0.367 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 58,661
Number of Sequences: 1233
Number of extensions: 1801
Number of successful extensions: 4
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of query: 97
length of database: 328,796
effective HSP length: 61
effective length of query: 36
effective length of database: 253,583
effective search space:  9128988
effective search space used:  9128988
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)
S2: 31 (16.5 bits)