HHsearch alignment for GI: 254780700 and conserved domain: KOG1320

>KOG1320 consensus.
Probab=99.96  E-value=7.7e-29  Score=202.52  Aligned_cols=351  Identities=21%  Similarity=0.258  Sum_probs=252.8

Q ss_pred             CCCCCEEEEEECCCCEEEECHHCCC---CCCEEEEECCCC--EEEEECCCCCCCCCCEEEEEEECCC---CCCCCCCCCC
Q ss_conf             5223402789759962985101047---871437962898--0674011123344432899960676---6765565567
Q gi|254780700|r  106 ERLMFGSGFFITDDGYILTSNHIVE---DGASFSVILSDD--TELPAKLVGTDALFDLAVLKVQSDR---KFIPVEFEDA  177 (489)
Q Consensus       106 ~~~~~GsG~ii~~~G~ilTn~hvv~---~a~~i~V~~~dg--~~~~a~vvg~D~~~DlAvlki~~~~---~~~~~~lg~s  177 (489)
T Consensus        84 q~~~~~s~f~i~~~-~lltn~~~v~~~~~~~~v~v~-~~gs~~k~~a~v~~~~~~cd~Avv~Ie~~ef~~~~~~~e~~~i  161 (473)
T KOG1320          84 QFSSGGSGFAIYGK-KLLTNAHVVAPNNDHKFVTVK-KHGSPRKYKAFVAAVFEECDLAVVYIESEEFWKGMNPFELGDI  161 (473)
T ss_pred             HHCCCCCCHHHCCC-CEEECCCCCCCCCCCCCCEEC-CCCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCC
T ss_conf             01246642211042-004447655642354320102-4799666644677663215530788751235677764446787


Q ss_pred             CCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCC-CC--CCCCEEEEEEEEECCCCCCEEEECCCEEEEEECCCCCCCCC
Q ss_conf             3111241467523665531111258744311223-34--43420233233201347703540343035551234455322
Q gi|254780700|r  178 NNIRVGEAVFTIGNPFRLRGTVSAGIVSALDRDI-PD--RPGTFTQIDAPINQGNSGGPCFNALGHVIGVNAMIVTSGQF  254 (489)
Q Consensus       178 ~~~~~G~~v~aiG~P~g~~~tvt~GiiSa~~R~~-~~--~~~~~iqtDa~InpGnSGGpl~n~~G~viGint~i~~~~g~  254 (489)
T Consensus       162 p~l--~~S~~Vv~---gd~i~VTnghV~~~~~~~y~~~~~~l~~vqI~aa~~~~~s~ep~i~g~d~~~gvA~l~ik-~~~  235 (473)
T KOG1320         162 PSL--NGSGFVVG---GDGIIVTNGHVVRVEPRIYAHSSTVLLRVQIDAAIGPGNSGEPVIVGVDKVAGVAFLKIK-TPE  235 (473)
T ss_pred             CCC--CCCEEEEC---CCCEEEEEEEEEEEEECCCCCCCCEEEEEEEEEEECCCCCCCCEEECCCCCCCEEEEEEE-CCC
T ss_conf             655--65089983---884799835899877313457774012699997006876679768645533654899974-488


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCC-HHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHH
Q ss_conf             22223211233211001000023333-334332000342-1667644176444411320111112113467116788875
Q gi|254780700|r  255 HMGVGLIIPLSIIKKAIPSLISKGRV-DHGWFGIMTQNL-TQELAIPLGLRGTKGSLITAVVKESPADKAGMKVGDVICM  332 (489)
Q Consensus       255 ~~GigfaIP~~~~~~i~~~l~~~g~v-~rg~lGv~~~~v-~~~la~~lgl~~~~GvlV~~V~~~sPA~~AGLk~GDvI~~  332 (489)
T Consensus       236 --~i~~~i~~~~s~~~~~G~~~~a~~~~f~~~nt~~qg~vs~~~R~~~~lg~~~g~~i~~~~qtd~ai~~-~nsg~~ll~  312 (473)
T KOG1320         236 --NILYVIPLGVSSHFRTGVEVSAIGNGFGLLNTLTQGMVSGQLRKSFKLGLETGVLISKINQTDAAINP-GNSGGPLLN  312 (473)
T ss_pred             --CCCCEEECCEEEEEECCEEEEECCCCEECCCEEEEEEECCCCCCCCCCCCCCCCEECCEEECCHHHHC-CCCCCCEEE
T ss_conf             --62543763433133057187730477000344464103023257655686655110113025444406-468996795


Q ss_pred             HCCCCCCCC-C-----CEEEEECCCCCCCCEEEEECCCCCEEEECCCCCCCCCCCCCCCCC--CCCCCCCCEEEEECCHH
Q ss_conf             243147874-3-----101222035667520101204781665125565587631000012--46545254698728965
Q gi|254780700|r  333 LDGRIIKSH-Q-----DFVWQIASRSPKEQVKISLCKEGSKHSVAVVLGSSPTAKNDMHLE--VGDKELLGMVLQDINDG  404 (489)
Q Consensus       333 ing~~I~~~-~-----~l~~~i~~~~~G~~v~l~v~R~g~~~~~~V~l~~~p~~~~~~~~~--~~~~~~lGl~v~~l~~~  404 (489)
T Consensus       313 ~DG~~IgVn~~~~~ri~~~~~iS~~~p~d~vl~~v~r~~---e~~~~lr~~~~~~p~~~~~g~~s~~i~~g~vf~~~~~~  389 (473)
T KOG1320         313 LDGEVIGVNTRKVTRIGFSHGISFKIPIDTVLVIVLRLG---EFQISLRPVKPLVPVHQYIGLPSYYIFAGLVFVPLTKS  389 (473)
T ss_pred             CCCCEEEEEEEEEEEEECCCCCEECCCCHHHHHHHHHHH---CCCEEECCCCCCCCCCCCCCCEEEEEECCEEEEECCCC
T ss_conf             368485035103777400136364057336210132221---00323134567666566678404999653788525778


Q ss_pred             HC----CEEEEEEEEECCCCHHHHCCCCCCCEEEEECCEECCCHHHHHHHHHHHHHCCCCEEEEEEEECCCC
Q ss_conf             71----520079996068897898299988899988999938999999999988625995699999717764
Q gi|254780700|r  405 NK----KLVRIVALNPNREREVEAKGIQKGMTIVSVNTHEVSCIKDVERLIGKAKEKKRDSVLLQIKYDPDM  472 (489)
Q Consensus       405