HHsearch alignment for GI: 254780700 and conserved domain: COG0265

>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones].
Probab=100.00  E-value=0  Score=473.52  Aligned_cols=306  Identities=38%  Similarity=0.681  Sum_probs=277.4

Q ss_pred             CCHHHHHHHHCCCEEEEEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEEEEC
Q ss_conf             89889999848950899999998722555555445567888770025445530135776666754455522340278975
Q gi|254780700|r   38 VDLPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFIT  117 (489)
Q Consensus        38 ~~~~~~~~~~~paVV~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GsG~ii~  117 (489)
T Consensus        33 ~~~~~~~~~~~~~vV~~~~~~~~~~--------------------~~~~---------~~~---~~~~~~~~~gSg~i~~   80 (347)
T COG0265          33 LSFATAVEKVAPAVVSIATGLTAKL--------------------RSFF---------PSD---PPLRSAEGLGSGFIIS   80 (347)
T ss_pred             CCHHHHHHHCCCCEEEEEECCCCCC--------------------HHHC---------CCC---CCHHHHCCCCCEEEEC
T ss_conf             3578887641687799994133340--------------------2212---------467---4212220334469987


Q ss_pred             CCCEEEECHHCCCCCCEEEEECCCCEEEEECCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCC
Q ss_conf             99629851010478714379628980674011123344432899960676676556556731112414675236655311
Q gi|254780700|r  118 DDGYILTSNHIVEDGASFSVILSDDTELPAKLVGTDALFDLAVLKVQSDRKFIPVEFEDANNIRVGEAVFTIGNPFRLRG  197 (489)
Q Consensus       118 ~~G~ilTn~hvv~~a~~i~V~~~dg~~~~a~vvg~D~~~DlAvlki~~~~~~~~~~lg~s~~~~~G~~v~aiG~P~g~~~  197 (489)
T Consensus        81 ~~g~ivTn~hVi~~a~~i~v~l~dg~~~~a~~vg~d~~~dlavlki~~~~~~~~~~~~~s~~l~vg~~v~aiGnp~g~~~  160 (347)
T COG0265          81 SDGYIVTNNHVIAGAEEITVTLADGREVPAKLVGKDPISDLAVLKIDGAGGLPVIALGDSDKLRVGDVVVAIGNPFGLGQ  160 (347)
T ss_pred             CCCEEEEEEEECCCCCEEEEECCCCCEEEEEEECCCCCCCEEEEEEECCCCCCEEEECCCCCCCCCCEEEECCCCCCCCC
T ss_conf             87169973005156534688836895886688404665526999960678762267133666635874997637767666


Q ss_pred             CCCCCCCCCCCCC-CC--CCCCCEEEEEEEEECCCCCCEEEECCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1125874431122-33--44342023323320134770354034303555123445532222223211233211001000
Q gi|254780700|r  198 TVSAGIVSALDRD-IP--DRPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGVGLIIPLSIIKKAIPSL  274 (489)
Q Consensus       198 tvt~GiiSa~~R~-~~--~~~~~~iqtDa~InpGnSGGpl~n~~G~viGint~i~~~~g~~~GigfaIP~~~~~~i~~~l  274 (489)
T Consensus       161 tvt~Givs~~~r~~v~~~~~~~~~IqtdAain~gnsGgpl~n~~g~~iGint~~~~~~~~~~gigfaiP~~~~~~v~~~l  240 (347)
T COG0265         161 TVTSGIVSALGRTGVGSAGGYVNFIQTDAAINPGNSGGPLVNIDGEVVGINTAIIAPSGGSSGIGFAIPVNLVAPVLDEL  240 (347)
T ss_pred             CEEEEEEECCCCCCCCCCCCCCCEEEECCCCCCCCCCCCEECCCCCEEEEEEEEEECCCCCCCEEEEECHHHHHHHHHHH
T ss_conf             33124682244464335667554475146437898888501467718988866640478655425893188899999988


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCEEEEECCCCCC
Q ss_conf             02333333433200034216676441764444113201111121134671167888752431478743101222035667
Q gi|254780700|r  275 ISKGRVDHGWFGIMTQNLTQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICMLDGRIIKSHQDFVWQIASRSPK  354 (489)
Q Consensus       275 ~~~g~v~rg~lGv~~~~v~~~la~~lgl~~~~GvlV~~V~~~sPA~~AGLk~GDvI~~ing~~I~~~~~l~~~i~~~~~G  354 (489)
T Consensus       241 ~~~G~v~~~~lgv~~~~~~~~~~--~g~~~~~G~~V~~v~~~spa~~agi~~Gdii~~~ng~~v~~~~~l~~~v~~~~~g  318 (347)
T COG0265         241 ISKGKVVRGYLGVIGEPLTADIA--LGLPVAAGAVVLGVLPGSPAAKAGIKAGDIITAVNGKPVASLSDLVAAVASNRPG  318 (347)
T ss_pred             HHCCCCCCCCCCEEEEECCCHHC--CCCCCCCCCEEEEECCCCHHHHCCCCCCCEEEEECCEECCCHHHHHHHHHCCCCC
T ss_conf             65697434635427687451102--6876788768865179985787378778779978998855788888887326999


Q ss_pred             CCEEEEECCCCCEEEECCCCCCC
Q ss_conf             52010120478166512556558
Q gi|254780700|r  355 EQVKISLCKEGSKHSVAVVLGSS  377 (489)
Q Consensus       355 ~~v~l~v~R~g~~~~~~V~l~~~  377 (489)
T Consensus       319 ~~v~~~~~r~g~~~~~~v~l~~~  341 (347)
T COG0265         319 DEVALKLLRGGKERELAVTLGDR  341 (347)
T ss_pred             CEEEEEEEECCEEEEEEEECCCC
T ss_conf             76889999788357776861555