HHsearch alignment for GI: 254780700 and conserved domain: KOG1320

>KOG1320 consensus.
Probab=100.00  E-value=0  Score=318.87  Aligned_cols=303  Identities=25%  Similarity=0.339  Sum_probs=244.9

Q ss_pred             HHHHHHHHCCCEEEEEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEEEECCC
Q ss_conf             88999984895089999999872255555544556788877002544553013577666675445552234027897599
Q gi|254780700|r   40 LPPVIARVSPSIVSVMVEPKKKVSVEQMFNAYGFGNLPEDHPLKNYFRKDFHKFFSGEEPILSDTVERLMFGSGFFITDD  119 (489)
Q Consensus        40 ~~~~~~~~~paVV~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GsG~ii~~~  119 (489)
T Consensus       130 v~~~~~~cd~Avv~Ie~~ef~~-----------------~----------~~~~e~~~--------ip~l~~S~~Vv~gd  174 (473)
T KOG1320         130 VAAVFEECDLAVVYIESEEFWK-----------------G----------MNPFELGD--------IPSLNGSGFVVGGD  174 (473)
T ss_pred             HHHHHHCCCCEEEEEEECCCCC-----------------C----------CCCCCCCC--------CCCCCCCEEEECCC
T ss_conf             7766321553078875123567-----------------7----------76444678--------76556508998388


Q ss_pred             CEEEECHHCCCCCCE-----------EEEECCCC--EEEEECCCCCCCCCCEEEEEEECCCC-CCCCCCCCCCCCCCCCE
Q ss_conf             629851010478714-----------37962898--06740111233444328999606766-76556556731112414
Q gi|254780700|r  120 GYILTSNHIVEDGAS-----------FSVILSDD--TELPAKLVGTDALFDLAVLKVQSDRK-FIPVEFEDANNIRVGEA  185 (489)
Q Consensus       120 G~ilTn~hvv~~a~~-----------i~V~~~dg--~~~~a~vvg~D~~~DlAvlki~~~~~-~~~~~lg~s~~~~~G~~  185 (489)
T Consensus       175 ~i~VTnghV~~~~~~~y~~~~~~l~~vqI~aa~~~~~s~ep~i~g~d~~~gvA~l~ik~~~~i~~~i~~~~s~~~~~G~~  254 (473)
T KOG1320         175 GIIVTNGHVVRVEPRIYAHSSTVLLRVQIDAAIGPGNSGEPVIVGVDKVAGVAFLKIKTPENILYVIPLGVSSHFRTGVE  254 (473)
T ss_pred             CEEEEEEEEEEEEECCCCCCCCEEEEEEEEEEECCCCCCCCEEECCCCCCCEEEEEEECCCCCCCEEECCEEEEEECCEE
T ss_conf             47998358998773134577740126999970068766797686455336548999744886254376343313305718


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCC-------CCCCEEEEEEEEECCCCCCEEEECCCEEEEEECCCCCCCCCCCCC
Q ss_conf             6752366553111125874431122334-------434202332332013477035403430355512344553222222
Q gi|254780700|r  186 VFTIGNPFRLRGTVSAGIVSALDRDIPD-------RPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQFHMGV  258 (489)
Q Consensus       186 v~aiG~P~g~~~tvt~GiiSa~~R~~~~-------~~~~~iqtDa~InpGnSGGpl~n~~G~viGint~i~~~~g~~~Gi  258 (489)
T Consensus       255 ~~a~~~~f~~~nt~~qg~vs~~~R~~~~lg~~~g~~i~~~~qtd~ai~~~nsg~~ll~~DG~~IgVn~~~~~ri~~~~~i  334 (473)
T KOG1320         255 VSAIGNGFGLLNTLTQGMVSGQLRKSFKLGLETGVLISKINQTDAAINPGNSGGPLLNLDGEVIGVNTRKVTRIGFSHGI  334 (473)
T ss_pred             EEECCCCEECCCEEEEEEECCCCCCCCCCCCCCCCEECCEEECCHHHHCCCCCCCEEECCCCEEEEEEEEEEEEECCCCC
T ss_conf             77304770003444641030232576556866551101130254444064689967953684850351037774001363


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCC---------CCCCCCCCCCCCHHHHHH-----HCCCC--CCCCEEEECCCCCCCCCCC
Q ss_conf             3211233211001000023333---------334332000342166764-----41764--4441132011111211346
Q gi|254780700|r  259 GLIIPLSIIKKAIPSLISKGRV---------DHGWFGIMTQNLTQELAI-----PLGLR--GTKGSLITAVVKESPADKA  322 (489)
Q Consensus       259 gfaIP~~~~~~i~~~l~~~g~v---------~rg~lGv~~~~v~~~la~-----~lgl~--~~~GvlV~~V~~~sPA~~A  322 (489)
T Consensus       335 S~~~p~d~vl~~v~r~~e~~~~lr~~~~~~p~~~~~g~~s~~i~~g~vf~~~~~~~~~~~~~~q~v~is~Vlp~~~~~~~  414 (473)
T KOG1320         335 SFKIPIDTVLVIVLRLGEFQISLRPVKPLVPVHQYIGLPSYYIFAGLVFVPLTKSYIFPSGVVQLVLVSQVLPGSINGGY  414 (473)
T ss_pred             EECCCCHHHHHHHHHHHCCCEEECCCCCCCCCCCCCCCEEEEEECCEEEEECCCCCCCCCCCEEEEEEEEECCCCCCCCC
T ss_conf             64057336210132221003231345676665666784049996537885257786665563358999886469976100


Q ss_pred             CCHHHHHHHHHCCCCCCCCCCEEEEECCCCCCCCEEEEECCCCCEEEECCCCCCC
Q ss_conf             7116788875243147874310122203566752010120478166512556558
Q gi|254780700|r  323 GMKVGDVICMLDGRIIKSHQDFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSS  377 (489)
Q Consensus       323 GLk~GDvI~~ing~~I~~~~~l~~~i~~~~~G~~v~l~v~R~g~~~~~~V~l~~~  377 (489)
T Consensus       415 ~~~~g~~V~~vng~~V~n~~~l~~~i~~~~~~~~v~vl~~~~~e~~tl~Il~~~~  469 (473)
T KOG1320         415 GLKPGDQVVKVNGKPVKNLKHLYELIEECSTEDKVAVLDRRSAEDATLEILPEHK  469 (473)
T ss_pred             CCCCCCEEEEECCEEEECHHHHHHHHHHCCCCCEEEEEEECCCCCEEEEEECCCC
T ss_conf             2367878998889885256879999875276766999971476302589502335